Query         psy12018
Match_columns 148
No_of_seqs    115 out of 1129
Neff          10.8
Searched_HMMs 46136
Date          Fri Aug 16 16:33:00 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy12018.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/12018hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG2462|consensus               99.9 1.9E-24 4.1E-29  142.2   6.6  105   32-140   159-264 (279)
  2 KOG2462|consensus               99.9 1.1E-24 2.3E-29  143.3   5.1  114   31-147   127-243 (279)
  3 KOG3576|consensus               99.7 1.4E-17 3.1E-22  105.5   1.7  117   30-147   113-240 (267)
  4 KOG1074|consensus               99.7 3.5E-17 7.5E-22  121.5   3.3   56   91-147   606-661 (958)
  5 KOG3623|consensus               99.5 4.7E-16   1E-20  114.3  -2.0  106   34-140   210-330 (1007)
  6 KOG3623|consensus               99.5 5.8E-15 1.3E-19  108.7   1.7   76   63-139   894-970 (1007)
  7 KOG1074|consensus               99.5 5.3E-14 1.1E-18  105.0   5.0   56   91-147   880-935 (958)
  8 KOG3576|consensus               99.4 1.4E-14   3E-19   92.1  -0.5   84   61-145   115-199 (267)
  9 KOG3608|consensus               99.4   1E-13 2.2E-18   94.8   3.6  104   39-143   184-316 (467)
 10 KOG3608|consensus               99.4 5.3E-13 1.1E-17   91.4   3.9  107   32-143   235-345 (467)
 11 PLN03086 PRLI-interacting fact  99.3 4.4E-12 9.5E-17   93.1   5.6  109   29-145   448-566 (567)
 12 PHA00733 hypothetical protein   99.2   1E-11 2.3E-16   75.4   2.5   80   62-144    39-124 (128)
 13 PHA02768 hypothetical protein;  99.0 6.8E-11 1.5E-15   60.2   1.0   43   91-136     6-48  (55)
 14 PHA00733 hypothetical protein   99.0 3.6E-10 7.7E-15   68.7   2.5   85   29-115    35-124 (128)
 15 PHA02768 hypothetical protein;  98.8 1.3E-09 2.8E-14   55.5   1.6   41   34-77      5-45  (55)
 16 KOG3993|consensus               98.8 1.4E-09   3E-14   76.4   1.1   81   33-114   266-380 (500)
 17 PF13465 zf-H2C2_2:  Zinc-finge  98.8 3.9E-09 8.5E-14   46.1   1.5   26  105-131     1-26  (26)
 18 PHA00616 hypothetical protein   98.7 8.8E-09 1.9E-13   50.0   2.4   29  119-147     1-29  (44)
 19 PLN03086 PRLI-interacting fact  98.6 2.9E-08 6.3E-13   73.4   4.0   76   62-142   452-537 (567)
 20 PF13465 zf-H2C2_2:  Zinc-finge  98.5 1.7E-08 3.6E-13   44.1   0.1   25   49-74      1-25  (26)
 21 PHA00616 hypothetical protein   98.4 4.5E-08 9.7E-13   47.6   0.3   34   34-68      1-34  (44)
 22 PHA00732 hypothetical protein   98.4 1.1E-07 2.4E-12   52.8   1.6   46   90-141     1-46  (79)
 23 PF05605 zf-Di19:  Drought indu  98.3 1.5E-06 3.3E-11   44.8   4.3   52   90-144     2-54  (54)
 24 PHA00732 hypothetical protein   98.2 1.2E-06 2.5E-11   48.7   2.2   40   34-76      1-40  (79)
 25 PF00096 zf-C2H2:  Zinc finger,  98.2 1.1E-06 2.5E-11   37.0   1.6   22  120-141     1-22  (23)
 26 PF13894 zf-C2H2_4:  C2H2-type   98.1 2.1E-06 4.6E-11   36.4   2.0   24  120-143     1-24  (24)
 27 KOG3993|consensus               98.1 6.6E-07 1.4E-11   63.3   0.3   84   63-146   267-383 (500)
 28 PF13912 zf-C2H2_6:  C2H2-type   98.0 2.4E-06 5.3E-11   37.5   1.4   26  119-144     1-26  (27)
 29 PF00096 zf-C2H2:  Zinc finger,  97.9 8.9E-06 1.9E-10   34.2   1.9   23   91-113     1-23  (23)
 30 PF09237 GAGA:  GAGA factor;  I  97.9 9.7E-06 2.1E-10   40.3   1.9   38  110-147    15-52  (54)
 31 PF13912 zf-C2H2_6:  C2H2-type   97.8 1.1E-05 2.3E-10   35.3   1.0   26   34-59      1-26  (27)
 32 PF13894 zf-C2H2_4:  C2H2-type   97.6 6.4E-05 1.4E-09   31.6   2.0   24   91-114     1-24  (24)
 33 PF12756 zf-C2H2_2:  C2H2 type   97.6 5.2E-05 1.1E-09   43.9   2.3   74   65-143     1-74  (100)
 34 PF12756 zf-C2H2_2:  C2H2 type   97.5 8.2E-05 1.8E-09   43.1   2.2   75   36-115     1-75  (100)
 35 smart00355 ZnF_C2H2 zinc finge  97.5 0.00013 2.9E-09   31.1   2.4   23  120-142     1-23  (26)
 36 PF05605 zf-Di19:  Drought indu  97.4 8.1E-05 1.8E-09   38.3   1.5   37   34-71      2-39  (54)
 37 COG5189 SFP1 Putative transcri  97.2 9.2E-05   2E-09   51.0   0.6   53   88-140   347-419 (423)
 38 COG5189 SFP1 Putative transcri  97.2  0.0002 4.4E-09   49.4   2.0   72   31-111   346-419 (423)
 39 PF09237 GAGA:  GAGA factor;  I  97.2 0.00023   5E-09   35.5   1.6   37   26-63     16-52  (54)
 40 PF13909 zf-H2C2_5:  C2H2-type   97.1 0.00046   1E-08   29.1   1.6   24  120-144     1-24  (24)
 41 PF12874 zf-met:  Zinc-finger o  96.9 0.00055 1.2E-08   29.1   1.3   22  120-141     1-22  (25)
 42 smart00355 ZnF_C2H2 zinc finge  96.8 0.00091   2E-08   28.3   1.7   24   91-114     1-24  (26)
 43 PRK04860 hypothetical protein;  96.8  0.0012 2.7E-08   41.7   2.5   38   90-132   119-156 (160)
 44 PF12171 zf-C2H2_jaz:  Zinc-fin  96.5  0.0023   5E-08   27.8   1.9   22   35-56      2-23  (27)
 45 PRK04860 hypothetical protein;  96.5   0.001 2.2E-08   42.1   0.8   37   34-75    119-155 (160)
 46 PF12874 zf-met:  Zinc-finger o  96.4  0.0026 5.6E-08   27.0   1.5   23   91-113     1-23  (25)
 47 PF13909 zf-H2C2_5:  C2H2-type   96.1   0.006 1.3E-07   25.6   2.0   24   91-115     1-24  (24)
 48 PF12171 zf-C2H2_jaz:  Zinc-fin  95.6  0.0057 1.2E-07   26.5   0.9   21   91-111     2-22  (27)
 49 PF13913 zf-C2HC_2:  zinc-finge  95.5   0.011 2.5E-07   25.1   1.6   19  121-140     4-22  (25)
 50 KOG2893|consensus               94.8   0.006 1.3E-07   40.7  -0.6   48   93-145    13-60  (341)
 51 smart00451 ZnF_U1 U1-like zinc  94.7   0.024 5.3E-07   26.0   1.6   22  119-140     3-24  (35)
 52 smart00451 ZnF_U1 U1-like zinc  94.3   0.022 4.7E-07   26.1   0.9   23   34-56      3-25  (35)
 53 COG4049 Uncharacterized protei  93.5   0.072 1.6E-06   27.2   1.9   27  117-143    15-41  (65)
 54 PF09538 FYDLN_acid:  Protein o  93.3   0.077 1.7E-06   31.4   2.1   33   32-76      7-39  (108)
 55 COG4049 Uncharacterized protei  92.3   0.041 8.9E-07   28.0   0.1   32   28-59     11-42  (65)
 56 KOG1146|consensus               92.2    0.12 2.6E-06   42.8   2.5   75   33-111   464-539 (1406)
 57 cd00350 rubredoxin_like Rubred  90.4    0.23   5E-06   22.6   1.5   10  118-127    16-25  (33)
 58 COG5048 FOG: Zn-finger [Genera  90.3   0.056 1.2E-06   39.2  -0.9   57   89-146   288-350 (467)
 59 COG5048 FOG: Zn-finger [Genera  90.1    0.33 7.2E-06   35.2   3.0   44   33-77    288-337 (467)
 60 PF09986 DUF2225:  Uncharacteri  89.0    0.21 4.6E-06   33.3   1.2   24   32-55      3-26  (214)
 61 TIGR02300 FYDLN_acid conserved  88.6    0.36 7.7E-06   29.3   1.8   33   32-76      7-39  (129)
 62 KOG2231|consensus               88.5    0.36 7.9E-06   37.5   2.2   92   45-144   125-237 (669)
 63 PRK14890 putative Zn-ribbon RN  88.4     1.4   3E-05   22.9   3.7   11  117-127    46-56  (59)
 64 PF04959 ARS2:  Arsenite-resist  87.8    0.19 4.1E-06   33.5   0.4   30   86-115    73-102 (214)
 65 PF09986 DUF2225:  Uncharacteri  87.3    0.16 3.5E-06   33.9  -0.2   16   62-77      4-19  (214)
 66 PRK00464 nrdR transcriptional   86.5    0.58 1.3E-05   29.6   2.0   14   64-77     29-42  (154)
 67 KOG1146|consensus               86.3    0.12 2.7E-06   42.7  -1.3  108   34-145  1228-1354(1406)
 68 COG1592 Rubrerythrin [Energy p  85.7     0.6 1.3E-05   29.9   1.8   24   90-127   134-157 (166)
 69 PF02892 zf-BED:  BED zinc fing  85.5    0.69 1.5E-05   22.4   1.6   26  118-143    15-44  (45)
 70 COG1198 PriA Primosomal protei  85.2    0.87 1.9E-05   36.1   2.7   49   64-128   436-484 (730)
 71 cd00729 rubredoxin_SM Rubredox  84.4    0.99 2.1E-05   20.7   1.7   10  118-127    17-26  (34)
 72 PF10571 UPF0547:  Uncharacteri  84.1    0.86 1.9E-05   19.5   1.4    8   93-100    17-24  (26)
 73 TIGR02605 CxxC_CxxC_SSSS putat  84.0    0.43 9.4E-06   24.0   0.5   12   35-46      6-17  (52)
 74 PF13719 zinc_ribbon_5:  zinc-r  84.0    0.99 2.1E-05   21.0   1.7   10  120-129    26-35  (37)
 75 TIGR02098 MJ0042_CXXC MJ0042 f  84.0    0.94   2E-05   21.1   1.6   10  120-129    26-35  (38)
 76 PF05443 ROS_MUCR:  ROS/MUCR tr  83.1    0.75 1.6E-05   28.3   1.3   24  119-145    72-95  (132)
 77 COG2888 Predicted Zn-ribbon RN  83.0       1 2.2E-05   23.4   1.5   33   62-98     26-58  (61)
 78 TIGR00373 conserved hypothetic  82.7    0.99 2.1E-05   28.7   1.8   30   62-99    108-137 (158)
 79 PRK06266 transcription initiat  82.4     1.1 2.3E-05   29.2   1.9   14   63-76    117-130 (178)
 80 smart00659 RPOLCX RNA polymera  82.3     1.5 3.3E-05   21.4   2.0   10   64-73      3-12  (44)
 81 PF12013 DUF3505:  Protein of u  82.0     1.2 2.6E-05   26.3   1.9   25  120-144    81-109 (109)
 82 PF09723 Zn-ribbon_8:  Zinc rib  81.7     1.1 2.4E-05   21.5   1.4   11   35-45      6-16  (42)
 83 COG1997 RPL43A Ribosomal prote  81.1    0.86 1.9E-05   25.7   1.0   30   63-101    35-64  (89)
 84 PRK09678 DNA-binding transcrip  81.1     0.6 1.3E-05   25.5   0.4   42   64-106     2-45  (72)
 85 smart00614 ZnF_BED BED zinc fi  81.1     1.4 3.1E-05   22.0   1.7   21  121-141    20-45  (50)
 86 PRK00398 rpoP DNA-directed RNA  80.9     1.1 2.4E-05   21.9   1.3   29   63-100     3-31  (46)
 87 smart00531 TFIIE Transcription  80.6     1.5 3.1E-05   27.5   2.0   36   62-100    98-133 (147)
 88 PF13717 zinc_ribbon_4:  zinc-r  80.5     1.6 3.5E-05   20.2   1.7   10  120-129    26-35  (36)
 89 smart00834 CxxC_CXXC_SSSS Puta  80.1    0.91   2E-05   21.4   0.8   11   64-74      6-16  (41)
 90 PF03604 DNA_RNApol_7kD:  DNA d  79.2     1.7 3.7E-05   19.6   1.5    7  120-126    18-24  (32)
 91 PF14353 CpXC:  CpXC protein     78.9    0.61 1.3E-05   28.4  -0.1   42   35-76      2-51  (128)
 92 COG0068 HypF Hydrogenase matur  78.4     1.1 2.4E-05   35.2   1.1   79   35-128   102-182 (750)
 93 PRK14873 primosome assembly pr  77.3       2 4.3E-05   33.9   2.2   10  118-127   421-430 (665)
 94 PF15135 UPF0515:  Uncharacteri  76.8     3.3 7.2E-05   28.3   2.9   21   26-46    104-124 (278)
 95 TIGR00622 ssl1 transcription f  76.4       7 0.00015   23.3   3.9   48   92-142    57-104 (112)
 96 TIGR00595 priA primosomal prot  76.4     2.5 5.3E-05   32.2   2.5   47   65-127   215-261 (505)
 97 KOG4167|consensus               76.3    0.57 1.2E-05   36.7  -0.8   29   31-59    789-817 (907)
 98 COG5236 Uncharacterized conser  76.0     4.6  0.0001   29.1   3.5  102   34-140   151-272 (493)
 99 PHA00626 hypothetical protein   75.8     3.6 7.9E-05   21.1   2.2   11   90-100    23-33  (59)
100 PF12907 zf-met2:  Zinc-binding  75.5     1.2 2.5E-05   21.3   0.4   27  120-146     2-31  (40)
101 PF07975 C1_4:  TFIIH C1-like d  73.4     2.8 6.1E-05   21.2   1.5   23   32-54     19-41  (51)
102 smart00734 ZnF_Rad18 Rad18-lik  73.0     3.5 7.6E-05   17.5   1.6   19  121-140     3-21  (26)
103 PF15269 zf-C2H2_7:  Zinc-finge  72.9     2.6 5.6E-05   20.5   1.2   22  120-141    21-42  (54)
104 KOG2893|consensus               72.6     1.7 3.6E-05   29.5   0.7   40   31-76      8-47  (341)
105 KOG2186|consensus               72.4     2.6 5.7E-05   28.8   1.6   50   64-115     4-53  (276)
106 COG1996 RPC10 DNA-directed RNA  72.3     2.8 6.1E-05   21.0   1.3   10   64-73      7-16  (49)
107 PTZ00255 60S ribosomal protein  71.4     2.7 5.9E-05   24.0   1.3   32   62-102    35-66  (90)
108 PF01780 Ribosomal_L37ae:  Ribo  71.1     1.7 3.6E-05   24.8   0.4   30   63-101    35-64  (90)
109 COG4957 Predicted transcriptio  71.1     2.9 6.3E-05   25.7   1.4   22  120-144    77-98  (148)
110 PF00301 Rubredoxin:  Rubredoxi  69.7     5.4 0.00012   19.8   2.0    7   36-42      3-9   (47)
111 cd00730 rubredoxin Rubredoxin;  69.4       6 0.00013   19.9   2.2    8   36-43      3-10  (50)
112 PF04959 ARS2:  Arsenite-resist  69.2       4 8.7E-05   27.4   1.9   29  118-146    76-104 (214)
113 KOG4173|consensus               68.9     2.2 4.7E-05   28.3   0.6   80   63-144    79-171 (253)
114 PF06524 NOA36:  NOA36 protein;  68.8     1.3 2.7E-05   30.5  -0.5   20  117-136   207-226 (314)
115 KOG4167|consensus               68.3     2.1 4.5E-05   33.8   0.5   25  119-143   792-816 (907)
116 TIGR01206 lysW lysine biosynth  67.4     2.6 5.6E-05   21.6   0.6   10   64-73      3-12  (54)
117 KOG2186|consensus               66.0     2.8 6.1E-05   28.7   0.7   46   34-82      3-48  (276)
118 TIGR00280 L37a ribosomal prote  65.9     2.2 4.8E-05   24.4   0.2   31   63-102    35-65  (91)
119 COG3357 Predicted transcriptio  64.7     3.9 8.5E-05   23.3   1.0   14   62-75     57-70  (97)
120 KOG2785|consensus               64.6     6.5 0.00014   28.6   2.3   53   90-142   166-243 (390)
121 KOG4173|consensus               64.6     2.4 5.3E-05   28.0   0.2   75   35-113    80-169 (253)
122 COG1198 PriA Primosomal protei  63.5     6.7 0.00014   31.4   2.4   45   36-99    437-484 (730)
123 PRK05580 primosome assembly pr  62.9     6.6 0.00014   31.2   2.3   10  118-127   420-429 (679)
124 PF05191 ADK_lid:  Adenylate ki  62.3     3.7 8.1E-05   19.0   0.6   11   91-101     2-12  (36)
125 PF04780 DUF629:  Protein of un  61.8     6.2 0.00014   29.7   1.9   22   91-112    58-79  (466)
126 COG4391 Uncharacterized protei  60.9      13 0.00029   19.5   2.5   45   53-101    15-59  (62)
127 KOG3408|consensus               60.8     5.2 0.00011   24.1   1.1   27   86-112    53-79  (129)
128 PF07754 DUF1610:  Domain of un  60.1     4.7  0.0001   16.9   0.6    8   63-70     16-23  (24)
129 PRK03976 rpl37ae 50S ribosomal  59.9     3.2 6.9E-05   23.7   0.1   30   63-101    36-65  (90)
130 KOG3408|consensus               57.6     7.2 0.00016   23.5   1.3   30   27-56     50-79  (129)
131 COG4530 Uncharacterized protei  57.2     6.8 0.00015   23.2   1.2   27   36-74     11-37  (129)
132 PF13451 zf-trcl:  Probable zin  57.1     2.8   6E-05   21.0  -0.4   13   63-75      4-16  (49)
133 KOG2807|consensus               55.4      22 0.00049   25.5   3.6   24  119-142   345-368 (378)
134 PF02176 zf-TRAF:  TRAF-type zi  54.7     8.9 0.00019   19.6   1.3   40   90-130     9-53  (60)
135 PF08274 PhnA_Zn_Ribbon:  PhnA   54.3     5.6 0.00012   17.7   0.4    9   36-44      4-12  (30)
136 PF12013 DUF3505:  Protein of u  52.8      13 0.00027   21.9   1.9   25   91-115    81-109 (109)
137 PF01927 Mut7-C:  Mut7-C RNAse   52.5      20 0.00042   22.4   2.8   14   91-104   125-138 (147)
138 COG4888 Uncharacterized Zn rib  51.6     7.9 0.00017   22.5   0.8   43   29-76     17-59  (104)
139 PF07800 DUF1644:  Protein of u  51.6      62  0.0014   20.7   5.8   56   89-146    79-135 (162)
140 smart00154 ZnF_AN1 AN1-like Zi  50.9     7.6 0.00016   18.3   0.6   15   34-48     12-26  (39)
141 PRK03824 hypA hydrogenase nick  50.7     8.2 0.00018   23.8   0.9   10   64-73     71-80  (135)
142 PF08271 TF_Zn_Ribbon:  TFIIB z  50.2      17 0.00036   17.4   1.8    7   91-97     20-26  (43)
143 KOG4118|consensus               49.0      10 0.00022   20.2   0.9   30  119-148    38-67  (74)
144 PF08790 zf-LYAR:  LYAR-type C2  48.6     7.9 0.00017   16.9   0.4    8   93-100     3-10  (28)
145 PF10013 DUF2256:  Uncharacteri  48.3      11 0.00023   18.2   0.9   16   92-107    10-25  (42)
146 PF07282 OrfB_Zn_ribbon:  Putat  48.2      18 0.00038   19.2   1.9    9   91-99     47-55  (69)
147 smart00440 ZnF_C2C2 C2C2 Zinc   47.8      22 0.00047   16.8   1.9    9   91-99     29-37  (40)
148 PF01096 TFIIS_C:  Transcriptio  46.3      15 0.00032   17.3   1.2    9   91-99     29-37  (39)
149 cd00924 Cyt_c_Oxidase_Vb Cytoc  45.3      11 0.00024   21.9   0.8   15   32-46     77-91  (97)
150 PF09845 DUF2072:  Zn-ribbon co  45.1      10 0.00022   23.3   0.7   15   34-48      1-15  (131)
151 PRK12380 hydrogenase nickel in  45.0      13 0.00028   22.2   1.1   10   64-73     71-80  (113)
152 PF13453 zf-TFIIB:  Transcripti  44.9      24 0.00052   16.6   1.9   15  121-135    21-35  (41)
153 COG3364 Zn-ribbon containing p  44.6      11 0.00023   22.1   0.6   16   33-48      1-16  (112)
154 PRK03564 formate dehydrogenase  44.6      14 0.00031   26.3   1.4   36   32-71    185-220 (309)
155 TIGR00100 hypA hydrogenase nic  44.3      11 0.00024   22.6   0.7   11   64-74     71-81  (115)
156 smart00661 RPOL9 RNA polymeras  44.3      24 0.00052   17.3   1.9    9   91-99     21-29  (52)
157 PF14369 zf-RING_3:  zinc-finge  44.0      24 0.00052   16.2   1.7   11   65-75     23-33  (35)
158 PF04216 FdhE:  Protein involve  43.8     9.6 0.00021   26.8   0.5   77   34-130   172-249 (290)
159 COG1571 Predicted DNA-binding   43.6      17 0.00038   27.0   1.7   12   90-101   367-378 (421)
160 PF13824 zf-Mss51:  Zinc-finger  43.1      25 0.00053   18.1   1.8    9   63-71     14-22  (55)
161 PF08209 Sgf11:  Sgf11 (transcr  43.1      36 0.00077   15.5   2.2   23   91-114     5-27  (33)
162 COG5236 Uncharacterized conser  42.9      12 0.00026   27.1   0.8   76   35-115   221-306 (493)
163 PF12760 Zn_Tnp_IS1595:  Transp  42.8      25 0.00055   17.0   1.8   10   88-97     35-44  (46)
164 PRK12496 hypothetical protein;  42.5      18 0.00038   23.2   1.5   29   89-130   126-154 (164)
165 COG3677 Transposase and inacti  42.5      21 0.00046   21.9   1.8   14   89-102    52-65  (129)
166 PF01428 zf-AN1:  AN1-like Zinc  42.4     8.5 0.00018   18.5   0.0   16   33-48     12-27  (43)
167 PLN02294 cytochrome c oxidase   42.3      13 0.00029   23.9   0.9   15   32-46    139-153 (174)
168 PF13878 zf-C2H2_3:  zinc-finge  42.2      26 0.00056   16.7   1.7   10  121-130    15-24  (41)
169 KOG2482|consensus               42.1      13 0.00029   26.8   1.0   52   91-142   145-218 (423)
170 PRK00432 30S ribosomal protein  42.0      26 0.00055   17.6   1.7    9   90-98     37-45  (50)
171 COG1655 Uncharacterized protei  41.9     7.9 0.00017   26.3  -0.1    7  120-126    63-69  (267)
172 PF04423 Rad50_zn_hook:  Rad50   41.7      11 0.00025   19.0   0.5   12   92-103    22-33  (54)
173 COG2879 Uncharacterized small   41.2      31 0.00068   18.2   2.0   18  130-147    23-40  (65)
174 smart00132 LIM Zinc-binding do  41.2      28  0.0006   15.4   1.8    6   92-97     29-34  (39)
175 PF01363 FYVE:  FYVE zinc finge  40.6      21 0.00046   18.8   1.4    8   37-44     12-19  (69)
176 KOG2593|consensus               40.4      18 0.00039   26.9   1.4   15   33-47    127-141 (436)
177 KOG2785|consensus               40.3      23  0.0005   26.0   1.9   25  117-141    66-90  (390)
178 COG1675 TFA1 Transcription ini  39.2      22 0.00048   23.2   1.5   14   62-75    112-125 (176)
179 TIGR01562 FdhE formate dehydro  39.1      35 0.00076   24.4   2.6   52   32-99    182-233 (305)
180 PRK00564 hypA hydrogenase nick  39.1      18 0.00039   21.7   1.1   10   35-44     72-81  (117)
181 PF07503 zf-HYPF:  HypF finger;  38.6     3.6 7.8E-05   19.0  -1.5   11  119-129    21-31  (35)
182 PF05495 zf-CHY:  CHY zinc fing  38.1      27 0.00058   18.9   1.6   13   35-47     11-23  (71)
183 PRK04023 DNA polymerase II lar  37.9      82  0.0018   26.7   4.7   10  119-128   663-672 (1121)
184 PF01155 HypA:  Hydrogenase exp  37.6      11 0.00024   22.5   0.0   11   35-45     71-81  (113)
185 KOG3214|consensus               37.6      13 0.00028   21.6   0.3   13  120-132    48-60  (109)
186 COG4338 Uncharacterized protei  36.9      13 0.00029   18.4   0.2   16   92-107    14-29  (54)
187 PF14803 Nudix_N_2:  Nudix N-te  36.5      30 0.00065   15.8   1.4    7   91-97     23-29  (34)
188 PF11789 zf-Nse:  Zinc-finger o  36.1      66  0.0014   16.5   3.1   45   61-124     9-53  (57)
189 KOG2071|consensus               35.8      24 0.00051   27.5   1.5   27  117-143   416-442 (579)
190 COG1594 RPB9 DNA-directed RNA   35.7      36 0.00078   20.3   2.0   18   31-48     19-36  (113)
191 PF11672 DUF3268:  Protein of u  35.4      47   0.001   19.5   2.4    7   91-97     32-38  (102)
192 PF01286 XPA_N:  XPA protein N-  35.1      13 0.00029   17.0   0.1   12  121-132     5-16  (34)
193 COG2331 Uncharacterized protei  35.0      14 0.00029   20.4   0.1   10   91-100    13-22  (82)
194 COG3091 SprT Zn-dependent meta  34.8      20 0.00043   22.7   0.8    8   90-97    140-147 (156)
195 COG1773 Rubredoxin [Energy pro  34.7      15 0.00032   18.9   0.2   10  120-129     4-13  (55)
196 KOG2482|consensus               34.0      24 0.00051   25.6   1.2   23   90-112   195-217 (423)
197 PF06397 Desulfoferrod_N:  Desu  33.5      16 0.00034   17.0   0.2   11   33-43      5-15  (36)
198 cd00065 FYVE FYVE domain; Zinc  33.3      28 0.00061   17.4   1.2   26   65-101     4-29  (57)
199 PRK03681 hypA hydrogenase nick  32.8      24 0.00052   21.1   0.9   10   64-73     71-80  (114)
200 TIGR00143 hypF [NiFe] hydrogen  32.4      25 0.00053   28.3   1.2   80   35-129    69-150 (711)
201 PF09332 Mcm10:  Mcm10 replicat  31.5      19 0.00042   26.1   0.4   42   34-75    252-297 (344)
202 KOG1842|consensus               31.4      23  0.0005   26.6   0.8   32   29-60     10-41  (505)
203 COG5152 Uncharacterized conser  31.2      26 0.00057   23.3   0.9   16   61-76    194-209 (259)
204 KOG2907|consensus               30.9      33 0.00072   20.5   1.2   10   91-100   103-112 (116)
205 TIGR00686 phnA alkylphosphonat  30.8      31 0.00068   20.4   1.1   29   65-103     4-32  (109)
206 KOG4124|consensus               30.6      23 0.00049   25.8   0.7   24   31-54    346-371 (442)
207 PRK10220 hypothetical protein;  29.9      35 0.00075   20.3   1.2   29   65-103     5-33  (111)
208 KOG2231|consensus               29.6      31 0.00068   27.4   1.3   43  102-144   161-207 (669)
209 COG5112 UFD2 U1-like Zn-finger  29.4      34 0.00075   20.2   1.1   28   29-56     50-77  (126)
210 PF03811 Zn_Tnp_IS1:  InsA N-te  29.0      20 0.00043   16.6   0.1    8   89-96     28-35  (36)
211 COG5151 SSL1 RNA polymerase II  28.3      49  0.0011   23.8   1.9   24  119-142   388-411 (421)
212 TIGR00627 tfb4 transcription f  27.9      40 0.00086   23.8   1.4    9   91-99    256-264 (279)
213 PF10276 zf-CHCC:  Zinc-finger   27.3      36 0.00077   16.2   0.8   11   90-100    29-39  (40)
214 PTZ00448 hypothetical protein;  27.2      43 0.00092   24.6   1.5   23  119-141   314-336 (373)
215 smart00064 FYVE Protein presen  27.1      36 0.00079   17.8   1.0   29   63-102    10-38  (68)
216 PF05290 Baculo_IE-1:  Baculovi  26.9      40 0.00086   20.9   1.2   15   61-75     78-92  (140)
217 KOG0402|consensus               26.7      25 0.00055   19.7   0.3   29   64-101    37-65  (92)
218 PF05129 Elf1:  Transcription e  26.5      39 0.00085   18.9   1.0   10   91-100    47-56  (81)
219 PF01215 COX5B:  Cytochrome c o  26.5      29 0.00062   21.6   0.5   16   32-47    110-125 (136)
220 COG4896 Uncharacterized protei  26.2      94   0.002   16.4   2.3    7   91-97     32-38  (68)
221 PF09963 DUF2197:  Uncharacteri  26.0      38 0.00082   17.5   0.8   10  119-128    31-40  (56)
222 TIGR00416 sms DNA repair prote  26.0      46   0.001   25.2   1.6   24   62-98      6-29  (454)
223 KOG1842|consensus               25.8      36 0.00078   25.6   1.0   25   91-115    16-40  (505)
224 PTZ00043 cytochrome c oxidase   25.8      36 0.00078   23.2   0.9   17   30-46    177-193 (268)
225 PRK05978 hypothetical protein;  25.8      43 0.00094   21.1   1.2   11   65-75     54-64  (148)
226 PRK14714 DNA polymerase II lar  25.7      58  0.0012   28.2   2.2   35   64-100   668-702 (1337)
227 PF10537 WAC_Acf1_DNA_bd:  ATP-  25.5      21 0.00046   20.9  -0.2   35   35-71      4-38  (102)
228 PF04780 DUF629:  Protein of un  25.3      56  0.0012   24.9   1.9   14   64-77     58-71  (466)
229 PF04810 zf-Sec23_Sec24:  Sec23  25.3      67  0.0014   15.0   1.6    8   90-97     24-31  (40)
230 PF15616 TerY-C:  TerY-C metal   25.0      74  0.0016   19.7   2.1    8   65-72     79-86  (131)
231 smart00249 PHD PHD zinc finger  24.6      87  0.0019   14.3   2.9   10   64-73     15-24  (47)
232 PRK11823 DNA repair protein Ra  24.6      52  0.0011   24.9   1.7   24   62-98      6-29  (446)
233 PF10083 DUF2321:  Uncharacteri  24.3      59  0.0013   20.7   1.6   18   88-105    66-83  (158)
234 KOG0717|consensus               23.6      47   0.001   25.2   1.2   21  120-140   293-313 (508)
235 smart00731 SprT SprT homologue  23.6      74  0.0016   19.8   2.0   32   90-129   112-143 (146)
236 TIGR00515 accD acetyl-CoA carb  23.6      39 0.00084   23.9   0.8   33   34-76     26-58  (285)
237 PF14787 zf-CCHC_5:  GAG-polypr  23.6      39 0.00086   15.7   0.6   14   92-105     4-17  (36)
238 PLN02748 tRNA dimethylallyltra  23.5      54  0.0012   25.0   1.6   24  118-141   417-441 (468)
239 PF04606 Ogr_Delta:  Ogr/Delta-  23.5      19 0.00041   17.6  -0.5    7   66-72      2-8   (47)
240 PRK00762 hypA hydrogenase nick  23.3      47   0.001   20.2   1.1   13   33-46     69-81  (124)
241 COG4306 Uncharacterized protei  22.8      55  0.0012   20.0   1.2   16   88-103    66-81  (160)
242 PF10263 SprT-like:  SprT-like   22.7      37 0.00081   21.2   0.5   32   90-130   123-154 (157)
243 PLN03238 probable histone acet  22.5      81  0.0018   22.4   2.1   24  117-140    46-69  (290)
244 PF02748 PyrI_C:  Aspartate car  22.4      52  0.0011   16.6   0.9   17   86-102    31-47  (52)
245 PF00412 LIM:  LIM domain;  Int  22.3      59  0.0013   16.1   1.2   12   63-74     26-37  (58)
246 PRK00420 hypothetical protein;  22.0      61  0.0013   19.4   1.3    9   91-99     41-49  (112)
247 COG1327 Predicted transcriptio  22.0      40 0.00088   21.4   0.6   13   64-76     29-41  (156)
248 KOG3507|consensus               21.8      74  0.0016   16.6   1.4   12  119-130    37-48  (62)
249 PRK14892 putative transcriptio  21.8      91   0.002   18.2   2.0    9   33-41     20-28  (99)
250 KOG2272|consensus               21.6 1.1E+02  0.0024   21.3   2.6   13  119-131   221-233 (332)
251 PF03145 Sina:  Seven in absent  21.6      94   0.002   20.4   2.3   12  134-145    62-73  (198)
252 PF14446 Prok-RING_1:  Prokaryo  21.3      33 0.00071   17.6   0.1   10   65-74      7-16  (54)
253 PRK04351 hypothetical protein;  21.1      51  0.0011   20.8   0.9   32   90-130   112-143 (149)
254 COG4640 Predicted membrane pro  20.7      78  0.0017   23.6   1.8   13   64-76     16-28  (465)
255 CHL00174 accD acetyl-CoA carbo  20.2      49  0.0011   23.6   0.7   32   35-76     39-70  (296)
256 PF07295 DUF1451:  Protein of u  20.1      24 0.00053   22.2  -0.7   12   88-99    110-121 (146)
257 KOG4727|consensus               20.0      67  0.0015   20.9   1.2   24   31-54     72-95  (193)

No 1  
>KOG2462|consensus
Probab=99.91  E-value=1.9e-24  Score=142.17  Aligned_cols=105  Identities=23%  Similarity=0.400  Sum_probs=56.0

Q ss_pred             CCccccCccccccCChhHHhcccccccCCCCcccCCCCCCcccccc-cccccccCCCCCceecCccccccccchhHHhhH
Q psy12018         32 YGKFACDVCGKEYQYYRNLYRHKKFECGQEPRYQCPQCPYRTKQKE-LGWESLKPNAYGMYVCDICGKVYQHKRTLYRHK  110 (148)
Q Consensus        32 ~~~~~C~~C~~~f~~~~~l~~h~~~~~~~~~~~~C~~c~~~f~~~~-~~~~~~~~~~~~~~~C~~c~~~f~~~~~l~~H~  110 (148)
                      .+.+.|..|++.|.+...|..|+++|.   -+++|.+||+.|...= ++-+.+.|+|||||.|+.|++.|..+++|+.|+
T Consensus       159 ~ka~~C~~C~K~YvSmpALkMHirTH~---l~c~C~iCGKaFSRPWLLQGHiRTHTGEKPF~C~hC~kAFADRSNLRAHm  235 (279)
T KOG2462|consen  159 KKAFSCKYCGKVYVSMPALKMHIRTHT---LPCECGICGKAFSRPWLLQGHIRTHTGEKPFSCPHCGKAFADRSNLRAHM  235 (279)
T ss_pred             cccccCCCCCceeeehHHHhhHhhccC---CCcccccccccccchHHhhcccccccCCCCccCCcccchhcchHHHHHHH
Confidence            444555555555555555555555553   2455555555555432 334444455555555555555555555555555


Q ss_pred             hhhhCCCCceeCCCChhhhhchHHHHHHHH
Q psy12018        111 KDECGQEPRFQCPQCPYRAKQKANLKTHLI  140 (148)
Q Consensus       111 ~~~~~~~~~~~C~~C~~~f~~~~~l~~H~~  140 (148)
                      ++|.+ .++|+|..|+|.|...+-|.+|..
T Consensus       236 QTHS~-~K~~qC~~C~KsFsl~SyLnKH~E  264 (279)
T KOG2462|consen  236 QTHSD-VKKHQCPRCGKSFALKSYLNKHSE  264 (279)
T ss_pred             HhhcC-CccccCcchhhHHHHHHHHHHhhh
Confidence            55555 445555555555555555555543


No 2  
>KOG2462|consensus
Probab=99.91  E-value=1.1e-24  Score=143.31  Aligned_cols=114  Identities=26%  Similarity=0.479  Sum_probs=99.3

Q ss_pred             CCCccccCccccccCChhHHhcccccccCC--CCcccCCCCCCcccccc-cccccccCCCCCceecCccccccccchhHH
Q psy12018         31 LYGKFACDVCGKEYQYYRNLYRHKKFECGQ--EPRYQCPQCPYRTKQKE-LGWESLKPNAYGMYVCDICGKVYQHKRTLY  107 (148)
Q Consensus        31 ~~~~~~C~~C~~~f~~~~~l~~h~~~~~~~--~~~~~C~~c~~~f~~~~-~~~~~~~~~~~~~~~C~~c~~~f~~~~~l~  107 (148)
                      ....|.|+.|++.+...++|.+|.++|...  .+.+.|+.|++.+.+.. +..+.+.|  .-+++|..||+.|.+.+.|+
T Consensus       127 ~~~r~~c~eCgk~ysT~snLsrHkQ~H~~~~s~ka~~C~~C~K~YvSmpALkMHirTH--~l~c~C~iCGKaFSRPWLLQ  204 (279)
T KOG2462|consen  127 KHPRYKCPECGKSYSTSSNLSRHKQTHRSLDSKKAFSCKYCGKVYVSMPALKMHIRTH--TLPCECGICGKAFSRPWLLQ  204 (279)
T ss_pred             cCCceeccccccccccccccchhhcccccccccccccCCCCCceeeehHHHhhHhhcc--CCCcccccccccccchHHhh
Confidence            455699999999999999999999998753  47899999999999876 33333333  35789999999999999999


Q ss_pred             hhHhhhhCCCCceeCCCChhhhhchHHHHHHHHhhcCCcc
Q psy12018        108 RHKKDECGQEPRFQCPQCPYRAKQKANLKTHLIIKHDSVL  147 (148)
Q Consensus       108 ~H~~~~~~~~~~~~C~~C~~~f~~~~~l~~H~~~~h~~~~  147 (148)
                      .|+|+|+| ||||.|..|+++|..+++|+.||.+|.+-+.
T Consensus       205 GHiRTHTG-EKPF~C~hC~kAFADRSNLRAHmQTHS~~K~  243 (279)
T KOG2462|consen  205 GHIRTHTG-EKPFSCPHCGKAFADRSNLRAHMQTHSDVKK  243 (279)
T ss_pred             cccccccC-CCCccCCcccchhcchHHHHHHHHhhcCCcc
Confidence            99999999 9999999999999999999999999987654


No 3  
>KOG3576|consensus
Probab=99.67  E-value=1.4e-17  Score=105.50  Aligned_cols=117  Identities=25%  Similarity=0.448  Sum_probs=102.0

Q ss_pred             CCCCccccCccccccCChhHHhcccccccCCCCcccCCCCCCcccccc-cccccccCCCCCceecCccccccccchhHHh
Q psy12018         30 KLYGKFACDVCGKEYQYYRNLYRHKKFECGQEPRYQCPQCPYRTKQKE-LGWESLKPNAYGMYVCDICGKVYQHKRTLYR  108 (148)
Q Consensus        30 ~~~~~~~C~~C~~~f~~~~~l~~h~~~~~~~~~~~~C~~c~~~f~~~~-~~~~~~~~~~~~~~~C~~c~~~f~~~~~l~~  108 (148)
                      .+...|.|.+|++.|....-|.+|++-|.. .+-+.|..||+.|...- +..+.+.|+|.+||+|..|++.|...-.|..
T Consensus       113 sd~d~ftCrvCgK~F~lQRmlnrh~kch~~-vkr~lct~cgkgfndtfdlkrh~rthtgvrpykc~~c~kaftqrcsles  191 (267)
T KOG3576|consen  113 SDQDSFTCRVCGKKFGLQRMLNRHLKCHSD-VKRHLCTFCGKGFNDTFDLKRHTRTHTGVRPYKCSLCEKAFTQRCSLES  191 (267)
T ss_pred             CCCCeeeeehhhhhhhHHHHHHHHhhhccH-HHHHHHhhccCcccchhhhhhhhccccCccccchhhhhHHHHhhccHHH
Confidence            345679999999999999999999999877 78899999999999876 5555567899999999999999999999999


Q ss_pred             hHhhhhCC----------CCceeCCCChhhhhchHHHHHHHHhhcCCcc
Q psy12018        109 HKKDECGQ----------EPRFQCPQCPYRAKQKANLKTHLIIKHDSVL  147 (148)
Q Consensus       109 H~~~~~~~----------~~~~~C~~C~~~f~~~~~l~~H~~~~h~~~~  147 (148)
                      |.+.-+|.          ++-|.|..||..-.....+..|++.+|...+
T Consensus       192 hl~kvhgv~~~yaykerr~kl~vcedcg~t~~~~e~~~~h~~~~hp~Sp  240 (267)
T KOG3576|consen  192 HLKKVHGVQHQYAYKERRAKLYVCEDCGYTSERPEVYYLHLKLHHPFSP  240 (267)
T ss_pred             HHHHHcCchHHHHHHHhhhheeeecccCCCCCChhHHHHHHHhcCCCCH
Confidence            98876662          4569999999999999999999999998654


No 4  
>KOG1074|consensus
Probab=99.66  E-value=3.5e-17  Score=121.54  Aligned_cols=56  Identities=29%  Similarity=0.485  Sum_probs=51.8

Q ss_pred             eecCccccccccchhHHhhHhhhhCCCCceeCCCChhhhhchHHHHHHHHhhcCCcc
Q psy12018         91 YVCDICGKVYQHKRTLYRHKKDECGQEPRFQCPQCPYRAKQKANLKTHLIIKHDSVL  147 (148)
Q Consensus        91 ~~C~~c~~~f~~~~~l~~H~~~~~~~~~~~~C~~C~~~f~~~~~l~~H~~~~h~~~~  147 (148)
                      -.|..|.|.+.=.++|+-|.++|+| |+||+|.+||++|.++.+|+.|+.+|-...+
T Consensus       606 NqCiiC~rVlSC~saLqmHyrtHtG-ERPFkCKiCgRAFtTkGNLkaH~~vHka~p~  661 (958)
T KOG1074|consen  606 NQCIICLRVLSCPSALQMHYRTHTG-ERPFKCKICGRAFTTKGNLKAHMSVHKAKPP  661 (958)
T ss_pred             cceeeeeecccchhhhhhhhhcccC-cCccccccccchhccccchhhcccccccCcc
Confidence            3799999999999999999999999 9999999999999999999999998876543


No 5  
>KOG3623|consensus
Probab=99.53  E-value=4.7e-16  Score=114.34  Aligned_cols=106  Identities=25%  Similarity=0.579  Sum_probs=89.8

Q ss_pred             ccccCccccccCChhHHhccccc-ccCCCCcccCCCCCCcccccccccccccCC--------------CCCceecCcccc
Q psy12018         34 KFACDVCGKEYQYYRNLYRHKKF-ECGQEPRYQCPQCPYRTKQKELGWESLKPN--------------AYGMYVCDICGK   98 (148)
Q Consensus        34 ~~~C~~C~~~f~~~~~l~~h~~~-~~~~~~~~~C~~c~~~f~~~~~~~~~~~~~--------------~~~~~~C~~c~~   98 (148)
                      ...|+.|.+.+.+...|+.|++- |..++..|.|..|..+|.+...+.+++..+              .-+.|+|.+|++
T Consensus       210 lltcpycdrgykrltslkeHikyrhekne~nfsC~lCsytFAyRtQLErhm~~hkpg~dqa~sltqsa~lRKFKCtECgK  289 (1007)
T KOG3623|consen  210 LLTCPYCDRGYKRLTSLKEHIKYRHEKNEPNFSCMLCSYTFAYRTQLERHMQLHKPGGDQAISLTQSALLRKFKCTECGK  289 (1007)
T ss_pred             hhcchhHHHHHHHHHHHHHHHHHHHhhCCCCCcchhhhhhhhhHHHHHHHHHhhcCCCcccccccchhhhccccccccch
Confidence            56799999999999999999754 444467799999999999876555544321              136799999999


Q ss_pred             ccccchhHHhhHhhhhCCCCceeCCCChhhhhchHHHHHHHH
Q psy12018         99 VYQHKRTLYRHKKDECGQEPRFQCPQCPYRAKQKANLKTHLI  140 (148)
Q Consensus        99 ~f~~~~~l~~H~~~~~~~~~~~~C~~C~~~f~~~~~l~~H~~  140 (148)
                      .|..+..|..|+|+|.| ||||.|.-|+|.|+.+..+..|+.
T Consensus       290 AFKfKHHLKEHlRIHSG-EKPfeCpnCkKRFSHSGSySSHmS  330 (1007)
T KOG3623|consen  290 AFKFKHHLKEHLRIHSG-EKPFECPNCKKRFSHSGSYSSHMS  330 (1007)
T ss_pred             hhhhHHHHHhhheeecC-CCCcCCcccccccccCCccccccc
Confidence            99999999999999999 999999999999999988888875


No 6  
>KOG3623|consensus
Probab=99.50  E-value=5.8e-15  Score=108.70  Aligned_cols=76  Identities=29%  Similarity=0.549  Sum_probs=50.1

Q ss_pred             cccCCCCCCcccccccccccc-cCCCCCceecCccccccccchhHHhhHhhhhCCCCceeCCCChhhhhchHHHHHHH
Q psy12018         63 RYQCPQCPYRTKQKELGWESL-KPNAYGMYVCDICGKVYQHKRTLYRHKKDECGQEPRFQCPQCPYRAKQKANLKTHL  139 (148)
Q Consensus        63 ~~~C~~c~~~f~~~~~~~~~~-~~~~~~~~~C~~c~~~f~~~~~l~~H~~~~~~~~~~~~C~~C~~~f~~~~~l~~H~  139 (148)
                      .|.|.+|.+.|.-.+.+.+|. .|+|.+||+|.+|.+.|..+..|..|.|.|.| ||||+|..|+|.|+.+..+..||
T Consensus       894 myaCDqCDK~FqKqSSLaRHKYEHsGqRPyqC~iCkKAFKHKHHLtEHkRLHSG-EKPfQCdKClKRFSHSGSYSQHM  970 (1007)
T KOG3623|consen  894 MYACDQCDKAFQKQSSLARHKYEHSGQRPYQCIICKKAFKHKHHLTEHKRLHSG-EKPFQCDKCLKRFSHSGSYSQHM  970 (1007)
T ss_pred             cchHHHHHHHHHhhHHHHHhhhhhcCCCCcccchhhHhhhhhhhhhhhhhhccC-CCcchhhhhhhhcccccchHhhh
Confidence            344444444443333222222 24555566677777777777788888888888 88888888888888888887776


No 7  
>KOG1074|consensus
Probab=99.47  E-value=5.3e-14  Score=104.98  Aligned_cols=56  Identities=27%  Similarity=0.469  Sum_probs=52.2

Q ss_pred             eecCccccccccchhHHhhHhhhhCCCCceeCCCChhhhhchHHHHHHHHhhcCCcc
Q psy12018         91 YVCDICGKVYQHKRTLYRHKKDECGQEPRFQCPQCPYRAKQKANLKTHLIIKHDSVL  147 (148)
Q Consensus        91 ~~C~~c~~~f~~~~~l~~H~~~~~~~~~~~~C~~C~~~f~~~~~l~~H~~~~h~~~~  147 (148)
                      ..|..|++.|...++|..|+++|++ ++||.|..|++.|.+...|..||..|+...+
T Consensus       880 h~C~vCgk~FsSSsALqiH~rTHtg-~KPF~C~fC~~aFttrgnLKvHMgtH~w~q~  935 (958)
T KOG1074|consen  880 HVCNVCGKQFSSSAALEIHMRTHTG-PKPFFCHFCEEAFTTRGNLKVHMGTHMWVQP  935 (958)
T ss_pred             hhhccchhcccchHHHHHhhhcCCC-CCCccchhhhhhhhhhhhhhhhhccccccCC
Confidence            4699999999999999999999999 8999999999999999999999999876543


No 8  
>KOG3576|consensus
Probab=99.43  E-value=1.4e-14  Score=92.08  Aligned_cols=84  Identities=23%  Similarity=0.467  Sum_probs=74.6

Q ss_pred             CCcccCCCCCCccccccccccccc-CCCCCceecCccccccccchhHHhhHhhhhCCCCceeCCCChhhhhchHHHHHHH
Q psy12018         61 EPRYQCPQCPYRTKQKELGWESLK-PNAYGMYVCDICGKVYQHKRTLYRHKKDECGQEPRFQCPQCPYRAKQKANLKTHL  139 (148)
Q Consensus        61 ~~~~~C~~c~~~f~~~~~~~~~~~-~~~~~~~~C~~c~~~f~~~~~l~~H~~~~~~~~~~~~C~~C~~~f~~~~~l~~H~  139 (148)
                      ...|.|..|++.|.....+.+++. |...+.|.|..||+.|...-+|.+|.++|+| -+||+|+.|+|+|.++..|..|+
T Consensus       115 ~d~ftCrvCgK~F~lQRmlnrh~kch~~vkr~lct~cgkgfndtfdlkrh~rthtg-vrpykc~~c~kaftqrcsleshl  193 (267)
T KOG3576|consen  115 QDSFTCRVCGKKFGLQRMLNRHLKCHSDVKRHLCTFCGKGFNDTFDLKRHTRTHTG-VRPYKCSLCEKAFTQRCSLESHL  193 (267)
T ss_pred             CCeeeeehhhhhhhHHHHHHHHhhhccHHHHHHHhhccCcccchhhhhhhhccccC-ccccchhhhhHHHHhhccHHHHH
Confidence            356999999999998776666654 5556889999999999999999999999999 89999999999999999999999


Q ss_pred             HhhcCC
Q psy12018        140 IIKHDS  145 (148)
Q Consensus       140 ~~~h~~  145 (148)
                      +..||-
T Consensus       194 ~kvhgv  199 (267)
T KOG3576|consen  194 KKVHGV  199 (267)
T ss_pred             HHHcCc
Confidence            988763


No 9  
>KOG3608|consensus
Probab=99.43  E-value=1e-13  Score=94.77  Aligned_cols=104  Identities=20%  Similarity=0.407  Sum_probs=78.1

Q ss_pred             ccccccCChhHHhcccccccCCCCcccCCCCCCcccccc-cccccccC----------------------------CCCC
Q psy12018         39 VCGKEYQYYRNLYRHKKFECGQEPRYQCPQCPYRTKQKE-LGWESLKP----------------------------NAYG   89 (148)
Q Consensus        39 ~C~~~f~~~~~l~~h~~~~~~~~~~~~C~~c~~~f~~~~-~~~~~~~~----------------------------~~~~   89 (148)
                      .|-+.|..++.|+.|++.|.+ ||...|+.||.-|.+.. ++.+.+..                            ....
T Consensus       184 ~Ct~~~~~k~~LreH~r~Hs~-eKvvACp~Cg~~F~~~tkl~DH~rRqt~l~~n~fqC~~C~KrFaTeklL~~Hv~rHvn  262 (467)
T KOG3608|consen  184 MCTKHMGNKYRLREHIRTHSN-EKVVACPHCGELFRTKTKLFDHLRRQTELNTNSFQCAQCFKRFATEKLLKSHVVRHVN  262 (467)
T ss_pred             hhhhhhccHHHHHHHHHhcCC-CeEEecchHHHHhccccHHHHHHHhhhhhcCCchHHHHHHHHHhHHHHHHHHHHHhhh
Confidence            377788888888888888877 67777777777777653 22221111                            1124


Q ss_pred             ceecCccccccccchhHHhhHhhhhCCCCceeCCCChhhhhchHHHHHHHHhhc
Q psy12018         90 MYVCDICGKVYQHKRTLYRHKKDECGQEPRFQCPQCPYRAKQKANLKTHLIIKH  143 (148)
Q Consensus        90 ~~~C~~c~~~f~~~~~l~~H~~~~~~~~~~~~C~~C~~~f~~~~~l~~H~~~~h  143 (148)
                      .|+|+.|+.+....+.|..|++.-+...+||+|..|.+.|.+-+.|.+|..+|.
T Consensus       263 ~ykCplCdmtc~~~ssL~~H~r~rHs~dkpfKCd~Cd~~c~~esdL~kH~~~HS  316 (467)
T KOG3608|consen  263 CYKCPLCDMTCSSASSLTTHIRYRHSKDKPFKCDECDTRCVRESDLAKHVQVHS  316 (467)
T ss_pred             cccccccccCCCChHHHHHHHHhhhccCCCccccchhhhhccHHHHHHHHHhcc
Confidence            588999999999999999998876666899999999999999999999988665


No 10 
>KOG3608|consensus
Probab=99.36  E-value=5.3e-13  Score=91.35  Aligned_cols=107  Identities=20%  Similarity=0.436  Sum_probs=79.9

Q ss_pred             CCccccCccccccCChhHHhcccccccCCCCcccCCCCCCcccccccccccc--cCCCCCceecCccccccccchhHHhh
Q psy12018         32 YGKFACDVCGKEYQYYRNLYRHKKFECGQEPRYQCPQCPYRTKQKELGWESL--KPNAYGMYVCDICGKVYQHKRTLYRH  109 (148)
Q Consensus        32 ~~~~~C~~C~~~f~~~~~l~~h~~~~~~~~~~~~C~~c~~~f~~~~~~~~~~--~~~~~~~~~C~~c~~~f~~~~~l~~H  109 (148)
                      ..+|.|..|.+.|.....|..|++.|.   ..|+|+.|..+....+.+..++  .|..+++|+|..|+..|...+.|.+|
T Consensus       235 ~n~fqC~~C~KrFaTeklL~~Hv~rHv---n~ykCplCdmtc~~~ssL~~H~r~rHs~dkpfKCd~Cd~~c~~esdL~kH  311 (467)
T KOG3608|consen  235 TNSFQCAQCFKRFATEKLLKSHVVRHV---NCYKCPLCDMTCSSASSLTTHIRYRHSKDKPFKCDECDTRCVRESDLAKH  311 (467)
T ss_pred             CCchHHHHHHHHHhHHHHHHHHHHHhh---hcccccccccCCCChHHHHHHHHhhhccCCCccccchhhhhccHHHHHHH
Confidence            458888888888888888888887773   4688888888777766443333  24557888888888888888888888


Q ss_pred             HhhhhCCCCceeCCC--ChhhhhchHHHHHHHHhhc
Q psy12018        110 KKDECGQEPRFQCPQ--CPYRAKQKANLKTHLIIKH  143 (148)
Q Consensus       110 ~~~~~~~~~~~~C~~--C~~~f~~~~~l~~H~~~~h  143 (148)
                      ...|.  +..|+|..  |..+|.+..++.+|++-+|
T Consensus       312 ~~~HS--~~~y~C~h~~C~~s~r~~~q~~~H~~evh  345 (467)
T KOG3608|consen  312 VQVHS--KTVYQCEHPDCHYSVRTYTQMRRHFLEVH  345 (467)
T ss_pred             HHhcc--ccceecCCCCCcHHHHHHHHHHHHHHHhc
Confidence            88775  35677766  7777777777777777666


No 11 
>PLN03086 PRLI-interacting factor K; Provisional
Probab=99.30  E-value=4.4e-12  Score=93.08  Aligned_cols=109  Identities=21%  Similarity=0.442  Sum_probs=86.1

Q ss_pred             CCCCCccccCccccccCChhHHhcccccccCCCCcccCCCCCCcccccccccccccCCCCCceecCcccccccc------
Q psy12018         29 PKLYGKFACDVCGKEYQYYRNLYRHKKFECGQEPRYQCPQCPYRTKQKELGWESLKPNAYGMYVCDICGKVYQH------  102 (148)
Q Consensus        29 ~~~~~~~~C~~C~~~f~~~~~l~~h~~~~~~~~~~~~C~~c~~~f~~~~~~~~~~~~~~~~~~~C~~c~~~f~~------  102 (148)
                      ...++.+.|+.|++.|. ...|..|+++++   +++.|+ |+..+....+..+...+...+++.|..|+..|..      
T Consensus       448 ~el~~H~~C~~Cgk~f~-~s~LekH~~~~H---kpv~Cp-Cg~~~~R~~L~~H~~thCp~Kpi~C~fC~~~v~~g~~~~d  522 (567)
T PLN03086        448 EEAKNHVHCEKCGQAFQ-QGEMEKHMKVFH---EPLQCP-CGVVLEKEQMVQHQASTCPLRLITCRFCGDMVQAGGSAMD  522 (567)
T ss_pred             cccccCccCCCCCCccc-hHHHHHHHHhcC---CCccCC-CCCCcchhHHHhhhhccCCCCceeCCCCCCccccCccccc
Confidence            34567789999999996 578999999874   589999 9976644334444455778899999999998852      


Q ss_pred             ----chhHHhhHhhhhCCCCceeCCCChhhhhchHHHHHHHHhhcCC
Q psy12018        103 ----KRTLYRHKKDECGQEPRFQCPQCPYRAKQKANLKTHLIIKHDS  145 (148)
Q Consensus       103 ----~~~l~~H~~~~~~~~~~~~C~~C~~~f~~~~~l~~H~~~~h~~  145 (148)
                          ...|..|.... | .+++.|..||+.+..+ .+..|+...|..
T Consensus       523 ~~d~~s~Lt~HE~~C-G-~rt~~C~~Cgk~Vrlr-dm~~H~~~~h~~  566 (567)
T PLN03086        523 VRDRLRGMSEHESIC-G-SRTAPCDSCGRSVMLK-EMDIHQIAVHQK  566 (567)
T ss_pred             hhhhhhhHHHHHHhc-C-CcceEccccCCeeeeh-hHHHHHHHhhcC
Confidence                35799999886 5 7899999999999887 567898877754


No 12 
>PHA00733 hypothetical protein
Probab=99.19  E-value=1e-11  Score=75.39  Aligned_cols=80  Identities=21%  Similarity=0.291  Sum_probs=60.3

Q ss_pred             CcccCCCCCCccccccccc------ccccCCCCCceecCccccccccchhHHhhHhhhhCCCCceeCCCChhhhhchHHH
Q psy12018         62 PRYQCPQCPYRTKQKELGW------ESLKPNAYGMYVCDICGKVYQHKRTLYRHKKDECGQEPRFQCPQCPYRAKQKANL  135 (148)
Q Consensus        62 ~~~~C~~c~~~f~~~~~~~------~~~~~~~~~~~~C~~c~~~f~~~~~l~~H~~~~~~~~~~~~C~~C~~~f~~~~~l  135 (148)
                      +++.|.+|...|....++.      ++....+.++|.|..|++.|.....|..|++.+   +.++.|..|++.|.....|
T Consensus        39 ~~~~~~~~~~~~~~~~~l~~~~~l~~~~~~~~~kPy~C~~Cgk~Fss~s~L~~H~r~h---~~~~~C~~CgK~F~~~~sL  115 (128)
T PHA00733         39 KRLIRAVVKTLIYNPQLLDESSYLYKLLTSKAVSPYVCPLCLMPFSSSVSLKQHIRYT---EHSKVCPVCGKEFRNTDST  115 (128)
T ss_pred             hhHHHHHHhhhccChhhhcchHHHHhhcccCCCCCccCCCCCCcCCCHHHHHHHHhcC---CcCccCCCCCCccCCHHHH
Confidence            4555655555555443221      223344577899999999999999999999876   3469999999999999999


Q ss_pred             HHHHHhhcC
Q psy12018        136 KTHLIIKHD  144 (148)
Q Consensus       136 ~~H~~~~h~  144 (148)
                      ..|+...|+
T Consensus       116 ~~H~~~~h~  124 (128)
T PHA00733        116 LDHVCKKHN  124 (128)
T ss_pred             HHHHHHhcC
Confidence            999998886


No 13 
>PHA02768 hypothetical protein; Provisional
Probab=99.03  E-value=6.8e-11  Score=60.18  Aligned_cols=43  Identities=19%  Similarity=0.576  Sum_probs=39.2

Q ss_pred             eecCccccccccchhHHhhHhhhhCCCCceeCCCChhhhhchHHHH
Q psy12018         91 YVCDICGKVYQHKRTLYRHKKDECGQEPRFQCPQCPYRAKQKANLK  136 (148)
Q Consensus        91 ~~C~~c~~~f~~~~~l~~H~~~~~~~~~~~~C~~C~~~f~~~~~l~  136 (148)
                      |.|+.||+.|...+.|..|+++|+   +++.|..|++.|.+.+.|.
T Consensus         6 y~C~~CGK~Fs~~~~L~~H~r~H~---k~~kc~~C~k~f~~~s~l~   48 (55)
T PHA02768          6 YECPICGEIYIKRKSMITHLRKHN---TNLKLSNCKRISLRTGEYI   48 (55)
T ss_pred             cCcchhCCeeccHHHHHHHHHhcC---CcccCCcccceecccceeE
Confidence            789999999999999999999996   5799999999999887763


No 14 
>PHA00733 hypothetical protein
Probab=98.97  E-value=3.6e-10  Score=68.72  Aligned_cols=85  Identities=14%  Similarity=0.153  Sum_probs=65.8

Q ss_pred             CCCCCccccCccccccCChhHHhcc--c---ccccCCCCcccCCCCCCcccccccccccccCCCCCceecCccccccccc
Q psy12018         29 PKLYGKFACDVCGKEYQYYRNLYRH--K---KFECGQEPRYQCPQCPYRTKQKELGWESLKPNAYGMYVCDICGKVYQHK  103 (148)
Q Consensus        29 ~~~~~~~~C~~C~~~f~~~~~l~~h--~---~~~~~~~~~~~C~~c~~~f~~~~~~~~~~~~~~~~~~~C~~c~~~f~~~  103 (148)
                      +...+++.|..|.+.|.....|..+  +   ..+.+ ++||.|+.|++.|.+...+..+...+ ..+|.|..|++.|...
T Consensus        35 ~~~~~~~~~~~~~~~~~~~~~l~~~~~l~~~~~~~~-~kPy~C~~Cgk~Fss~s~L~~H~r~h-~~~~~C~~CgK~F~~~  112 (128)
T PHA00733         35 TPEQKRLIRAVVKTLIYNPQLLDESSYLYKLLTSKA-VSPYVCPLCLMPFSSSVSLKQHIRYT-EHSKVCPVCGKEFRNT  112 (128)
T ss_pred             ChhhhhHHHHHHhhhccChhhhcchHHHHhhcccCC-CCCccCCCCCCcCCCHHHHHHHHhcC-CcCccCCCCCCccCCH
Confidence            5567889999999998887777665  1   12223 67999999999999987544444322 4579999999999999


Q ss_pred             hhHHhhHhhhhC
Q psy12018        104 RTLYRHKKDECG  115 (148)
Q Consensus       104 ~~l~~H~~~~~~  115 (148)
                      ..|..|+...++
T Consensus       113 ~sL~~H~~~~h~  124 (128)
T PHA00733        113 DSTLDHVCKKHN  124 (128)
T ss_pred             HHHHHHHHHhcC
Confidence            999999987765


No 15 
>PHA02768 hypothetical protein; Provisional
Probab=98.84  E-value=1.3e-09  Score=55.50  Aligned_cols=41  Identities=15%  Similarity=0.426  Sum_probs=37.0

Q ss_pred             ccccCccccccCChhHHhcccccccCCCCcccCCCCCCcccccc
Q psy12018         34 KFACDVCGKEYQYYRNLYRHKKFECGQEPRYQCPQCPYRTKQKE   77 (148)
Q Consensus        34 ~~~C~~C~~~f~~~~~l~~h~~~~~~~~~~~~C~~c~~~f~~~~   77 (148)
                      .|.|+.||+.|....+|..|+++|.   +++.|..|++.|...+
T Consensus         5 ~y~C~~CGK~Fs~~~~L~~H~r~H~---k~~kc~~C~k~f~~~s   45 (55)
T PHA02768          5 GYECPICGEIYIKRKSMITHLRKHN---TNLKLSNCKRISLRTG   45 (55)
T ss_pred             ccCcchhCCeeccHHHHHHHHHhcC---CcccCCcccceecccc
Confidence            4899999999999999999999986   5899999999988765


No 16 
>KOG3993|consensus
Probab=98.80  E-value=1.4e-09  Score=76.39  Aligned_cols=81  Identities=21%  Similarity=0.474  Sum_probs=53.5

Q ss_pred             CccccCccccccCChhHHhcccccccCCCCcccCCCCCCcccccccccccccCC--------------------------
Q psy12018         33 GKFACDVCGKEYQYYRNLYRHKKFECGQEPRYQCPQCPYRTKQKELGWESLKPN--------------------------   86 (148)
Q Consensus        33 ~~~~C~~C~~~f~~~~~l~~h~~~~~~~~~~~~C~~c~~~f~~~~~~~~~~~~~--------------------------   86 (148)
                      +.|+|+.|...|.....|.+|.-..+. ...|.|++|++.|.....+..|+..+                          
T Consensus       266 GdyiCqLCK~kYeD~F~LAQHrC~RIV-~vEYrCPEC~KVFsCPANLASHRRWHKPR~eaa~a~~~P~k~~~~~rae~~e  344 (500)
T KOG3993|consen  266 GDYICQLCKEKYEDAFALAQHRCPRIV-HVEYRCPECDKVFSCPANLASHRRWHKPRPEAAKAGSPPPKQAVETRAEVQE  344 (500)
T ss_pred             HHHHHHHHHHhhhhHHHHhhccCCeeE-EeeecCCcccccccCchhhhhhhcccCCchhhhhcCCCChhhhhhhhhhhhh
Confidence            358899999999999999998654444 34589999999888764322222211                          


Q ss_pred             --------CCCceecCccccccccchhHHhhHhhhh
Q psy12018         87 --------AYGMYVCDICGKVYQHKRTLYRHKKDEC  114 (148)
Q Consensus        87 --------~~~~~~C~~c~~~f~~~~~l~~H~~~~~  114 (148)
                              .+..|.|..|++.|.....|+.|+.+|.
T Consensus       345 a~rsg~dss~gi~~C~~C~KkFrRqAYLrKHqlthq  380 (500)
T KOG3993|consen  345 AERSGDDSSSGIFSCHTCGKKFRRQAYLRKHQLTHQ  380 (500)
T ss_pred             ccccCCcccCceeecHHhhhhhHHHHHHHHhHHhhh
Confidence                    1234666777777766666666655443


No 17 
>PF13465 zf-H2C2_2:  Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A ....
Probab=98.76  E-value=3.9e-09  Score=46.09  Aligned_cols=26  Identities=31%  Similarity=0.685  Sum_probs=23.3

Q ss_pred             hHHhhHhhhhCCCCceeCCCChhhhhc
Q psy12018        105 TLYRHKKDECGQEPRFQCPQCPYRAKQ  131 (148)
Q Consensus       105 ~l~~H~~~~~~~~~~~~C~~C~~~f~~  131 (148)
                      +|..|+++|++ ++||.|+.|++.|.+
T Consensus         1 ~l~~H~~~H~~-~k~~~C~~C~k~F~~   26 (26)
T PF13465_consen    1 NLRRHMRTHTG-EKPYKCPYCGKSFSN   26 (26)
T ss_dssp             HHHHHHHHHSS-SSSEEESSSSEEESS
T ss_pred             CHHHHhhhcCC-CCCCCCCCCcCeeCc
Confidence            47899999999 899999999999864


No 18 
>PHA00616 hypothetical protein
Probab=98.74  E-value=8.8e-09  Score=50.01  Aligned_cols=29  Identities=24%  Similarity=0.429  Sum_probs=15.3

Q ss_pred             ceeCCCChhhhhchHHHHHHHHhhcCCcc
Q psy12018        119 RFQCPQCPYRAKQKANLKTHLIIKHDSVL  147 (148)
Q Consensus       119 ~~~C~~C~~~f~~~~~l~~H~~~~h~~~~  147 (148)
                      ||+|..||+.|...+.|.+|++.+|++++
T Consensus         1 pYqC~~CG~~F~~~s~l~~H~r~~hg~~~   29 (44)
T PHA00616          1 MYQCLRCGGIFRKKKEVIEHLLSVHKQNK   29 (44)
T ss_pred             CCccchhhHHHhhHHHHHHHHHHhcCCCc
Confidence            34555555555555555555555555543


No 19 
>PLN03086 PRLI-interacting factor K; Provisional
Probab=98.65  E-value=2.9e-08  Score=73.40  Aligned_cols=76  Identities=20%  Similarity=0.333  Sum_probs=56.9

Q ss_pred             CcccCCCCCCcccccccccccccCCCCCceecCccccccccchhHHhhHhhhhCCCCceeCCCChhhhhc----------
Q psy12018         62 PRYQCPQCPYRTKQKELGWESLKPNAYGMYVCDICGKVYQHKRTLYRHKKDECGQEPRFQCPQCPYRAKQ----------  131 (148)
Q Consensus        62 ~~~~C~~c~~~f~~~~~~~~~~~~~~~~~~~C~~c~~~f~~~~~l~~H~~~~~~~~~~~~C~~C~~~f~~----------  131 (148)
                      +++.|+.|++.|....+..+...+  .+++.|+ |++.+ ....|..|+..+.. ++++.|..|++.|..          
T Consensus       452 ~H~~C~~Cgk~f~~s~LekH~~~~--Hkpv~Cp-Cg~~~-~R~~L~~H~~thCp-~Kpi~C~fC~~~v~~g~~~~d~~d~  526 (567)
T PLN03086        452 NHVHCEKCGQAFQQGEMEKHMKVF--HEPLQCP-CGVVL-EKEQMVQHQASTCP-LRLITCRFCGDMVQAGGSAMDVRDR  526 (567)
T ss_pred             cCccCCCCCCccchHHHHHHHHhc--CCCccCC-CCCCc-chhHHHhhhhccCC-CCceeCCCCCCccccCccccchhhh
Confidence            456788998888644333333333  3789999 99765 56899999999988 899999999999852          


Q ss_pred             hHHHHHHHHhh
Q psy12018        132 KANLKTHLIIK  142 (148)
Q Consensus       132 ~~~l~~H~~~~  142 (148)
                      .+.|..|..+.
T Consensus       527 ~s~Lt~HE~~C  537 (567)
T PLN03086        527 LRGMSEHESIC  537 (567)
T ss_pred             hhhHHHHHHhc
Confidence            35788898774


No 20 
>PF13465 zf-H2C2_2:  Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A ....
Probab=98.53  E-value=1.7e-08  Score=44.08  Aligned_cols=25  Identities=40%  Similarity=0.754  Sum_probs=21.2

Q ss_pred             HHhcccccccCCCCcccCCCCCCccc
Q psy12018         49 NLYRHKKFECGQEPRYQCPQCPYRTK   74 (148)
Q Consensus        49 ~l~~h~~~~~~~~~~~~C~~c~~~f~   74 (148)
                      +|..|+++|.+ ++||.|+.|++.|.
T Consensus         1 ~l~~H~~~H~~-~k~~~C~~C~k~F~   25 (26)
T PF13465_consen    1 NLRRHMRTHTG-EKPYKCPYCGKSFS   25 (26)
T ss_dssp             HHHHHHHHHSS-SSSEEESSSSEEES
T ss_pred             CHHHHhhhcCC-CCCCCCCCCcCeeC
Confidence            47889998888 78999999998875


No 21 
>PHA00616 hypothetical protein
Probab=98.44  E-value=4.5e-08  Score=47.56  Aligned_cols=34  Identities=12%  Similarity=0.250  Sum_probs=30.7

Q ss_pred             ccccCccccccCChhHHhcccccccCCCCcccCCC
Q psy12018         34 KFACDVCGKEYQYYRNLYRHKKFECGQEPRYQCPQ   68 (148)
Q Consensus        34 ~~~C~~C~~~f~~~~~l~~h~~~~~~~~~~~~C~~   68 (148)
                      ||.|..||+.|...+.|..|++.+++ ++++.|..
T Consensus         1 pYqC~~CG~~F~~~s~l~~H~r~~hg-~~~~~~~~   34 (44)
T PHA00616          1 MYQCLRCGGIFRKKKEVIEHLLSVHK-QNKLTLEY   34 (44)
T ss_pred             CCccchhhHHHhhHHHHHHHHHHhcC-CCccceeE
Confidence            68999999999999999999999999 67888754


No 22 
>PHA00732 hypothetical protein
Probab=98.43  E-value=1.1e-07  Score=52.82  Aligned_cols=46  Identities=26%  Similarity=0.538  Sum_probs=29.1

Q ss_pred             ceecCccccccccchhHHhhHhhhhCCCCceeCCCChhhhhchHHHHHHHHh
Q psy12018         90 MYVCDICGKVYQHKRTLYRHKKDECGQEPRFQCPQCPYRAKQKANLKTHLII  141 (148)
Q Consensus        90 ~~~C~~c~~~f~~~~~l~~H~~~~~~~~~~~~C~~C~~~f~~~~~l~~H~~~  141 (148)
                      +|.|..|++.|.....|..|++.++.   ++.|+.|++.|.+   |..|.+.
T Consensus         1 py~C~~Cgk~F~s~s~Lk~H~r~~H~---~~~C~~CgKsF~~---l~~H~~~   46 (79)
T PHA00732          1 MFKCPICGFTTVTLFALKQHARRNHT---LTKCPVCNKSYRR---LNQHFYS   46 (79)
T ss_pred             CccCCCCCCccCCHHHHHHHhhcccC---CCccCCCCCEeCC---hhhhhcc
Confidence            36677777777777777777764222   2467777777763   4555543


No 23 
>PF05605 zf-Di19:  Drought induced 19 protein (Di19), zinc-binding;  InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins. Di19 has been found to be strongly expressed in both the roots and leaves of Arabidopsis thaliana during progressive drought [], whilst RING finger proteins are thought to play a role in spermatogenesis. The precise function is unknown.
Probab=98.31  E-value=1.5e-06  Score=44.82  Aligned_cols=52  Identities=33%  Similarity=0.602  Sum_probs=40.5

Q ss_pred             ceecCccccccccchhHHhhHhhhhCC-CCceeCCCChhhhhchHHHHHHHHhhcC
Q psy12018         90 MYVCDICGKVYQHKRTLYRHKKDECGQ-EPRFQCPQCPYRAKQKANLKTHLIIKHD  144 (148)
Q Consensus        90 ~~~C~~c~~~f~~~~~l~~H~~~~~~~-~~~~~C~~C~~~f~~~~~l~~H~~~~h~  144 (148)
                      .|.|++|++. .+...|..|....+.. .+.+.|++|...+.  ..|..|+..+|+
T Consensus         2 ~f~CP~C~~~-~~~~~L~~H~~~~H~~~~~~v~CPiC~~~~~--~~l~~Hl~~~H~   54 (54)
T PF05605_consen    2 SFTCPYCGKG-FSESSLVEHCEDEHRSESKNVVCPICSSRVT--DNLIRHLNSQHR   54 (54)
T ss_pred             CcCCCCCCCc-cCHHHHHHHHHhHCcCCCCCccCCCchhhhh--hHHHHHHHHhcC
Confidence            4889999995 4567899997765543 45789999998655  489999998885


No 24 
>PHA00732 hypothetical protein
Probab=98.18  E-value=1.2e-06  Score=48.73  Aligned_cols=40  Identities=23%  Similarity=0.463  Sum_probs=32.1

Q ss_pred             ccccCccccccCChhHHhcccccccCCCCcccCCCCCCccccc
Q psy12018         34 KFACDVCGKEYQYYRNLYRHKKFECGQEPRYQCPQCPYRTKQK   76 (148)
Q Consensus        34 ~~~C~~C~~~f~~~~~l~~h~~~~~~~~~~~~C~~c~~~f~~~   76 (148)
                      ||.|..|++.|.....|..|++.++.   ++.|+.|++.|.+.
T Consensus         1 py~C~~Cgk~F~s~s~Lk~H~r~~H~---~~~C~~CgKsF~~l   40 (79)
T PHA00732          1 MFKCPICGFTTVTLFALKQHARRNHT---LTKCPVCNKSYRRL   40 (79)
T ss_pred             CccCCCCCCccCCHHHHHHHhhcccC---CCccCCCCCEeCCh
Confidence            58899999999999999999875322   35788898888753


No 25 
>PF00096 zf-C2H2:  Zinc finger, C2H2 type;  InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger: #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C], where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter []. This entry represents the classical C2H2 zinc finger domain.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0005622 intracellular; PDB: 2D9H_A 2EPC_A 1SP1_A 1VA3_A 2WBT_B 2ELR_A 2YTP_A 2YTT_A 1VA1_A 2ELO_A ....
Probab=98.18  E-value=1.1e-06  Score=36.99  Aligned_cols=22  Identities=36%  Similarity=0.735  Sum_probs=15.7

Q ss_pred             eeCCCChhhhhchHHHHHHHHh
Q psy12018        120 FQCPQCPYRAKQKANLKTHLII  141 (148)
Q Consensus       120 ~~C~~C~~~f~~~~~l~~H~~~  141 (148)
                      |.|..|++.|.+.+.|..|++.
T Consensus         1 y~C~~C~~~f~~~~~l~~H~~~   22 (23)
T PF00096_consen    1 YKCPICGKSFSSKSNLKRHMRR   22 (23)
T ss_dssp             EEETTTTEEESSHHHHHHHHHH
T ss_pred             CCCCCCCCccCCHHHHHHHHhH
Confidence            5677777777777777777765


No 26 
>PF13894 zf-C2H2_4:  C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A ....
Probab=98.13  E-value=2.1e-06  Score=36.35  Aligned_cols=24  Identities=38%  Similarity=0.825  Sum_probs=17.4

Q ss_pred             eeCCCChhhhhchHHHHHHHHhhc
Q psy12018        120 FQCPQCPYRAKQKANLKTHLIIKH  143 (148)
Q Consensus       120 ~~C~~C~~~f~~~~~l~~H~~~~h  143 (148)
                      |.|+.|++.|.+...|..|++.+|
T Consensus         1 ~~C~~C~~~~~~~~~l~~H~~~~H   24 (24)
T PF13894_consen    1 FQCPICGKSFRSKSELRQHMRTHH   24 (24)
T ss_dssp             EE-SSTS-EESSHHHHHHHHHHHS
T ss_pred             CCCcCCCCcCCcHHHHHHHHHhhC
Confidence            578888888888888888887765


No 27 
>KOG3993|consensus
Probab=98.11  E-value=6.6e-07  Score=63.31  Aligned_cols=84  Identities=20%  Similarity=0.372  Sum_probs=64.7

Q ss_pred             cccCCCCCCcccccccccccccCC-CCCceecCccccccccchhHHhhHhhhhCC-------------------------
Q psy12018         63 RYQCPQCPYRTKQKELGWESLKPN-AYGMYVCDICGKVYQHKRTLYRHKKDECGQ-------------------------  116 (148)
Q Consensus        63 ~~~C~~c~~~f~~~~~~~~~~~~~-~~~~~~C~~c~~~f~~~~~l~~H~~~~~~~-------------------------  116 (148)
                      .|.|..|...|...-.+.+|+-.. ..-.|+|++|++.|.=..+|..|++.|-..                         
T Consensus       267 dyiCqLCK~kYeD~F~LAQHrC~RIV~vEYrCPEC~KVFsCPANLASHRRWHKPR~eaa~a~~~P~k~~~~~rae~~ea~  346 (500)
T KOG3993|consen  267 DYICQLCKEKYEDAFALAQHRCPRIVHVEYRCPECDKVFSCPANLASHRRWHKPRPEAAKAGSPPPKQAVETRAEVQEAE  346 (500)
T ss_pred             HHHHHHHHHhhhhHHHHhhccCCeeEEeeecCCcccccccCchhhhhhhcccCCchhhhhcCCCChhhhhhhhhhhhhcc
Confidence            388988988777765455554332 223599999999999999999999866321                         


Q ss_pred             -------CCceeCCCChhhhhchHHHHHHHHhhcCCc
Q psy12018        117 -------EPRFQCPQCPYRAKQKANLKTHLIIKHDSV  146 (148)
Q Consensus       117 -------~~~~~C~~C~~~f~~~~~l~~H~~~~h~~~  146 (148)
                             +-.|.|..|+|.|....=|++|+..||...
T Consensus       347 rsg~dss~gi~~C~~C~KkFrRqAYLrKHqlthq~~~  383 (500)
T KOG3993|consen  347 RSGDDSSSGIFSCHTCGKKFRRQAYLRKHQLTHQRAP  383 (500)
T ss_pred             ccCCcccCceeecHHhhhhhHHHHHHHHhHHhhhccc
Confidence                   113899999999999999999999888653


No 28 
>PF13912 zf-C2H2_6:  C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B.
Probab=98.05  E-value=2.4e-06  Score=37.46  Aligned_cols=26  Identities=19%  Similarity=0.395  Sum_probs=19.5

Q ss_pred             ceeCCCChhhhhchHHHHHHHHhhcC
Q psy12018        119 RFQCPQCPYRAKQKANLKTHLIIKHD  144 (148)
Q Consensus       119 ~~~C~~C~~~f~~~~~l~~H~~~~h~  144 (148)
                      ||.|..|++.|.+...|..|++.|++
T Consensus         1 ~~~C~~C~~~F~~~~~l~~H~~~h~~   26 (27)
T PF13912_consen    1 PFECDECGKTFSSLSALREHKRSHCS   26 (27)
T ss_dssp             SEEETTTTEEESSHHHHHHHHCTTTT
T ss_pred             CCCCCccCCccCChhHHHHHhHHhcC
Confidence            46777788888887778778777654


No 29 
>PF00096 zf-C2H2:  Zinc finger, C2H2 type;  InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger: #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C], where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter []. This entry represents the classical C2H2 zinc finger domain.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0005622 intracellular; PDB: 2D9H_A 2EPC_A 1SP1_A 1VA3_A 2WBT_B 2ELR_A 2YTP_A 2YTT_A 1VA1_A 2ELO_A ....
Probab=97.91  E-value=8.9e-06  Score=34.17  Aligned_cols=23  Identities=43%  Similarity=0.924  Sum_probs=21.0

Q ss_pred             eecCccccccccchhHHhhHhhh
Q psy12018         91 YVCDICGKVYQHKRTLYRHKKDE  113 (148)
Q Consensus        91 ~~C~~c~~~f~~~~~l~~H~~~~  113 (148)
                      |+|+.|++.|.....|..|++.|
T Consensus         1 y~C~~C~~~f~~~~~l~~H~~~H   23 (23)
T PF00096_consen    1 YKCPICGKSFSSKSNLKRHMRRH   23 (23)
T ss_dssp             EEETTTTEEESSHHHHHHHHHHH
T ss_pred             CCCCCCCCccCCHHHHHHHHhHC
Confidence            68999999999999999999864


No 30 
>PF09237 GAGA:  GAGA factor;  InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  Members of this entry bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 1YUI_A 1YUJ_A.
Probab=97.88  E-value=9.7e-06  Score=40.33  Aligned_cols=38  Identities=32%  Similarity=0.463  Sum_probs=22.6

Q ss_pred             HhhhhCCCCceeCCCChhhhhchHHHHHHHHhhcCCcc
Q psy12018        110 KKDECGQEPRFQCPQCPYRAKQKANLKTHLIIKHDSVL  147 (148)
Q Consensus       110 ~~~~~~~~~~~~C~~C~~~f~~~~~l~~H~~~~h~~~~  147 (148)
                      .+.+...+.|..|++|+..+++..+|++|+.+.|+.++
T Consensus        15 ~k~~~~S~~PatCP~C~a~~~~srnLrRHle~~H~~k~   52 (54)
T PF09237_consen   15 PKSKSQSEQPATCPICGAVIRQSRNLRRHLEIRHFKKP   52 (54)
T ss_dssp             -CCCCTTS--EE-TTT--EESSHHHHHHHHHHHTTTS-
T ss_pred             HHHhhccCCCCCCCcchhhccchhhHHHHHHHHhcccC
Confidence            33333446778888888888888888888888887653


No 31 
>PF13912 zf-C2H2_6:  C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B.
Probab=97.77  E-value=1.1e-05  Score=35.35  Aligned_cols=26  Identities=38%  Similarity=0.881  Sum_probs=23.3

Q ss_pred             ccccCccccccCChhHHhcccccccC
Q psy12018         34 KFACDVCGKEYQYYRNLYRHKKFECG   59 (148)
Q Consensus        34 ~~~C~~C~~~f~~~~~l~~h~~~~~~   59 (148)
                      +|.|..|++.|.....|..|++.|..
T Consensus         1 ~~~C~~C~~~F~~~~~l~~H~~~h~~   26 (27)
T PF13912_consen    1 PFECDECGKTFSSLSALREHKRSHCS   26 (27)
T ss_dssp             SEEETTTTEEESSHHHHHHHHCTTTT
T ss_pred             CCCCCccCCccCChhHHHHHhHHhcC
Confidence            68999999999999999999987753


No 32 
>PF13894 zf-C2H2_4:  C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A ....
Probab=97.58  E-value=6.4e-05  Score=31.58  Aligned_cols=24  Identities=33%  Similarity=0.807  Sum_probs=19.7

Q ss_pred             eecCccccccccchhHHhhHhhhh
Q psy12018         91 YVCDICGKVYQHKRTLYRHKKDEC  114 (148)
Q Consensus        91 ~~C~~c~~~f~~~~~l~~H~~~~~  114 (148)
                      |.|+.|++.|.....|..|+..++
T Consensus         1 ~~C~~C~~~~~~~~~l~~H~~~~H   24 (24)
T PF13894_consen    1 FQCPICGKSFRSKSELRQHMRTHH   24 (24)
T ss_dssp             EE-SSTS-EESSHHHHHHHHHHHS
T ss_pred             CCCcCCCCcCCcHHHHHHHHHhhC
Confidence            689999999999999999998764


No 33 
>PF12756 zf-C2H2_2:  C2H2 type zinc-finger (2 copies); PDB: 2DMI_A.
Probab=97.58  E-value=5.2e-05  Score=43.94  Aligned_cols=74  Identities=19%  Similarity=0.253  Sum_probs=22.0

Q ss_pred             cCCCCCCcccccccccccccCCCCCceecCccccccccchhHHhhHhhhhCCCCceeCCCChhhhhchHHHHHHHHhhc
Q psy12018         65 QCPQCPYRTKQKELGWESLKPNAYGMYVCDICGKVYQHKRTLYRHKKDECGQEPRFQCPQCPYRAKQKANLKTHLIIKH  143 (148)
Q Consensus        65 ~C~~c~~~f~~~~~~~~~~~~~~~~~~~C~~c~~~f~~~~~l~~H~~~~~~~~~~~~C~~C~~~f~~~~~l~~H~~~~h  143 (148)
                      +|..|+..|.+...+..|+.....-..  + ....+.....+..+.+....  ..+.|..|++.|.+...|..|++.++
T Consensus         1 ~C~~C~~~f~~~~~l~~H~~~~H~~~~--~-~~~~l~~~~~~~~~~~~~~~--~~~~C~~C~~~f~s~~~l~~Hm~~~~   74 (100)
T PF12756_consen    1 QCLFCDESFSSVDDLLQHMKKKHGFDI--P-DQKYLVDPNRLLNYLRKKVK--ESFRCPYCNKTFRSREALQEHMRSKH   74 (100)
T ss_dssp             -----------------------------------------------------SSEEBSSSS-EESSHHHHHHHHHHTT
T ss_pred             Ccccccccccccccccccccccccccc--c-cccccccccccccccccccC--CCCCCCccCCCCcCHHHHHHHHcCcc
Confidence            478888888887644445432222111  1 11112233334444443322  36999999999999999999998653


No 34 
>PF12756 zf-C2H2_2:  C2H2 type zinc-finger (2 copies); PDB: 2DMI_A.
Probab=97.48  E-value=8.2e-05  Score=43.09  Aligned_cols=75  Identities=16%  Similarity=0.332  Sum_probs=22.7

Q ss_pred             ccCccccccCChhHHhcccccccCCCCcccCCCCCCcccccccccccccCCCCCceecCccccccccchhHHhhHhhhhC
Q psy12018         36 ACDVCGKEYQYYRNLYRHKKFECGQEPRYQCPQCPYRTKQKELGWESLKPNAYGMYVCDICGKVYQHKRTLYRHKKDECG  115 (148)
Q Consensus        36 ~C~~C~~~f~~~~~l~~h~~~~~~~~~~~~C~~c~~~f~~~~~~~~~~~~~~~~~~~C~~c~~~f~~~~~l~~H~~~~~~  115 (148)
                      .|..|+..|.....|..|+...++...+    . ...+.............-...+.|..|++.|.+...|..|++.+..
T Consensus         1 ~C~~C~~~f~~~~~l~~H~~~~H~~~~~----~-~~~l~~~~~~~~~~~~~~~~~~~C~~C~~~f~s~~~l~~Hm~~~~H   75 (100)
T PF12756_consen    1 QCLFCDESFSSVDDLLQHMKKKHGFDIP----D-QKYLVDPNRLLNYLRKKVKESFRCPYCNKTFRSREALQEHMRSKHH   75 (100)
T ss_dssp             -----------------------------------------------------SSEEBSSSS-EESSHHHHHHHHHHTTT
T ss_pred             Cccccccccccccccccccccccccccc----c-ccccccccccccccccccCCCCCCCccCCCCcCHHHHHHHHcCccC
Confidence            4889999999999999999665552221    1 1111111111111111222369999999999999999999997643


No 35 
>smart00355 ZnF_C2H2 zinc finger.
Probab=97.48  E-value=0.00013  Score=31.07  Aligned_cols=23  Identities=35%  Similarity=0.751  Sum_probs=16.8

Q ss_pred             eeCCCChhhhhchHHHHHHHHhh
Q psy12018        120 FQCPQCPYRAKQKANLKTHLIIK  142 (148)
Q Consensus       120 ~~C~~C~~~f~~~~~l~~H~~~~  142 (148)
                      |.|..|++.|.+...|..|++.|
T Consensus         1 ~~C~~C~~~f~~~~~l~~H~~~H   23 (26)
T smart00355        1 YRCPECGKVFKSKSALKEHMRTH   23 (26)
T ss_pred             CCCCCCcchhCCHHHHHHHHHHh
Confidence            46777777777777777777744


No 36 
>PF05605 zf-Di19:  Drought induced 19 protein (Di19), zinc-binding;  InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins. Di19 has been found to be strongly expressed in both the roots and leaves of Arabidopsis thaliana during progressive drought [], whilst RING finger proteins are thought to play a role in spermatogenesis. The precise function is unknown.
Probab=97.42  E-value=8.1e-05  Score=38.33  Aligned_cols=37  Identities=30%  Similarity=0.560  Sum_probs=21.4

Q ss_pred             ccccCccccccCChhHHhcccccccC-CCCcccCCCCCC
Q psy12018         34 KFACDVCGKEYQYYRNLYRHKKFECG-QEPRYQCPQCPY   71 (148)
Q Consensus        34 ~~~C~~C~~~f~~~~~l~~h~~~~~~-~~~~~~C~~c~~   71 (148)
                      .|.|+.|++. .+...|..|....+. +.+.+.||+|..
T Consensus         2 ~f~CP~C~~~-~~~~~L~~H~~~~H~~~~~~v~CPiC~~   39 (54)
T PF05605_consen    2 SFTCPYCGKG-FSESSLVEHCEDEHRSESKNVVCPICSS   39 (54)
T ss_pred             CcCCCCCCCc-cCHHHHHHHHHhHCcCCCCCccCCCchh
Confidence            4677888774 445677777544333 224455655553


No 37 
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning]
Probab=97.25  E-value=9.2e-05  Score=51.02  Aligned_cols=53  Identities=26%  Similarity=0.488  Sum_probs=38.5

Q ss_pred             CCceecCc--cccccccchhHHhhHhhhh------------------CCCCceeCCCChhhhhchHHHHHHHH
Q psy12018         88 YGMYVCDI--CGKVYQHKRTLYRHKKDEC------------------GQEPRFQCPQCPYRAKQKANLKTHLI  140 (148)
Q Consensus        88 ~~~~~C~~--c~~~f~~~~~l~~H~~~~~------------------~~~~~~~C~~C~~~f~~~~~l~~H~~  140 (148)
                      +++|+|+.  |++.+...-.|.-|+..-+                  ...|||+|++|+|.+....-|.-|..
T Consensus       347 ~KpykCpV~gC~K~YknqnGLKYH~lhGH~~~~~~~~p~p~~~~~F~~~~KPYrCevC~KRYKNlNGLKYHr~  419 (423)
T COG5189         347 GKPYKCPVEGCNKKYKNQNGLKYHMLHGHQNQKLHENPSPEKMNIFSAKDKPYRCEVCDKRYKNLNGLKYHRK  419 (423)
T ss_pred             CceecCCCCCchhhhccccchhhhhhccccCcccCCCCCccccccccccCCceeccccchhhccCccceeccc
Confidence            47788866  7788877777776654222                  12589999999999998877765554


No 38 
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning]
Probab=97.22  E-value=0.0002  Score=49.39  Aligned_cols=72  Identities=22%  Similarity=0.361  Sum_probs=44.8

Q ss_pred             CCCccccCc--cccccCChhHHhcccccccCCCCcccCCCCCCcccccccccccccCCCCCceecCccccccccchhHHh
Q psy12018         31 LYGKFACDV--CGKEYQYYRNLYRHKKFECGQEPRYQCPQCPYRTKQKELGWESLKPNAYGMYVCDICGKVYQHKRTLYR  108 (148)
Q Consensus        31 ~~~~~~C~~--C~~~f~~~~~l~~h~~~~~~~~~~~~C~~c~~~f~~~~~~~~~~~~~~~~~~~C~~c~~~f~~~~~l~~  108 (148)
                      .++||.|++  |.+.|.....|+-|+..-+-..+..+-+         +--....-....|||.|+.|++.+...-.|.-
T Consensus       346 d~KpykCpV~gC~K~YknqnGLKYH~lhGH~~~~~~~~p---------~p~~~~~F~~~~KPYrCevC~KRYKNlNGLKY  416 (423)
T COG5189         346 DGKPYKCPVEGCNKKYKNQNGLKYHMLHGHQNQKLHENP---------SPEKMNIFSAKDKPYRCEVCDKRYKNLNGLKY  416 (423)
T ss_pred             cCceecCCCCCchhhhccccchhhhhhccccCcccCCCC---------CccccccccccCCceeccccchhhccCcccee
Confidence            458999988  8899999888888864322111111111         00000111234689999999999988888877


Q ss_pred             hHh
Q psy12018        109 HKK  111 (148)
Q Consensus       109 H~~  111 (148)
                      |+.
T Consensus       417 Hr~  419 (423)
T COG5189         417 HRK  419 (423)
T ss_pred             ccc
Confidence            654


No 39 
>PF09237 GAGA:  GAGA factor;  InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  Members of this entry bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 1YUI_A 1YUJ_A.
Probab=97.20  E-value=0.00023  Score=35.50  Aligned_cols=37  Identities=24%  Similarity=0.322  Sum_probs=25.3

Q ss_pred             CCCCCCCCccccCccccccCChhHHhcccccccCCCCc
Q psy12018         26 PFKPKLYGKFACDVCGKEYQYYRNLYRHKKFECGQEPR   63 (148)
Q Consensus        26 ~~~~~~~~~~~C~~C~~~f~~~~~l~~h~~~~~~~~~~   63 (148)
                      ......+.|..|+.|+..+....+|.+|+.+.++ .+|
T Consensus        16 k~~~~S~~PatCP~C~a~~~~srnLrRHle~~H~-~k~   52 (54)
T PF09237_consen   16 KSKSQSEQPATCPICGAVIRQSRNLRRHLEIRHF-KKP   52 (54)
T ss_dssp             CCCCTTS--EE-TTT--EESSHHHHHHHHHHHTT-TS-
T ss_pred             HHhhccCCCCCCCcchhhccchhhHHHHHHHHhc-ccC
Confidence            3445678899999999999999999999988776 443


No 40 
>PF13909 zf-H2C2_5:  C2H2-type zinc-finger domain; PDB: 1X5W_A.
Probab=97.05  E-value=0.00046  Score=29.11  Aligned_cols=24  Identities=46%  Similarity=1.021  Sum_probs=14.4

Q ss_pred             eeCCCChhhhhchHHHHHHHHhhcC
Q psy12018        120 FQCPQCPYRAKQKANLKTHLIIKHD  144 (148)
Q Consensus       120 ~~C~~C~~~f~~~~~l~~H~~~~h~  144 (148)
                      |+|+.|+.... ...|.+|++.+|+
T Consensus         1 y~C~~C~y~t~-~~~l~~H~~~~H~   24 (24)
T PF13909_consen    1 YKCPHCSYSTS-KSNLKRHLKRHHP   24 (24)
T ss_dssp             EE-SSSS-EES-HHHHHHHHHHHHS
T ss_pred             CCCCCCCCcCC-HHHHHHHHHhhCc
Confidence            46677766665 6677777776654


No 41 
>PF12874 zf-met:  Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A.
Probab=96.91  E-value=0.00055  Score=29.13  Aligned_cols=22  Identities=27%  Similarity=0.528  Sum_probs=14.8

Q ss_pred             eeCCCChhhhhchHHHHHHHHh
Q psy12018        120 FQCPQCPYRAKQKANLKTHLII  141 (148)
Q Consensus       120 ~~C~~C~~~f~~~~~l~~H~~~  141 (148)
                      |.|..|++.|.+...|..|++.
T Consensus         1 ~~C~~C~~~f~s~~~~~~H~~s   22 (25)
T PF12874_consen    1 FYCDICNKSFSSENSLRQHLRS   22 (25)
T ss_dssp             EEETTTTEEESSHHHHHHHHTT
T ss_pred             CCCCCCCCCcCCHHHHHHHHCc
Confidence            4566777777777777776654


No 42 
>smart00355 ZnF_C2H2 zinc finger.
Probab=96.84  E-value=0.00091  Score=28.32  Aligned_cols=24  Identities=38%  Similarity=0.811  Sum_probs=20.9

Q ss_pred             eecCccccccccchhHHhhHhhhh
Q psy12018         91 YVCDICGKVYQHKRTLYRHKKDEC  114 (148)
Q Consensus        91 ~~C~~c~~~f~~~~~l~~H~~~~~  114 (148)
                      |.|..|++.|.....|..|++.|.
T Consensus         1 ~~C~~C~~~f~~~~~l~~H~~~H~   24 (26)
T smart00355        1 YRCPECGKVFKSKSALKEHMRTHX   24 (26)
T ss_pred             CCCCCCcchhCCHHHHHHHHHHhc
Confidence            579999999999999999998654


No 43 
>PRK04860 hypothetical protein; Provisional
Probab=96.76  E-value=0.0012  Score=41.75  Aligned_cols=38  Identities=32%  Similarity=0.649  Sum_probs=32.9

Q ss_pred             ceecCccccccccchhHHhhHhhhhCCCCceeCCCChhhhhch
Q psy12018         90 MYVCDICGKVYQHKRTLYRHKKDECGQEPRFQCPQCPYRAKQK  132 (148)
Q Consensus        90 ~~~C~~c~~~f~~~~~l~~H~~~~~~~~~~~~C~~C~~~f~~~  132 (148)
                      +|.|. |+.   ....+..|.+++.+ +++|.|..|+..|...
T Consensus       119 ~Y~C~-C~~---~~~~~rrH~ri~~g-~~~YrC~~C~~~l~~~  156 (160)
T PRK04860        119 PYRCK-CQE---HQLTVRRHNRVVRG-EAVYRCRRCGETLVFK  156 (160)
T ss_pred             EEEcC-CCC---eeCHHHHHHHHhcC-CccEECCCCCceeEEe
Confidence            58998 987   67778999999999 8899999999988754


No 44 
>PF12171 zf-C2H2_jaz:  Zinc-finger double-stranded RNA-binding;  InterPro: IPR022755  This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length. The mammalian members of this group occur multiple times along the protein, joined by flexible linkers, and are referred to as JAZ - dsRNA-binding ZF protein - zinc-fingers. The JAZ proteins are expressed in all tissues tested and localise in the nucleus, particularly the nucleolus []. JAZ preferentially binds to double-stranded (ds) RNA or RNA/DNA hybrids rather than DNA. In addition to binding double-stranded RNA, these zinc-fingers are required for nucleolar localisation.   This entry represents the multiple-adjacent-C2H2 zinc finger, JAZ. ; PDB: 4DGW_A 1ZR9_A.
Probab=96.53  E-value=0.0023  Score=27.77  Aligned_cols=22  Identities=36%  Similarity=0.656  Sum_probs=19.9

Q ss_pred             cccCccccccCChhHHhccccc
Q psy12018         35 FACDVCGKEYQYYRNLYRHKKF   56 (148)
Q Consensus        35 ~~C~~C~~~f~~~~~l~~h~~~   56 (148)
                      |.|..|++.|.....+..|++.
T Consensus         2 ~~C~~C~k~f~~~~~~~~H~~s   23 (27)
T PF12171_consen    2 FYCDACDKYFSSENQLKQHMKS   23 (27)
T ss_dssp             CBBTTTTBBBSSHHHHHCCTTS
T ss_pred             CCcccCCCCcCCHHHHHHHHcc
Confidence            6899999999999999999864


No 45 
>PRK04860 hypothetical protein; Provisional
Probab=96.51  E-value=0.001  Score=42.14  Aligned_cols=37  Identities=24%  Similarity=0.573  Sum_probs=22.9

Q ss_pred             ccccCccccccCChhHHhcccccccCCCCcccCCCCCCcccc
Q psy12018         34 KFACDVCGKEYQYYRNLYRHKKFECGQEPRYQCPQCPYRTKQ   75 (148)
Q Consensus        34 ~~~C~~C~~~f~~~~~l~~h~~~~~~~~~~~~C~~c~~~f~~   75 (148)
                      +|.|. |+.   ....+..|.+++.+ +++|.|..|+..|..
T Consensus       119 ~Y~C~-C~~---~~~~~rrH~ri~~g-~~~YrC~~C~~~l~~  155 (160)
T PRK04860        119 PYRCK-CQE---HQLTVRRHNRVVRG-EAVYRCRRCGETLVF  155 (160)
T ss_pred             EEEcC-CCC---eeCHHHHHHHHhcC-CccEECCCCCceeEE
Confidence            56665 665   44556666666666 556777666665543


No 46 
>PF12874 zf-met:  Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A.
Probab=96.38  E-value=0.0026  Score=26.96  Aligned_cols=23  Identities=30%  Similarity=0.846  Sum_probs=20.4

Q ss_pred             eecCccccccccchhHHhhHhhh
Q psy12018         91 YVCDICGKVYQHKRTLYRHKKDE  113 (148)
Q Consensus        91 ~~C~~c~~~f~~~~~l~~H~~~~  113 (148)
                      |.|..|++.|.+...+..|++.+
T Consensus         1 ~~C~~C~~~f~s~~~~~~H~~s~   23 (25)
T PF12874_consen    1 FYCDICNKSFSSENSLRQHLRSK   23 (25)
T ss_dssp             EEETTTTEEESSHHHHHHHHTTH
T ss_pred             CCCCCCCCCcCCHHHHHHHHCcC
Confidence            67999999999999999998754


No 47 
>PF13909 zf-H2C2_5:  C2H2-type zinc-finger domain; PDB: 1X5W_A.
Probab=96.14  E-value=0.006  Score=25.56  Aligned_cols=24  Identities=33%  Similarity=0.504  Sum_probs=18.4

Q ss_pred             eecCccccccccchhHHhhHhhhhC
Q psy12018         91 YVCDICGKVYQHKRTLYRHKKDECG  115 (148)
Q Consensus        91 ~~C~~c~~~f~~~~~l~~H~~~~~~  115 (148)
                      |+|+.|+.... ...|..|++.+++
T Consensus         1 y~C~~C~y~t~-~~~l~~H~~~~H~   24 (24)
T PF13909_consen    1 YKCPHCSYSTS-KSNLKRHLKRHHP   24 (24)
T ss_dssp             EE-SSSS-EES-HHHHHHHHHHHHS
T ss_pred             CCCCCCCCcCC-HHHHHHHHHhhCc
Confidence            68999998887 8899999988753


No 48 
>PF12171 zf-C2H2_jaz:  Zinc-finger double-stranded RNA-binding;  InterPro: IPR022755  This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length. The mammalian members of this group occur multiple times along the protein, joined by flexible linkers, and are referred to as JAZ - dsRNA-binding ZF protein - zinc-fingers. The JAZ proteins are expressed in all tissues tested and localise in the nucleus, particularly the nucleolus []. JAZ preferentially binds to double-stranded (ds) RNA or RNA/DNA hybrids rather than DNA. In addition to binding double-stranded RNA, these zinc-fingers are required for nucleolar localisation.   This entry represents the multiple-adjacent-C2H2 zinc finger, JAZ. ; PDB: 4DGW_A 1ZR9_A.
Probab=95.65  E-value=0.0057  Score=26.49  Aligned_cols=21  Identities=33%  Similarity=0.808  Sum_probs=13.4

Q ss_pred             eecCccccccccchhHHhhHh
Q psy12018         91 YVCDICGKVYQHKRTLYRHKK  111 (148)
Q Consensus        91 ~~C~~c~~~f~~~~~l~~H~~  111 (148)
                      |-|..|++.|.+...|..|++
T Consensus         2 ~~C~~C~k~f~~~~~~~~H~~   22 (27)
T PF12171_consen    2 FYCDACDKYFSSENQLKQHMK   22 (27)
T ss_dssp             CBBTTTTBBBSSHHHHHCCTT
T ss_pred             CCcccCCCCcCCHHHHHHHHc
Confidence            456666666666666666654


No 49 
>PF13913 zf-C2HC_2:  zinc-finger of a C2HC-type
Probab=95.52  E-value=0.011  Score=25.14  Aligned_cols=19  Identities=26%  Similarity=0.562  Sum_probs=8.7

Q ss_pred             eCCCChhhhhchHHHHHHHH
Q psy12018        121 QCPQCPYRAKQKANLKTHLI  140 (148)
Q Consensus       121 ~C~~C~~~f~~~~~l~~H~~  140 (148)
                      .|..||+.| ..+.|.+|+.
T Consensus         4 ~C~~CgR~F-~~~~l~~H~~   22 (25)
T PF13913_consen    4 PCPICGRKF-NPDRLEKHEK   22 (25)
T ss_pred             cCCCCCCEE-CHHHHHHHHH
Confidence            344555555 3334444443


No 50 
>KOG2893|consensus
Probab=94.75  E-value=0.006  Score=40.70  Aligned_cols=48  Identities=23%  Similarity=0.559  Sum_probs=35.5

Q ss_pred             cCccccccccchhHHhhHhhhhCCCCceeCCCChhhhhchHHHHHHHHhhcCC
Q psy12018         93 CDICGKVYQHKRTLYRHKKDECGQEPRFQCPQCPYRAKQKANLKTHLIIKHDS  145 (148)
Q Consensus        93 C~~c~~~f~~~~~l~~H~~~~~~~~~~~~C~~C~~~f~~~~~l~~H~~~~h~~  145 (148)
                      |=+|.+.|.....|.+|++     .+.|+|..|.|...+..-|..|-...|.+
T Consensus        13 cwycnrefddekiliqhqk-----akhfkchichkkl~sgpglsihcmqvhke   60 (341)
T KOG2893|consen   13 CWYCNREFDDEKILIQHQK-----AKHFKCHICHKKLFSGPGLSIHCMQVHKE   60 (341)
T ss_pred             eeecccccchhhhhhhhhh-----hccceeeeehhhhccCCCceeehhhhhhh
Confidence            6678888888888888875     45688888887776666666666655544


No 51 
>smart00451 ZnF_U1 U1-like zinc finger. Family of C2H2-type zinc fingers, present in matrin, U1 small nuclear ribonucleoprotein C and other RNA-binding proteins.
Probab=94.73  E-value=0.024  Score=25.96  Aligned_cols=22  Identities=23%  Similarity=0.522  Sum_probs=17.4

Q ss_pred             ceeCCCChhhhhchHHHHHHHH
Q psy12018        119 RFQCPQCPYRAKQKANLKTHLI  140 (148)
Q Consensus       119 ~~~C~~C~~~f~~~~~l~~H~~  140 (148)
                      +|.|..|++.|.+...+..|+.
T Consensus         3 ~~~C~~C~~~~~~~~~~~~H~~   24 (35)
T smart00451        3 GFYCKLCNVTFTDEISVEAHLK   24 (35)
T ss_pred             CeEccccCCccCCHHHHHHHHC
Confidence            4778888888888888877775


No 52 
>smart00451 ZnF_U1 U1-like zinc finger. Family of C2H2-type zinc fingers, present in matrin, U1 small nuclear ribonucleoprotein C and other RNA-binding proteins.
Probab=94.31  E-value=0.022  Score=26.13  Aligned_cols=23  Identities=22%  Similarity=0.379  Sum_probs=19.5

Q ss_pred             ccccCccccccCChhHHhccccc
Q psy12018         34 KFACDVCGKEYQYYRNLYRHKKF   56 (148)
Q Consensus        34 ~~~C~~C~~~f~~~~~l~~h~~~   56 (148)
                      +|.|..|++.|.....+..|+..
T Consensus         3 ~~~C~~C~~~~~~~~~~~~H~~g   25 (35)
T smart00451        3 GFYCKLCNVTFTDEISVEAHLKG   25 (35)
T ss_pred             CeEccccCCccCCHHHHHHHHCh
Confidence            58899999999988888888653


No 53 
>COG4049 Uncharacterized protein containing archaeal-type C2H2 Zn-finger [General function prediction only]
Probab=93.54  E-value=0.072  Score=27.17  Aligned_cols=27  Identities=22%  Similarity=0.547  Sum_probs=15.7

Q ss_pred             CCceeCCCChhhhhchHHHHHHHHhhc
Q psy12018        117 EPRFQCPQCPYRAKQKANLKTHLIIKH  143 (148)
Q Consensus       117 ~~~~~C~~C~~~f~~~~~l~~H~~~~h  143 (148)
                      |.-+.|+-||+.|.....+.+|.-..|
T Consensus        15 E~~lrCPRC~~~FR~~K~Y~RHVNKaH   41 (65)
T COG4049          15 EEFLRCPRCGMVFRRRKDYIRHVNKAH   41 (65)
T ss_pred             ceeeeCCchhHHHHHhHHHHHHhhHHh
Confidence            444566666666666666666654433


No 54 
>PF09538 FYDLN_acid:  Protein of unknown function (FYDLN_acid);  InterPro: IPR012644 Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues. The function of members of this family is unknown.
Probab=93.29  E-value=0.077  Score=31.38  Aligned_cols=33  Identities=21%  Similarity=0.503  Sum_probs=22.4

Q ss_pred             CCccccCccccccCChhHHhcccccccCCCCcccCCCCCCccccc
Q psy12018         32 YGKFACDVCGKEYQYYRNLYRHKKFECGQEPRYQCPQCPYRTKQK   76 (148)
Q Consensus        32 ~~~~~C~~C~~~f~~~~~l~~h~~~~~~~~~~~~C~~c~~~f~~~   76 (148)
                      .....|+.||+.|....            ..|..||.||..|.-.
T Consensus         7 GtKR~Cp~CG~kFYDLn------------k~PivCP~CG~~~~~~   39 (108)
T PF09538_consen    7 GTKRTCPSCGAKFYDLN------------KDPIVCPKCGTEFPPE   39 (108)
T ss_pred             CCcccCCCCcchhccCC------------CCCccCCCCCCccCcc
Confidence            44557888888875532            3577788888777654


No 55 
>COG4049 Uncharacterized protein containing archaeal-type C2H2 Zn-finger [General function prediction only]
Probab=92.27  E-value=0.041  Score=28.03  Aligned_cols=32  Identities=19%  Similarity=0.344  Sum_probs=25.9

Q ss_pred             CCCCCCccccCccccccCChhHHhcccccccC
Q psy12018         28 KPKLYGKFACDVCGKEYQYYRNLYRHKKFECG   59 (148)
Q Consensus        28 ~~~~~~~~~C~~C~~~f~~~~~l~~h~~~~~~   59 (148)
                      ...++..++|+-|+..|....+..+|....++
T Consensus        11 ~RDGE~~lrCPRC~~~FR~~K~Y~RHVNKaH~   42 (65)
T COG4049          11 DRDGEEFLRCPRCGMVFRRRKDYIRHVNKAHG   42 (65)
T ss_pred             ccCCceeeeCCchhHHHHHhHHHHHHhhHHhh
Confidence            34567789999999999999999999765544


No 56 
>KOG1146|consensus
Probab=92.22  E-value=0.12  Score=42.76  Aligned_cols=75  Identities=16%  Similarity=0.263  Sum_probs=40.1

Q ss_pred             CccccCccccccCChhHHhcccccccCCCCcccCCCCCCcccccc-cccccccCCCCCceecCccccccccchhHHhhHh
Q psy12018         33 GKFACDVCGKEYQYYRNLYRHKKFECGQEPRYQCPQCPYRTKQKE-LGWESLKPNAYGMYVCDICGKVYQHKRTLYRHKK  111 (148)
Q Consensus        33 ~~~~C~~C~~~f~~~~~l~~h~~~~~~~~~~~~C~~c~~~f~~~~-~~~~~~~~~~~~~~~C~~c~~~f~~~~~l~~H~~  111 (148)
                      +.|.|++|...|.....|..|+|.-+.+-..   ..|.. +.... ...-....-+.++|.|..|...+.....|..|+.
T Consensus       464 kt~~cpkc~~~yk~a~~L~vhmRskhp~~~~---~~c~~-gq~~~~~arg~~~~~~~~p~~C~~C~~stttng~Lsihlq  539 (1406)
T KOG1146|consen  464 KTLKCPKCNWHYKLAQTLGVHMRSKHPESQS---AYCKA-GQNHPRLARGEVYRCPGKPYPCRACNYSTTTNGNLSIHLQ  539 (1406)
T ss_pred             ccccCCccchhhhhHHHhhhcccccccccch---hHhHh-ccccccccccccccCCCCcccceeeeeeeecchHHHHHHH
Confidence            5677777777777777777777763331111   11110 00000 0000001122466788888888877777777765


No 57 
>cd00350 rubredoxin_like Rubredoxin_like; nonheme iron binding domain containing a [Fe(SCys)4] center. The family includes rubredoxins, a small electron transfer protein, and a slightly smaller modular rubredoxin domain present in rubrerythrin and nigerythrin and detected either N- or C-terminal to such proteins as flavin reductase, NAD(P)H-nitrite reductase, and ferredoxin-thioredoxin reductase. In rubredoxin, the iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), but iron can also be replaced by cobalt, nickel or zinc and believed to be involved in electron transfer.  Rubrerythrins and nigerythrins are small homodimeric proteins, generally consisting of 2 domains: a rubredoxin domain C-terminal to a non-sulfur, oxo-bridged diiron site in the N-terminal rubrerythrin domain.  Rubrerythrins and nigerythrins have putative peroxide activity.
Probab=90.39  E-value=0.23  Score=22.56  Aligned_cols=10  Identities=30%  Similarity=0.893  Sum_probs=5.9

Q ss_pred             CceeCCCChh
Q psy12018        118 PRFQCPQCPY  127 (148)
Q Consensus       118 ~~~~C~~C~~  127 (148)
                      .++.|+.||.
T Consensus        16 ~~~~CP~Cg~   25 (33)
T cd00350          16 APWVCPVCGA   25 (33)
T ss_pred             CCCcCcCCCC
Confidence            3566666654


No 58 
>COG5048 FOG: Zn-finger [General function prediction only]
Probab=90.29  E-value=0.056  Score=39.22  Aligned_cols=57  Identities=23%  Similarity=0.458  Sum_probs=47.7

Q ss_pred             CceecCccccccccchhHHhhHh--hhhCCC--CceeCC--CChhhhhchHHHHHHHHhhcCCc
Q psy12018         89 GMYVCDICGKVYQHKRTLYRHKK--DECGQE--PRFQCP--QCPYRAKQKANLKTHLIIKHDSV  146 (148)
Q Consensus        89 ~~~~C~~c~~~f~~~~~l~~H~~--~~~~~~--~~~~C~--~C~~~f~~~~~l~~H~~~~h~~~  146 (148)
                      .++.|..|...|.....|..|.+  .|.+ +  +++.|.  .|++.|.....+..|...+.+..
T Consensus       288 ~~~~~~~~~~~~s~~~~l~~~~~~~~h~~-~~~~~~~~p~~~~~~~~~~~~~~~~~~~~~~~~~  350 (467)
T COG5048         288 LPIKSKQCNISFSRSSPLTRHLRSVNHSG-ESLKPFSCPYSLCGKLFSRNDALKRHILLHTSIS  350 (467)
T ss_pred             cCCCCccccCCcccccccccccccccccc-ccCCceeeeccCCCccccccccccCCcccccCCC
Confidence            35788889999999999999999  7887 6  889998  79999999888888888777654


No 59 
>COG5048 FOG: Zn-finger [General function prediction only]
Probab=90.15  E-value=0.33  Score=35.23  Aligned_cols=44  Identities=20%  Similarity=0.425  Sum_probs=34.2

Q ss_pred             CccccCccccccCChhHHhcccc--cccCCC--CcccCC--CCCCcccccc
Q psy12018         33 GKFACDVCGKEYQYYRNLYRHKK--FECGQE--PRYQCP--QCPYRTKQKE   77 (148)
Q Consensus        33 ~~~~C~~C~~~f~~~~~l~~h~~--~~~~~~--~~~~C~--~c~~~f~~~~   77 (148)
                      .++.|..|...|.....|..|.+  .|.+ +  +++.|+  .|++.|....
T Consensus       288 ~~~~~~~~~~~~s~~~~l~~~~~~~~h~~-~~~~~~~~p~~~~~~~~~~~~  337 (467)
T COG5048         288 LPIKSKQCNISFSRSSPLTRHLRSVNHSG-ESLKPFSCPYSLCGKLFSRND  337 (467)
T ss_pred             cCCCCccccCCcccccccccccccccccc-ccCCceeeeccCCCccccccc
Confidence            46788888888888888888888  6766 5  788888  6888777764


No 60 
>PF09986 DUF2225:  Uncharacterized protein conserved in bacteria (DUF2225);  InterPro: IPR018708 This conserved bacterial family has no known function.
Probab=88.98  E-value=0.21  Score=33.34  Aligned_cols=24  Identities=29%  Similarity=0.545  Sum_probs=15.4

Q ss_pred             CCccccCccccccCChhHHhcccc
Q psy12018         32 YGKFACDVCGKEYQYYRNLYRHKK   55 (148)
Q Consensus        32 ~~~~~C~~C~~~f~~~~~l~~h~~   55 (148)
                      ++...|++|++.|....-.....+
T Consensus         3 ~k~~~CPvC~~~F~~~~vrs~~~r   26 (214)
T PF09986_consen    3 DKKITCPVCGKEFKTKKVRSGKIR   26 (214)
T ss_pred             CCceECCCCCCeeeeeEEEcCCce
Confidence            355778888888877654444443


No 61 
>TIGR02300 FYDLN_acid conserved hypothetical protein TIGR02300. Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues. The function of members of this family is unknown.
Probab=88.63  E-value=0.36  Score=29.26  Aligned_cols=33  Identities=12%  Similarity=0.071  Sum_probs=21.8

Q ss_pred             CCccccCccccccCChhHHhcccccccCCCCcccCCCCCCccccc
Q psy12018         32 YGKFACDVCGKEYQYYRNLYRHKKFECGQEPRYQCPQCPYRTKQK   76 (148)
Q Consensus        32 ~~~~~C~~C~~~f~~~~~l~~h~~~~~~~~~~~~C~~c~~~f~~~   76 (148)
                      .....|+.||+.|....            ..|..|+.||..|.-.
T Consensus         7 GtKr~Cp~cg~kFYDLn------------k~p~vcP~cg~~~~~~   39 (129)
T TIGR02300         7 GTKRICPNTGSKFYDLN------------RRPAVSPYTGEQFPPE   39 (129)
T ss_pred             CccccCCCcCccccccC------------CCCccCCCcCCccCcc
Confidence            44557888888875532            4577788888776544


No 62 
>KOG2231|consensus
Probab=88.52  E-value=0.36  Score=37.47  Aligned_cols=92  Identities=21%  Similarity=0.303  Sum_probs=55.5

Q ss_pred             CChhHHhcccccccCCCCcccCCCCC---Cccccc-------ccccccccC-CC----CCceecCccccccccchhHHhh
Q psy12018         45 QYYRNLYRHKKFECGQEPRYQCPQCP---YRTKQK-------ELGWESLKP-NA----YGMYVCDICGKVYQHKRTLYRH  109 (148)
Q Consensus        45 ~~~~~l~~h~~~~~~~~~~~~C~~c~---~~f~~~-------~~~~~~~~~-~~----~~~~~C~~c~~~f~~~~~l~~H  109 (148)
                      .....|+.|++..+.   .+.|..|-   +.|...       .+..+.+.. .+    .+.-.|..|...|.....|..|
T Consensus       125 ~s~~~Lk~H~~~~H~---~~~c~lC~~~~kif~~e~k~Yt~~el~~h~~~gd~d~~s~rGhp~C~~C~~~fld~~el~rH  201 (669)
T KOG2231|consen  125 KSVENLKNHMRDQHK---LHLCSLCLQNLKIFINERKLYTRAELNLHLMFGDPDDESCRGHPLCKFCHERFLDDDELYRH  201 (669)
T ss_pred             hHHHHHHHHHHHhhh---hhccccccccceeeeeeeehehHHHHHHHHhcCCCccccccCCccchhhhhhhccHHHHHHh
Confidence            367888999855443   35555543   233332       122222211 11    1234788999999999999998


Q ss_pred             HhhhhCCCCceeCCCC------hhhhhchHHHHHHHHhhcC
Q psy12018        110 KKDECGQEPRFQCPQC------PYRAKQKANLKTHLIIKHD  144 (148)
Q Consensus       110 ~~~~~~~~~~~~C~~C------~~~f~~~~~l~~H~~~~h~  144 (148)
                      ++.++.     -|..|      +.-|.....|..|-+..|-
T Consensus       202 ~~~~h~-----~chfC~~~~~~neyy~~~~dLe~HfR~~Hf  237 (669)
T KOG2231|consen  202 LRFDHE-----FCHFCDYKTGQNEYYNDYDDLEEHFRKGHF  237 (669)
T ss_pred             hcccee-----heeecCcccccchhcccchHHHHHhhhcCc
Confidence            876554     34434      4566777888888887764


No 63 
>PRK14890 putative Zn-ribbon RNA-binding protein; Provisional
Probab=88.41  E-value=1.4  Score=22.92  Aligned_cols=11  Identities=27%  Similarity=1.183  Sum_probs=6.8

Q ss_pred             CCceeCCCChh
Q psy12018        117 EPRFQCPQCPY  127 (148)
Q Consensus       117 ~~~~~C~~C~~  127 (148)
                      ..+|.|+.||.
T Consensus        46 ~~~Y~CP~CGF   56 (59)
T PRK14890         46 SNPYTCPKCGF   56 (59)
T ss_pred             CCceECCCCCC
Confidence            34677777763


No 64 
>PF04959 ARS2:  Arsenite-resistance protein 2;  InterPro: IPR007042 This entry represents Arsenite-resistance protein 2 (also known as Serrate RNA effector molecule homolog) which is thought to play a role in arsenite resistance [], although does not directly confer arsenite resistance but rather modulates arsenic sensitivity []. Arsenite is a carcinogenic compound which can act as a comutagen by inhibiting DNA repair. It is also involved in cell cycle progression at S phase. ; PDB: 3AX1_A.
Probab=87.82  E-value=0.19  Score=33.49  Aligned_cols=30  Identities=17%  Similarity=0.468  Sum_probs=17.4

Q ss_pred             CCCCceecCccccccccchhHHhhHhhhhC
Q psy12018         86 NAYGMYVCDICGKVYQHKRTLYRHKKDECG  115 (148)
Q Consensus        86 ~~~~~~~C~~c~~~f~~~~~l~~H~~~~~~  115 (148)
                      ..+..|.|..|++.|........|+..-|.
T Consensus        73 ~~~~K~~C~lc~KlFkg~eFV~KHI~nKH~  102 (214)
T PF04959_consen   73 EDEDKWRCPLCGKLFKGPEFVRKHIFNKHP  102 (214)
T ss_dssp             SSSEEEEE-SSS-EESSHHHHHHHHHHH-H
T ss_pred             HcCCEECCCCCCcccCChHHHHHHHhhcCH
Confidence            344557777777777777777777665554


No 65 
>PF09986 DUF2225:  Uncharacterized protein conserved in bacteria (DUF2225);  InterPro: IPR018708 This conserved bacterial family has no known function.
Probab=87.29  E-value=0.16  Score=33.93  Aligned_cols=16  Identities=31%  Similarity=0.679  Sum_probs=11.4

Q ss_pred             CcccCCCCCCcccccc
Q psy12018         62 PRYQCPQCPYRTKQKE   77 (148)
Q Consensus        62 ~~~~C~~c~~~f~~~~   77 (148)
                      +...||.|+..|..+.
T Consensus         4 k~~~CPvC~~~F~~~~   19 (214)
T PF09986_consen    4 KKITCPVCGKEFKTKK   19 (214)
T ss_pred             CceECCCCCCeeeeeE
Confidence            4567888888777764


No 66 
>PRK00464 nrdR transcriptional regulator NrdR; Validated
Probab=86.49  E-value=0.58  Score=29.58  Aligned_cols=14  Identities=29%  Similarity=0.467  Sum_probs=9.4

Q ss_pred             ccCCCCCCcccccc
Q psy12018         64 YQCPQCPYRTKQKE   77 (148)
Q Consensus        64 ~~C~~c~~~f~~~~   77 (148)
                      +.|+.||.+|....
T Consensus        29 ~~c~~c~~~f~~~e   42 (154)
T PRK00464         29 RECLACGKRFTTFE   42 (154)
T ss_pred             eeccccCCcceEeE
Confidence            66777777776643


No 67 
>KOG1146|consensus
Probab=86.30  E-value=0.12  Score=42.66  Aligned_cols=108  Identities=11%  Similarity=0.122  Sum_probs=67.7

Q ss_pred             ccccCccccccCChhHHhcccccccC---CCCcccCCCCCCcccccccccccccCCCCCceecCccccccccchhHHhhH
Q psy12018         34 KFACDVCGKEYQYYRNLYRHKKFECG---QEPRYQCPQCPYRTKQKELGWESLKPNAYGMYVCDICGKVYQHKRTLYRHK  110 (148)
Q Consensus        34 ~~~C~~C~~~f~~~~~l~~h~~~~~~---~~~~~~C~~c~~~f~~~~~~~~~~~~~~~~~~~C~~c~~~f~~~~~l~~H~  110 (148)
                      ...|..|...|........+-+-.-.   ....+.|..|.+.+...-... +..  -..+|.|..|...|.....|..|+
T Consensus      1228 gl~~~~~e~~f~~~~~~~~~a~~~~~~~~~sGe~~c~~~~~~~~~~~~~~-~l~--~~~~~~~~~~~~~~~~~~~l~~~~ 1304 (1406)
T KOG1146|consen 1228 GLLPNALEQPFPQEPEPTATAPPKPPELPASGEGECGAVDELLTPSFGIS-TLD--VTHRYLCRQCKMAFDGEAPLTAHQ 1304 (1406)
T ss_pred             cccHHhhhcCccCcccccccCCCCCCcCcCCCcchhhhccccccCcccee-ecc--cchhHHHHHHHhhhcchhHHHHHH
Confidence            34567777777777666555322111   013466777776655432111 111  123578888888888888888887


Q ss_pred             hhhhC----------------CCCceeCCCChhhhhchHHHHHHHHhhcCC
Q psy12018        111 KDECG----------------QEPRFQCPQCPYRAKQKANLKTHLIIKHDS  145 (148)
Q Consensus       111 ~~~~~----------------~~~~~~C~~C~~~f~~~~~l~~H~~~~h~~  145 (148)
                      +...-                +..+| |..|...|+....|+.|+++.++.
T Consensus      1305 ~k~~~~~~~~~~~~~~~l~~~d~~~~-c~~c~~~~~~~~alqihm~~~~~~ 1354 (1406)
T KOG1146|consen 1305 RKFCFAGRGSGGSMPPPLRVPDCTYH-CLACEVLLSGREALQIHMRSSAHR 1354 (1406)
T ss_pred             HHHHhccCccccCCCCcccCcccccc-chHHHhhcchhHHHHHHHHHhhhc
Confidence            53211                13456 999999999999999999876653


No 68 
>COG1592 Rubrerythrin [Energy production and conversion]
Probab=85.73  E-value=0.6  Score=29.86  Aligned_cols=24  Identities=38%  Similarity=0.873  Sum_probs=17.9

Q ss_pred             ceecCccccccccchhHHhhHhhhhCCCCceeCCCChh
Q psy12018         90 MYVCDICGKVYQHKRTLYRHKKDECGQEPRFQCPQCPY  127 (148)
Q Consensus        90 ~~~C~~c~~~f~~~~~l~~H~~~~~~~~~~~~C~~C~~  127 (148)
                      -|.|+.||.++             .+ +.|.+|+.||.
T Consensus       134 ~~vC~vCGy~~-------------~g-e~P~~CPiCga  157 (166)
T COG1592         134 VWVCPVCGYTH-------------EG-EAPEVCPICGA  157 (166)
T ss_pred             EEEcCCCCCcc-------------cC-CCCCcCCCCCC
Confidence            58899998553             34 67888999873


No 69 
>PF02892 zf-BED:  BED zinc finger;  InterPro: IPR003656 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents predicted BED-type zinc finger domains. The BED finger which was named after the Drosophila proteins BEAF and DREF, is found in one or more copies in cellular regulatory factors and transposases from plants, animals and fungi. The BED finger is an about 50 to 60 amino acid residues domain that contains a characteristic motif with two highly conserved aromatic positions, as well as a shared pattern of cysteines and histidines that is predicted to form a zinc finger. As diverse BED fingers are able to bind DNA, it has been suggested that DNA-binding is the general function of this domain []. Some proteins known to contain a BED domain include animal, plant and fungi AC1 and Hobo-like transposases; Caenorhabditis elegans Dpy-20 protein, a predicted cuticular gene transcriptional regulator; Drosophila BEAF (boundary element-associated factor), thought to be involved in chromatin insulation; Drosophila DREF, a transcriptional regulator for S-phase genes; and tobacco 3AF1 and tomato E4/E8-BP1, light- and ethylene-regulated DNA binding proteins that contain two BED fingers. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003677 DNA binding; PDB: 2DJR_A 2CT5_A.
Probab=85.47  E-value=0.69  Score=22.37  Aligned_cols=26  Identities=38%  Similarity=0.565  Sum_probs=12.6

Q ss_pred             CceeCCCChhhhhch----HHHHHHHHhhc
Q psy12018        118 PRFQCPQCPYRAKQK----ANLKTHLIIKH  143 (148)
Q Consensus       118 ~~~~C~~C~~~f~~~----~~l~~H~~~~h  143 (148)
                      ....|..|++.+...    +.|.+|++..|
T Consensus        15 ~~a~C~~C~~~~~~~~~~ts~l~~HL~~~h   44 (45)
T PF02892_consen   15 KKAKCKYCGKVIKYSSGGTSNLKRHLKKKH   44 (45)
T ss_dssp             S-EEETTTTEE-----SSTHHHHHHHHHTT
T ss_pred             CeEEeCCCCeEEeeCCCcHHHHHHhhhhhC
Confidence            345666666666543    56667765443


No 70 
>COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair]
Probab=85.25  E-value=0.87  Score=36.09  Aligned_cols=49  Identities=22%  Similarity=0.448  Sum_probs=25.3

Q ss_pred             ccCCCCCCcccccccccccccCCCCCceecCccccccccchhHHhhHhhhhCCCCceeCCCChhh
Q psy12018         64 YQCPQCPYRTKQKELGWESLKPNAYGMYVCDICGKVYQHKRTLYRHKKDECGQEPRFQCPQCPYR  128 (148)
Q Consensus        64 ~~C~~c~~~f~~~~~~~~~~~~~~~~~~~C~~c~~~f~~~~~l~~H~~~~~~~~~~~~C~~C~~~  128 (148)
                      ..|..||..+....--.....|...+...|.+||..               . ..|..|+.||..
T Consensus       436 l~C~~Cg~v~~Cp~Cd~~lt~H~~~~~L~CH~Cg~~---------------~-~~p~~Cp~Cgs~  484 (730)
T COG1198         436 LLCRDCGYIAECPNCDSPLTLHKATGQLRCHYCGYQ---------------E-PIPQSCPECGSE  484 (730)
T ss_pred             eecccCCCcccCCCCCcceEEecCCCeeEeCCCCCC---------------C-CCCCCCCCCCCC
Confidence            446666665554431111112223345677777632               2 567788888753


No 71 
>cd00729 rubredoxin_SM Rubredoxin, Small Modular nonheme iron binding domain containing a [Fe(SCys)4] center, present in rubrerythrin and nigerythrin and detected either N- or C-terminal to such proteins as flavin reductase, NAD(P)H-nitrite reductase, and ferredoxin-thioredoxin reductase. In rubredoxin, the iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), and  believed to be involved in electron transfer. Rubrerythrins and nigerythrins are small homodimeric proteins, generally consisting of 2 domains: a rubredoxin domain C-terminal to a non-sulfur, oxo-bridged diiron site in the N-terminal rubrerythrin domain. Rubrerythrins and nigerythrins have putative peroxide activity.
Probab=84.44  E-value=0.99  Score=20.65  Aligned_cols=10  Identities=30%  Similarity=0.730  Sum_probs=6.1

Q ss_pred             CceeCCCChh
Q psy12018        118 PRFQCPQCPY  127 (148)
Q Consensus       118 ~~~~C~~C~~  127 (148)
                      .|..|+.||.
T Consensus        17 ~p~~CP~Cg~   26 (34)
T cd00729          17 APEKCPICGA   26 (34)
T ss_pred             CCCcCcCCCC
Confidence            4556777764


No 72 
>PF10571 UPF0547:  Uncharacterised protein family UPF0547;  InterPro: IPR018886  This domain may well be a type of zinc-finger as it carries two pairs of highly conserved cysteine residues though with no accompanying histidines. Several members are annotated as putative helicases. 
Probab=84.09  E-value=0.86  Score=19.51  Aligned_cols=8  Identities=38%  Similarity=1.115  Sum_probs=3.4

Q ss_pred             cCcccccc
Q psy12018         93 CDICGKVY  100 (148)
Q Consensus        93 C~~c~~~f  100 (148)
                      |+.||..|
T Consensus        17 Cp~CG~~F   24 (26)
T PF10571_consen   17 CPHCGYDF   24 (26)
T ss_pred             CCCCCCCC
Confidence            44444443


No 73 
>TIGR02605 CxxC_CxxC_SSSS putative regulatory protein, FmdB family. This model represents a region of about 50 amino acids found in a number of small proteins in a wide range of bacteria. The region begins usually with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One member of this family is has been noted as a putative regulatory protein, designated FmdB (PubMed:8841393). Most members of this family have a C-terminal region containing highly degenerate sequence, such as SSTSESTKSSGSSGSSGSSESKASGSTEKSTSSTTAAAAV in Mycobacterium tuberculosis and VAVGGSAPAPSPAPRAGGGGGGCCGGGCCG in Streptomyces avermitilis. These low complexity regions, which are not included in the model, resemble low-complexity C-terminal regions of some heterocycle-containing bacteriocin precursors.
Probab=84.05  E-value=0.43  Score=23.99  Aligned_cols=12  Identities=25%  Similarity=1.135  Sum_probs=8.1

Q ss_pred             cccCccccccCC
Q psy12018         35 FACDVCGKEYQY   46 (148)
Q Consensus        35 ~~C~~C~~~f~~   46 (148)
                      |.|..|+..|..
T Consensus         6 y~C~~Cg~~fe~   17 (52)
T TIGR02605         6 YRCTACGHRFEV   17 (52)
T ss_pred             EEeCCCCCEeEE
Confidence            677777776653


No 74 
>PF13719 zinc_ribbon_5:  zinc-ribbon domain
Probab=84.02  E-value=0.99  Score=21.05  Aligned_cols=10  Identities=30%  Similarity=0.853  Sum_probs=4.6

Q ss_pred             eeCCCChhhh
Q psy12018        120 FQCPQCPYRA  129 (148)
Q Consensus       120 ~~C~~C~~~f  129 (148)
                      .+|..|+..|
T Consensus        26 vrC~~C~~~f   35 (37)
T PF13719_consen   26 VRCPKCGHVF   35 (37)
T ss_pred             EECCCCCcEe
Confidence            4444444443


No 75 
>TIGR02098 MJ0042_CXXC MJ0042 family finger-like domain. This domain contains a CXXCX(19)CXXC motif suggestive of both zinc fingers and thioredoxin, usually found at the N-terminus of prokaryotic proteins. One partially characterized gene, agmX, is among a large set in Myxococcus whose interruption affects adventurous gliding motility.
Probab=84.02  E-value=0.94  Score=21.06  Aligned_cols=10  Identities=20%  Similarity=0.504  Sum_probs=5.4

Q ss_pred             eeCCCChhhh
Q psy12018        120 FQCPQCPYRA  129 (148)
Q Consensus       120 ~~C~~C~~~f  129 (148)
                      ..|+.|+..|
T Consensus        26 v~C~~C~~~~   35 (38)
T TIGR02098        26 VRCGKCGHVW   35 (38)
T ss_pred             EECCCCCCEE
Confidence            4555555544


No 76 
>PF05443 ROS_MUCR:  ROS/MUCR transcriptional regulator protein;  InterPro: IPR008807 This family consists of several ROS/MUCR transcriptional regulator proteins. The ros chromosomal gene is present in octopine and nopaline strains of Agrobacterium tumefaciens as well as in Rhizobium meliloti (Sinorhizobium meliloti). This gene encodes a 15.5 kDa protein that specifically represses the virC and virD operons in the virulence region of the Ti plasmid [] and is necessary for succinoglycan production []. S. meliloti can produce two types of acidic exopolysaccharides, succinoglycan and galactoglucan, that are interchangeable for infection of Medicago sativa (Alfalfa) nodules. MucR from S. meliloti acts as a transcriptional repressor that blocks the expression of the exp genes responsible for galactoglucan production therefore allowing the exclusive production of succinoglycan [].; GO: 0003677 DNA binding, 0008270 zinc ion binding, 0006355 regulation of transcription, DNA-dependent; PDB: 2JSP_A.
Probab=83.06  E-value=0.75  Score=28.28  Aligned_cols=24  Identities=29%  Similarity=0.447  Sum_probs=13.3

Q ss_pred             ceeCCCChhhhhchHHHHHHHHhhcCC
Q psy12018        119 RFQCPQCPYRAKQKANLKTHLIIKHDS  145 (148)
Q Consensus       119 ~~~C~~C~~~f~~~~~l~~H~~~~h~~  145 (148)
                      ...|-+||+.|..-   .+|++.|||-
T Consensus        72 ~i~clecGk~~k~L---krHL~~~~gl   95 (132)
T PF05443_consen   72 YIICLECGKKFKTL---KRHLRTHHGL   95 (132)
T ss_dssp             -EE-TBT--EESBH---HHHHHHTT-S
T ss_pred             eeEEccCCcccchH---HHHHHHccCC
Confidence            35777788877754   6777777764


No 77 
>COG2888 Predicted Zn-ribbon RNA-binding protein with a function in translation [Translation, ribosomal structure and biogenesis]
Probab=82.96  E-value=1  Score=23.44  Aligned_cols=33  Identities=21%  Similarity=0.430  Sum_probs=17.5

Q ss_pred             CcccCCCCCCcccccccccccccCCCCCceecCcccc
Q psy12018         62 PRYQCPQCPYRTKQKELGWESLKPNAYGMYVCDICGK   98 (148)
Q Consensus        62 ~~~~C~~c~~~f~~~~~~~~~~~~~~~~~~~C~~c~~   98 (148)
                      ..|.|+.||+.....-.    +--....+|.|+.||.
T Consensus        26 v~F~CPnCGe~~I~Rc~----~CRk~g~~Y~Cp~CGF   58 (61)
T COG2888          26 VKFPCPNCGEVEIYRCA----KCRKLGNPYRCPKCGF   58 (61)
T ss_pred             eEeeCCCCCceeeehhh----hHHHcCCceECCCcCc
Confidence            34778888764333221    1112234678888774


No 78 
>TIGR00373 conserved hypothetical protein TIGR00373. This family of proteins is, so far, restricted to archaeal genomes. The family appears to be distantly related to the N-terminal region of the eukaryotic transcription initiation factor IIE alpha chain.
Probab=82.73  E-value=0.99  Score=28.68  Aligned_cols=30  Identities=23%  Similarity=0.378  Sum_probs=15.9

Q ss_pred             CcccCCCCCCcccccccccccccCCCCCceecCccccc
Q psy12018         62 PRYQCPQCPYRTKQKELGWESLKPNAYGMYVCDICGKV   99 (148)
Q Consensus        62 ~~~~C~~c~~~f~~~~~~~~~~~~~~~~~~~C~~c~~~   99 (148)
                      .-|.|+.|+..|.......        .-|.|+.||..
T Consensus       108 ~~Y~Cp~c~~r~tf~eA~~--------~~F~Cp~Cg~~  137 (158)
T TIGR00373       108 MFFICPNMCVRFTFNEAME--------LNFTCPRCGAM  137 (158)
T ss_pred             CeEECCCCCcEeeHHHHHH--------cCCcCCCCCCE
Confidence            3466666666555543221        13666666644


No 79 
>PRK06266 transcription initiation factor E subunit alpha; Validated
Probab=82.41  E-value=1.1  Score=29.17  Aligned_cols=14  Identities=29%  Similarity=0.698  Sum_probs=7.7

Q ss_pred             cccCCCCCCccccc
Q psy12018         63 RYQCPQCPYRTKQK   76 (148)
Q Consensus        63 ~~~C~~c~~~f~~~   76 (148)
                      -|.|+.|+..|...
T Consensus       117 ~Y~Cp~C~~rytf~  130 (178)
T PRK06266        117 FFFCPNCHIRFTFD  130 (178)
T ss_pred             EEECCCCCcEEeHH
Confidence            45666666555543


No 80 
>smart00659 RPOLCX RNA polymerase subunit CX. present in RNA polymerase I, II and III
Probab=82.31  E-value=1.5  Score=21.36  Aligned_cols=10  Identities=30%  Similarity=0.883  Sum_probs=4.8

Q ss_pred             ccCCCCCCcc
Q psy12018         64 YQCPQCPYRT   73 (148)
Q Consensus        64 ~~C~~c~~~f   73 (148)
                      |.|..||..|
T Consensus         3 Y~C~~Cg~~~   12 (44)
T smart00659        3 YICGECGREN   12 (44)
T ss_pred             EECCCCCCEe
Confidence            4455555443


No 81 
>PF12013 DUF3505:  Protein of unknown function (DUF3505);  InterPro: IPR022698  This family of proteins is functionally uncharacterised. This protein is found in eukaryotes. Proteins in this family are typically between 247 to 1018 amino acids in length. This region contains two segments that are likely to be C2H2 zinc binding domains. 
Probab=82.04  E-value=1.2  Score=26.25  Aligned_cols=25  Identities=28%  Similarity=0.836  Sum_probs=22.3

Q ss_pred             eeC----CCChhhhhchHHHHHHHHhhcC
Q psy12018        120 FQC----PQCPYRAKQKANLKTHLIIKHD  144 (148)
Q Consensus       120 ~~C----~~C~~~f~~~~~l~~H~~~~h~  144 (148)
                      |.|    ..|+....+...+++|.+.+||
T Consensus        81 ~~C~~~~~~C~y~~~~~~~m~~H~~~~Hg  109 (109)
T PF12013_consen   81 YRCQCDPPHCGYITRSKKTMRKHWRKEHG  109 (109)
T ss_pred             eeeecCCCCCCcEeccHHHHHHHHHHhcC
Confidence            788    8899999999999999998886


No 82 
>PF09723 Zn-ribbon_8:  Zinc ribbon domain;  InterPro: IPR013429  This entry represents a region of about 41 amino acids found in a number of small proteins in a wide range of bacteria. The region usually begins with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One protein in this entry has been noted as a putative regulatory protein, designated FmdB []. Most proteins in this entry have a C-terminal region containing highly degenerate sequence.
Probab=81.69  E-value=1.1  Score=21.53  Aligned_cols=11  Identities=36%  Similarity=1.389  Sum_probs=5.9

Q ss_pred             cccCccccccC
Q psy12018         35 FACDVCGKEYQ   45 (148)
Q Consensus        35 ~~C~~C~~~f~   45 (148)
                      |.|..||..|.
T Consensus         6 y~C~~Cg~~fe   16 (42)
T PF09723_consen    6 YRCEECGHEFE   16 (42)
T ss_pred             EEeCCCCCEEE
Confidence            45555555553


No 83 
>COG1997 RPL43A Ribosomal protein L37AE/L43A [Translation, ribosomal structure and biogenesis]
Probab=81.14  E-value=0.86  Score=25.68  Aligned_cols=30  Identities=30%  Similarity=0.711  Sum_probs=15.4

Q ss_pred             cccCCCCCCcccccccccccccCCCCCceecCccccccc
Q psy12018         63 RYQCPQCPYRTKQKELGWESLKPNAYGMYVCDICGKVYQ  101 (148)
Q Consensus        63 ~~~C~~c~~~f~~~~~~~~~~~~~~~~~~~C~~c~~~f~  101 (148)
                      .|.|+.|++.-..         -...+.|.|..|+..|.
T Consensus        35 ~~~Cp~C~~~~Vk---------R~a~GIW~C~kCg~~fA   64 (89)
T COG1997          35 KHVCPFCGRTTVK---------RIATGIWKCRKCGAKFA   64 (89)
T ss_pred             CCcCCCCCCccee---------eeccCeEEcCCCCCeec
Confidence            4666666654111         11233466666666654


No 84 
>PRK09678 DNA-binding transcriptional regulator; Provisional
Probab=81.09  E-value=0.6  Score=25.45  Aligned_cols=42  Identities=12%  Similarity=0.433  Sum_probs=22.1

Q ss_pred             ccCCCCCCcccccccccccccCCCCCceecC--ccccccccchhH
Q psy12018         64 YQCPQCPYRTKQKELGWESLKPNAYGMYVCD--ICGKVYQHKRTL  106 (148)
Q Consensus        64 ~~C~~c~~~f~~~~~~~~~~~~~~~~~~~C~--~c~~~f~~~~~l  106 (148)
                      +.|+.||............ ....+..+.|.  .||.+|.....+
T Consensus         2 m~CP~Cg~~a~irtSr~~s-~~~~~~Y~qC~N~eCg~tF~t~es~   45 (72)
T PRK09678          2 FHCPLCQHAAHARTSRYIT-DTTKERYHQCQNVNCSATFITYESV   45 (72)
T ss_pred             ccCCCCCCccEEEEChhcC-hhhheeeeecCCCCCCCEEEEEEEE
Confidence            4578887654322111111 11345567776  788877665443


No 85 
>smart00614 ZnF_BED BED zinc finger. DNA-binding domain in chromatin-boundary-element-binding proteins and transposases
Probab=81.06  E-value=1.4  Score=21.96  Aligned_cols=21  Identities=29%  Similarity=0.608  Sum_probs=10.8

Q ss_pred             eCCCChhhhhch-----HHHHHHHHh
Q psy12018        121 QCPQCPYRAKQK-----ANLKTHLII  141 (148)
Q Consensus       121 ~C~~C~~~f~~~-----~~l~~H~~~  141 (148)
                      .|..|++.+...     +.|.+|+..
T Consensus        20 ~C~~C~~~l~~~~~~gTs~L~rHl~~   45 (50)
T smart00614       20 KCKYCGKKLSRSSKGGTSNLRRHLRR   45 (50)
T ss_pred             EecCCCCEeeeCCCCCcHHHHHHHHh
Confidence            455555544332     466666663


No 86 
>PRK00398 rpoP DNA-directed RNA polymerase subunit P; Provisional
Probab=80.91  E-value=1.1  Score=21.93  Aligned_cols=29  Identities=24%  Similarity=0.540  Sum_probs=16.4

Q ss_pred             cccCCCCCCcccccccccccccCCCCCceecCcccccc
Q psy12018         63 RYQCPQCPYRTKQKELGWESLKPNAYGMYVCDICGKVY  100 (148)
Q Consensus        63 ~~~C~~c~~~f~~~~~~~~~~~~~~~~~~~C~~c~~~f  100 (148)
                      .|.|+.||..|.....         .....|+.||..+
T Consensus         3 ~y~C~~CG~~~~~~~~---------~~~~~Cp~CG~~~   31 (46)
T PRK00398          3 EYKCARCGREVELDEY---------GTGVRCPYCGYRI   31 (46)
T ss_pred             EEECCCCCCEEEECCC---------CCceECCCCCCeE
Confidence            4677777766554321         0146777777544


No 87 
>smart00531 TFIIE Transcription initiation factor IIE.
Probab=80.61  E-value=1.5  Score=27.52  Aligned_cols=36  Identities=25%  Similarity=0.562  Sum_probs=20.3

Q ss_pred             CcccCCCCCCcccccccccccccCCCCCceecCcccccc
Q psy12018         62 PRYQCPQCPYRTKQKELGWESLKPNAYGMYVCDICGKVY  100 (148)
Q Consensus        62 ~~~~C~~c~~~f~~~~~~~~~~~~~~~~~~~C~~c~~~f  100 (148)
                      .-|.|+.|+..|......... ..  .+.|.|+.||...
T Consensus        98 ~~Y~Cp~C~~~y~~~ea~~~~-d~--~~~f~Cp~Cg~~l  133 (147)
T smart00531       98 AYYKCPNCQSKYTFLEANQLL-DM--DGTFTCPRCGEEL  133 (147)
T ss_pred             cEEECcCCCCEeeHHHHHHhc-CC--CCcEECCCCCCEE
Confidence            457788887776654321111 11  3347888887654


No 88 
>PF13717 zinc_ribbon_4:  zinc-ribbon domain
Probab=80.53  E-value=1.6  Score=20.21  Aligned_cols=10  Identities=20%  Similarity=0.614  Sum_probs=4.3

Q ss_pred             eeCCCChhhh
Q psy12018        120 FQCPQCPYRA  129 (148)
Q Consensus       120 ~~C~~C~~~f  129 (148)
                      .+|..|+..|
T Consensus        26 v~C~~C~~~f   35 (36)
T PF13717_consen   26 VRCSKCGHVF   35 (36)
T ss_pred             EECCCCCCEe
Confidence            3444444433


No 89 
>smart00834 CxxC_CXXC_SSSS Putative regulatory protein. CxxC_CXXC_SSSS represents a region of about 41 amino acids found in a number of small proteins in a wide range of bacteria. The region usually begins with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One protein in this entry has been noted as a putative regulatory protein, designated FmdB. Most proteins in this entry have a C-terminal region containing highly degenerate sequence.
Probab=80.15  E-value=0.91  Score=21.38  Aligned_cols=11  Identities=27%  Similarity=0.839  Sum_probs=5.0

Q ss_pred             ccCCCCCCccc
Q psy12018         64 YQCPQCPYRTK   74 (148)
Q Consensus        64 ~~C~~c~~~f~   74 (148)
                      |.|+.||..|.
T Consensus         6 y~C~~Cg~~fe   16 (41)
T smart00834        6 YRCEDCGHTFE   16 (41)
T ss_pred             EEcCCCCCEEE
Confidence            44444444443


No 90 
>PF03604 DNA_RNApol_7kD:  DNA directed RNA polymerase, 7 kDa subunit;  InterPro: IPR006591 DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Each class of RNA polymerase is assembled from 9 to 15 different polypeptides. Rbp10 (RNA polymerase CX) is a domain found in RNA polymerase subunit 10; present in RNA polymerase I, II and III.; GO: 0003677 DNA binding, 0003899 DNA-directed RNA polymerase activity, 0006351 transcription, DNA-dependent; PDB: 2PMZ_Z 3HKZ_X 2NVX_L 3S1Q_L 2JA6_L 3S17_L 3HOW_L 3HOV_L 3PO2_L 3HOZ_L ....
Probab=79.21  E-value=1.7  Score=19.63  Aligned_cols=7  Identities=43%  Similarity=1.578  Sum_probs=3.3

Q ss_pred             eeCCCCh
Q psy12018        120 FQCPQCP  126 (148)
Q Consensus       120 ~~C~~C~  126 (148)
                      .+|..||
T Consensus        18 irC~~CG   24 (32)
T PF03604_consen   18 IRCPECG   24 (32)
T ss_dssp             SSBSSSS
T ss_pred             EECCcCC
Confidence            3444444


No 91 
>PF14353 CpXC:  CpXC protein
Probab=78.90  E-value=0.61  Score=28.38  Aligned_cols=42  Identities=21%  Similarity=0.513  Sum_probs=22.6

Q ss_pred             cccCccccccCChhHHhccc--------ccccCCCCcccCCCCCCccccc
Q psy12018         35 FACDVCGKEYQYYRNLYRHK--------KFECGQEPRYQCPQCPYRTKQK   76 (148)
Q Consensus        35 ~~C~~C~~~f~~~~~l~~h~--------~~~~~~~~~~~C~~c~~~f~~~   76 (148)
                      .+|+.|+..|..........        ++..+.-..+.||.||..|.-.
T Consensus         2 itCP~C~~~~~~~v~~~I~~~~~p~l~e~il~g~l~~~~CP~Cg~~~~~~   51 (128)
T PF14353_consen    2 ITCPHCGHEFEFEVWTSINADEDPELKEKILDGSLFSFTCPSCGHKFRLE   51 (128)
T ss_pred             cCCCCCCCeeEEEEEeEEcCcCCHHHHHHHHcCCcCEEECCCCCCceecC
Confidence            36888887765543322111        1112222457788888776543


No 92 
>COG0068 HypF Hydrogenase maturation factor [Posttranslational modification, protein turnover, chaperones]
Probab=78.39  E-value=1.1  Score=35.16  Aligned_cols=79  Identities=19%  Similarity=0.270  Sum_probs=47.4

Q ss_pred             cccCccccccCChhHHhcccccccCCCCc-ccCCCCCCcccccccccccccCCCCCc-eecCccccccccchhHHhhHhh
Q psy12018         35 FACDVCGKEYQYYRNLYRHKKFECGQEPR-YQCPQCPYRTKQKELGWESLKPNAYGM-YVCDICGKVYQHKRTLYRHKKD  112 (148)
Q Consensus        35 ~~C~~C~~~f~~~~~l~~h~~~~~~~~~~-~~C~~c~~~f~~~~~~~~~~~~~~~~~-~~C~~c~~~f~~~~~l~~H~~~  112 (148)
                      -.|+.|-+.....++-+-        .-| ..|..||-+|.-...+.--+.++.=+. -.|+.|.+.+....+.+-|   
T Consensus       102 a~C~~Cl~Ei~dp~~rrY--------~YPF~~CT~CGPRfTIi~alPYDR~nTsM~~F~lC~~C~~EY~dP~nRRfH---  170 (750)
T COG0068         102 ATCEDCLEEIFDPNSRRY--------LYPFINCTNCGPRFTIIEALPYDRENTSMADFPLCPFCDKEYKDPLNRRFH---  170 (750)
T ss_pred             hhhHHHHHHhcCCCCcce--------eccccccCCCCcceeeeccCCCCcccCccccCcCCHHHHHHhcCccccccc---
Confidence            357777665544433111        112 348899999887653333333333222 3699999988877665433   


Q ss_pred             hhCCCCceeCCCChhh
Q psy12018        113 ECGQEPRFQCPQCPYR  128 (148)
Q Consensus       113 ~~~~~~~~~C~~C~~~  128 (148)
                          -.|..|+.||-.
T Consensus       171 ----AQp~aCp~CGP~  182 (750)
T COG0068         171 ----AQPIACPKCGPH  182 (750)
T ss_pred             ----cccccCcccCCC
Confidence                347899999863


No 93 
>PRK14873 primosome assembly protein PriA; Provisional
Probab=77.33  E-value=2  Score=33.90  Aligned_cols=10  Identities=40%  Similarity=1.364  Sum_probs=6.5

Q ss_pred             CceeCCCChh
Q psy12018        118 PRFQCPQCPY  127 (148)
Q Consensus       118 ~~~~C~~C~~  127 (148)
                      .|+.|+.||.
T Consensus       421 ~p~~Cp~Cgs  430 (665)
T PRK14873        421 PDWRCPRCGS  430 (665)
T ss_pred             cCccCCCCcC
Confidence            3567777764


No 94 
>PF15135 UPF0515:  Uncharacterised protein UPF0515
Probab=76.84  E-value=3.3  Score=28.26  Aligned_cols=21  Identities=24%  Similarity=0.578  Sum_probs=14.8

Q ss_pred             CCCCCCCCccccCccccccCC
Q psy12018         26 PFKPKLYGKFACDVCGKEYQY   46 (148)
Q Consensus        26 ~~~~~~~~~~~C~~C~~~f~~   46 (148)
                      ...+..++-|.|..|+.....
T Consensus       104 ~~ip~~drqFaC~~Cd~~WwR  124 (278)
T PF15135_consen  104 NLIPSVDRQFACSSCDHMWWR  124 (278)
T ss_pred             ccccccceeeeccccchHHHh
Confidence            345677788999999765433


No 95 
>TIGR00622 ssl1 transcription factor ssl1. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=76.43  E-value=7  Score=23.34  Aligned_cols=48  Identities=13%  Similarity=0.189  Sum_probs=24.4

Q ss_pred             ecCccccccccchhHHhhHhhhhCCCCceeCCCChhhhhchHHHHHHHHhh
Q psy12018         92 VCDICGKVYQHKRTLYRHKKDECGQEPRFQCPQCPYRAKQKANLKTHLIIK  142 (148)
Q Consensus        92 ~C~~c~~~f~~~~~l~~H~~~~~~~~~~~~C~~C~~~f~~~~~l~~H~~~~  142 (148)
                      .|-.|...|........-.  -.. ...|+|..|...|--.-+.-.|..+|
T Consensus        57 ~C~~C~~~f~~~~~~~~~~--~~~-~~~y~C~~C~~~FC~dCD~fiHe~Lh  104 (112)
T TIGR00622        57 FCFGCQGPFPKPPVSPFDE--LKD-SHRYVCAVCKNVFCVDCDVFVHESLH  104 (112)
T ss_pred             cccCcCCCCCCcccccccc--ccc-ccceeCCCCCCccccccchhhhhhcc
Confidence            3666766665432111000  111 23577777777776655555565544


No 96 
>TIGR00595 priA primosomal protein N'. All proteins in this family for which functions are known are components of the primosome which is involved in replication, repair, and recombination.This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=76.39  E-value=2.5  Score=32.21  Aligned_cols=47  Identities=23%  Similarity=0.386  Sum_probs=22.6

Q ss_pred             cCCCCCCcccccccccccccCCCCCceecCccccccccchhHHhhHhhhhCCCCceeCCCChh
Q psy12018         65 QCPQCPYRTKQKELGWESLKPNAYGMYVCDICGKVYQHKRTLYRHKKDECGQEPRFQCPQCPY  127 (148)
Q Consensus        65 ~C~~c~~~f~~~~~~~~~~~~~~~~~~~C~~c~~~f~~~~~l~~H~~~~~~~~~~~~C~~C~~  127 (148)
                      .|..||.......--.....|.......|.+||...                ..|..|+.|+.
T Consensus       215 ~C~~Cg~~~~C~~C~~~l~~h~~~~~l~Ch~Cg~~~----------------~~~~~Cp~C~s  261 (505)
T TIGR00595       215 LCRSCGYILCCPNCDVSLTYHKKEGKLRCHYCGYQE----------------PIPKTCPQCGS  261 (505)
T ss_pred             EhhhCcCccCCCCCCCceEEecCCCeEEcCCCcCcC----------------CCCCCCCCCCC
Confidence            466666554443211111112233456677776332                44667777764


No 97 
>KOG4167|consensus
Probab=76.27  E-value=0.57  Score=36.68  Aligned_cols=29  Identities=28%  Similarity=0.440  Sum_probs=25.7

Q ss_pred             CCCccccCccccccCChhHHhcccccccC
Q psy12018         31 LYGKFACDVCGKEYQYYRNLYRHKKFECG   59 (148)
Q Consensus        31 ~~~~~~C~~C~~~f~~~~~l~~h~~~~~~   59 (148)
                      .+.-|.|..|++.|.....+.+||+.|.-
T Consensus       789 ~~giFpCreC~kvF~KiKSrNAHMK~Hr~  817 (907)
T KOG4167|consen  789 PTGIFPCRECGKVFFKIKSRNAHMKTHRQ  817 (907)
T ss_pred             CCceeehHHHHHHHHHHhhhhHHHHHHHH
Confidence            36679999999999999999999998864


No 98 
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only]
Probab=75.98  E-value=4.6  Score=29.06  Aligned_cols=102  Identities=20%  Similarity=0.275  Sum_probs=54.6

Q ss_pred             ccccCc--cccccCChhHHhcccccccCCCCcccCCCCC---Ccccccc-------cccccccCC-C---CCceecCccc
Q psy12018         34 KFACDV--CGKEYQYYRNLYRHKKFECGQEPRYQCPQCP---YRTKQKE-------LGWESLKPN-A---YGMYVCDICG   97 (148)
Q Consensus        34 ~~~C~~--C~~~f~~~~~l~~h~~~~~~~~~~~~C~~c~---~~f~~~~-------~~~~~~~~~-~---~~~~~C~~c~   97 (148)
                      .|.|+.  |...-..-..|..|.++.++   -+.|.+|-   +.|...-       +..+...-. +   .+--.|..|.
T Consensus       151 ~F~CP~skc~~~C~~~k~lk~H~K~~H~---~~~C~~C~~nKk~F~~E~~lF~~~~Lr~H~~~G~~e~GFKGHP~C~FC~  227 (493)
T COG5236         151 SFKCPKSKCHRRCGSLKELKKHYKAQHG---FVLCSECIGNKKDFWNEIRLFRSSTLRDHKNGGLEEEGFKGHPLCIFCK  227 (493)
T ss_pred             HhcCCchhhhhhhhhHHHHHHHHHhhcC---cEEhHhhhcCcccCccceeeeecccccccccCCccccCcCCCchhhhcc
Confidence            356665  55444445677777766554   25566653   2343332       111111111 1   1234689999


Q ss_pred             cccccchhHHhhHhhhhCCCCceeCCCC----hhhhhchHHHHHHHH
Q psy12018         98 KVYQHKRTLYRHKKDECGQEPRFQCPQC----PYRAKQKANLKTHLI  140 (148)
Q Consensus        98 ~~f~~~~~l~~H~~~~~~~~~~~~C~~C----~~~f~~~~~l~~H~~  140 (148)
                      ..|-.-..|..|.+..+.  +=+.|..-    .+-|.+...|..|.+
T Consensus       228 ~~FYdDDEL~~HcR~~HE--~ChICD~v~p~~~QYFK~Y~~Le~HF~  272 (493)
T COG5236         228 IYFYDDDELRRHCRLRHE--ACHICDMVGPIRYQYFKSYEDLEAHFR  272 (493)
T ss_pred             ceecChHHHHHHHHhhhh--hhhhhhccCccchhhhhCHHHHHHHhh
Confidence            889888889888886553  22333221    134555556666654


No 99 
>PHA00626 hypothetical protein
Probab=75.80  E-value=3.6  Score=21.13  Aligned_cols=11  Identities=45%  Similarity=0.718  Sum_probs=5.7

Q ss_pred             ceecCcccccc
Q psy12018         90 MYVCDICGKVY  100 (148)
Q Consensus        90 ~~~C~~c~~~f  100 (148)
                      .|+|+.|+..|
T Consensus        23 rYkCkdCGY~f   33 (59)
T PHA00626         23 DYVCCDCGYND   33 (59)
T ss_pred             ceEcCCCCCee
Confidence            35555555544


No 100
>PF12907 zf-met2:  Zinc-binding
Probab=75.45  E-value=1.2  Score=21.32  Aligned_cols=27  Identities=30%  Similarity=0.381  Sum_probs=17.7

Q ss_pred             eeCCCChhhhhc---hHHHHHHHHhhcCCc
Q psy12018        120 FQCPQCPYRAKQ---KANLKTHLIIKHDSV  146 (148)
Q Consensus       120 ~~C~~C~~~f~~---~~~l~~H~~~~h~~~  146 (148)
                      +.|.+|-..|..   ...|..|....|...
T Consensus         2 i~C~iC~qtF~~t~~~~~L~eH~enKHpK~   31 (40)
T PF12907_consen    2 IICKICRQTFMQTTNEPQLKEHAENKHPKN   31 (40)
T ss_pred             cCcHHhhHHHHhcCCHHHHHHHHHccCCCC
Confidence            467777766653   356777777777654


No 101
>PF07975 C1_4:  TFIIH C1-like domain;  InterPro: IPR004595 All proteins in this domain for which functions are known are components of the TFIIH complex which is involved in the initiation of transcription and nucleotide excision repair. It includes the yeast transcription factor Ssl1 (Suppressor of stem-loop protein 1) that is essential for translation initiation and affects UV resistance. The C-terminal region is essential for transcription activity. This regions binds three zinc atoms through two independent domain. The first contains a C4 zinc finger motif, whereas the second is characterised by a CX(2)CX(2-4)FCADCD motif. The solution structure of the second C-terminal domain revealed homology with the regulatory domain of protein kinase C [].; GO: 0006281 DNA repair, 0005634 nucleus; PDB: 1Z60_A.
Probab=73.37  E-value=2.8  Score=21.18  Aligned_cols=23  Identities=13%  Similarity=0.541  Sum_probs=13.3

Q ss_pred             CCccccCccccccCChhHHhccc
Q psy12018         32 YGKFACDVCGKEYQYYRNLYRHK   54 (148)
Q Consensus        32 ~~~~~C~~C~~~f~~~~~l~~h~   54 (148)
                      ...|.|+.|...|-..-++-.|.
T Consensus        19 ~~~y~C~~C~~~FC~dCD~fiHE   41 (51)
T PF07975_consen   19 SSRYRCPKCKNHFCIDCDVFIHE   41 (51)
T ss_dssp             -EEE--TTTT--B-HHHHHTTTT
T ss_pred             CCeEECCCCCCccccCcChhhhc
Confidence            45688999999888888877774


No 102
>smart00734 ZnF_Rad18 Rad18-like CCHC zinc finger. Yeast Rad18p functions with Rad5p in error-free post-replicative DNA repair. This zinc finger is likely to bind nucleic-acids.
Probab=73.01  E-value=3.5  Score=17.53  Aligned_cols=19  Identities=32%  Similarity=0.627  Sum_probs=12.0

Q ss_pred             eCCCChhhhhchHHHHHHHH
Q psy12018        121 QCPQCPYRAKQKANLKTHLI  140 (148)
Q Consensus       121 ~C~~C~~~f~~~~~l~~H~~  140 (148)
                      .|+.|++.+ ....+..|+.
T Consensus         3 ~CPiC~~~v-~~~~in~HLD   21 (26)
T smart00734        3 QCPVCFREV-PENLINSHLD   21 (26)
T ss_pred             cCCCCcCcc-cHHHHHHHHH
Confidence            577777776 4456666654


No 103
>PF15269 zf-C2H2_7:  Zinc-finger
Probab=72.92  E-value=2.6  Score=20.53  Aligned_cols=22  Identities=32%  Similarity=0.859  Sum_probs=16.1

Q ss_pred             eeCCCChhhhhchHHHHHHHHh
Q psy12018        120 FQCPQCPYRAKQKANLKTHLII  141 (148)
Q Consensus       120 ~~C~~C~~~f~~~~~l~~H~~~  141 (148)
                      |+|-+|.-.....++|..|++-
T Consensus        21 ykcfqcpftc~~kshl~nhmky   42 (54)
T PF15269_consen   21 YKCFQCPFTCNEKSHLFNHMKY   42 (54)
T ss_pred             ceeecCCcccchHHHHHHHHHH
Confidence            5677777777777888777763


No 104
>KOG2893|consensus
Probab=72.56  E-value=1.7  Score=29.48  Aligned_cols=40  Identities=20%  Similarity=0.448  Sum_probs=30.1

Q ss_pred             CCCccccCccccccCChhHHhcccccccCCCCcccCCCCCCccccc
Q psy12018         31 LYGKFACDVCGKEYQYYRNLYRHKKFECGQEPRYQCPQCPYRTKQK   76 (148)
Q Consensus        31 ~~~~~~C~~C~~~f~~~~~l~~h~~~~~~~~~~~~C~~c~~~f~~~   76 (148)
                      ..++ .|=.|.+.|....-|.+|++     .+.|+|.+|-+.+-+.
T Consensus         8 ~~kp-wcwycnrefddekiliqhqk-----akhfkchichkkl~sg   47 (341)
T KOG2893|consen    8 VDKP-WCWYCNREFDDEKILIQHQK-----AKHFKCHICHKKLFSG   47 (341)
T ss_pred             cCCc-eeeecccccchhhhhhhhhh-----hccceeeeehhhhccC
Confidence            3444 56679999999999999985     3578999997765443


No 105
>KOG2186|consensus
Probab=72.41  E-value=2.6  Score=28.80  Aligned_cols=50  Identities=18%  Similarity=0.405  Sum_probs=30.0

Q ss_pred             ccCCCCCCcccccccccccccCCCCCceecCccccccccchhHHhhHhhhhC
Q psy12018         64 YQCPQCPYRTKQKELGWESLKPNAYGMYVCDICGKVYQHKRTLYRHKKDECG  115 (148)
Q Consensus        64 ~~C~~c~~~f~~~~~~~~~~~~~~~~~~~C~~c~~~f~~~~~l~~H~~~~~~  115 (148)
                      |.|..||....-..+ ..|+..-....|.|..|+..|.. .....|..--+.
T Consensus         4 FtCnvCgEsvKKp~v-ekH~srCrn~~fSCIDC~k~F~~-~sYknH~kCITE   53 (276)
T KOG2186|consen    4 FTCNVCGESVKKPQV-EKHMSRCRNAYFSCIDCGKTFER-VSYKNHTKCITE   53 (276)
T ss_pred             Eehhhhhhhccccch-HHHHHhccCCeeEEeeccccccc-chhhhhhhhcch
Confidence            677778776665432 22443333466788888888766 455556554444


No 106
>COG1996 RPC10 DNA-directed RNA polymerase, subunit RPC10 (contains C4-type Zn-finger) [Transcription]
Probab=72.29  E-value=2.8  Score=20.97  Aligned_cols=10  Identities=30%  Similarity=1.035  Sum_probs=5.3

Q ss_pred             ccCCCCCCcc
Q psy12018         64 YQCPQCPYRT   73 (148)
Q Consensus        64 ~~C~~c~~~f   73 (148)
                      |.|..||+.|
T Consensus         7 Y~C~~Cg~~~   16 (49)
T COG1996           7 YKCARCGREV   16 (49)
T ss_pred             EEhhhcCCee
Confidence            5555555544


No 107
>PTZ00255 60S ribosomal protein L37a; Provisional
Probab=71.36  E-value=2.7  Score=23.98  Aligned_cols=32  Identities=28%  Similarity=0.669  Sum_probs=17.8

Q ss_pred             CcccCCCCCCcccccccccccccCCCCCceecCcccccccc
Q psy12018         62 PRYQCPQCPYRTKQKELGWESLKPNAYGMYVCDICGKVYQH  102 (148)
Q Consensus        62 ~~~~C~~c~~~f~~~~~~~~~~~~~~~~~~~C~~c~~~f~~  102 (148)
                      ..|.|+.|++.-..         -...+.|.|..|++.|.-
T Consensus        35 a~y~CpfCgk~~vk---------R~a~GIW~C~~C~~~~AG   66 (90)
T PTZ00255         35 AKYFCPFCGKHAVK---------RQAVGIWRCKGCKKTVAG   66 (90)
T ss_pred             CCccCCCCCCCcee---------eeeeEEEEcCCCCCEEeC
Confidence            35777777753111         122345777777776643


No 108
>PF01780 Ribosomal_L37ae:  Ribosomal L37ae protein family;  InterPro: IPR002674 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms. The codons of the mRNA are exposed on the ribosome to allow tRNA binding. This leads to the incorporation of amino acids into the growing polypeptide chain in accordance with the genetic information. Incoming amino acid monomers enter the ribosomal A site in the form of aminoacyl-tRNAs complexed with elongation factor Tu (EF-Tu) and GTP. The growing polypeptide chain, situated in the P site as peptidyl-tRNA, is then transferred to aminoacyl-tRNA and the new peptidyl-tRNA, extended by one residue, is translocated to the P site with the aid the elongation factor G (EF-G) and GTP as the deacylated tRNA is released from the ribosome through one or more exit sites [, ]. About 2/3 of the mass of the ribosome consists of RNA and 1/3 of protein. The proteins are named in accordance with the subunit of the ribosome which they belong to - the small (S1 to S31) and the large (L1 to L44). Usually they decorate the rRNA cores of the subunits.  Many ribosomal proteins, particularly those of the large subunit, are composed of a globular, surfaced-exposed domain with long finger-like projections that extend into the rRNA core to stabilise its structure. Most of the proteins interact with multiple RNA elements, often from different domains. In the large subunit, about 1/3 of the 23S rRNA nucleotides are at least in van der Waal's contact with protein, and L22 interacts with all six domains of the 23S rRNA. Proteins S4 and S7, which initiate assembly of the 16S rRNA, are located at junctions of five and four RNA helices, respectively. In this way proteins serve to organise and stabilise the rRNA tertiary structure. While the crucial activities of decoding and peptide transfer are RNA based, proteins play an active role in functions that may have evolved to streamline the process of protein synthesis. In addition to their function in the ribosome, many ribosomal proteins have some function 'outside' the ribosome [, ]. This ribosomal protein is found in archaebacteria and eukaryotes []. Ribosomal protein L37 has a single zinc finger-like motif of the C2-C2 type [].; GO: 0003735 structural constituent of ribosome, 0006412 translation, 0005622 intracellular, 0005840 ribosome; PDB: 4A1E_Y 4A17_Y 4A1C_Y 4A1A_Y 3O58_g 3IZS_m 3O5H_g 1S1I_9 3IZR_m 1YSH_D ....
Probab=71.08  E-value=1.7  Score=24.84  Aligned_cols=30  Identities=33%  Similarity=0.879  Sum_probs=15.9

Q ss_pred             cccCCCCCCcccccccccccccCCCCCceecCccccccc
Q psy12018         63 RYQCPQCPYRTKQKELGWESLKPNAYGMYVCDICGKVYQ  101 (148)
Q Consensus        63 ~~~C~~c~~~f~~~~~~~~~~~~~~~~~~~C~~c~~~f~  101 (148)
                      .|.|+.|++.-.-         -.....|.|..|++.|.
T Consensus        35 ky~Cp~Cgk~~vk---------R~a~GIW~C~~C~~~~A   64 (90)
T PF01780_consen   35 KYTCPFCGKTSVK---------RVATGIWKCKKCGKKFA   64 (90)
T ss_dssp             -BEESSSSSSEEE---------EEETTEEEETTTTEEEE
T ss_pred             CCcCCCCCCceeE---------EeeeEEeecCCCCCEEe
Confidence            4777777764211         11233566777776654


No 109
>COG4957 Predicted transcriptional regulator [Transcription]
Probab=71.07  E-value=2.9  Score=25.70  Aligned_cols=22  Identities=27%  Similarity=0.333  Sum_probs=12.1

Q ss_pred             eeCCCChhhhhchHHHHHHHHhhcC
Q psy12018        120 FQCPQCPYRAKQKANLKTHLIIKHD  144 (148)
Q Consensus       120 ~~C~~C~~~f~~~~~l~~H~~~~h~  144 (148)
                      ..|-++|+.|.   .|.+|+.+|++
T Consensus        77 IicLEDGkkfK---SLKRHL~t~~g   98 (148)
T COG4957          77 IICLEDGKKFK---SLKRHLTTHYG   98 (148)
T ss_pred             EEEeccCcchH---HHHHHHhcccC
Confidence            45556666555   34556655554


No 110
>PF00301 Rubredoxin:  Rubredoxin;  InterPro: IPR004039 Rubredoxin is a low molecular weight iron-containing bacterial protein involved in electron transfer [, ], sometimes replacing ferredoxin as an electron carrier []. The 3-D structures of a number of rubredoxins have been solved [, ]. The fold belongs to the alpha+beta class, with 2 alpha-helices and 2-3 beta-strands. Its active site contains an iron ion which is co-ordinated by the sulphurs of four conserved cysteine residues forming an almost regular tetrahedron. The conserved cysteines reside on two loops, which are the most conserved regions of the protein. In addition, a ring of acidic residues in the proximity of the [Fe(Cys)4] centre is also well-conserved []. ; GO: 0009055 electron carrier activity, 0046872 metal ion binding; PDB: 2RDV_C 1RDV_A 1S24_A 1T9O_B 1B2J_A 1SMW_A 2PVE_B 1BFY_A 1T9P_C 1C09_C ....
Probab=69.65  E-value=5.4  Score=19.78  Aligned_cols=7  Identities=57%  Similarity=1.426  Sum_probs=2.8

Q ss_pred             ccCcccc
Q psy12018         36 ACDVCGK   42 (148)
Q Consensus        36 ~C~~C~~   42 (148)
                      .|..|+-
T Consensus         3 ~C~~Cgy    9 (47)
T PF00301_consen    3 QCPVCGY    9 (47)
T ss_dssp             EETTTSB
T ss_pred             CCCCCCE
Confidence            3444443


No 111
>cd00730 rubredoxin Rubredoxin; nonheme iron binding domains containing a [Fe(SCys)4] center. Rubredoxins are small nonheme iron proteins. The iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), but iron can also be replaced by cobalt, nickel or zinc. They are believed to be involved in electron transfer.
Probab=69.41  E-value=6  Score=19.88  Aligned_cols=8  Identities=38%  Similarity=1.149  Sum_probs=3.3

Q ss_pred             ccCccccc
Q psy12018         36 ACDVCGKE   43 (148)
Q Consensus        36 ~C~~C~~~   43 (148)
                      .|..||-.
T Consensus         3 ~C~~Cgyi   10 (50)
T cd00730           3 ECRICGYI   10 (50)
T ss_pred             CCCCCCeE
Confidence            34444433


No 112
>PF04959 ARS2:  Arsenite-resistance protein 2;  InterPro: IPR007042 This entry represents Arsenite-resistance protein 2 (also known as Serrate RNA effector molecule homolog) which is thought to play a role in arsenite resistance [], although does not directly confer arsenite resistance but rather modulates arsenic sensitivity []. Arsenite is a carcinogenic compound which can act as a comutagen by inhibiting DNA repair. It is also involved in cell cycle progression at S phase. ; PDB: 3AX1_A.
Probab=69.16  E-value=4  Score=27.36  Aligned_cols=29  Identities=24%  Similarity=0.518  Sum_probs=18.7

Q ss_pred             CceeCCCChhhhhchHHHHHHHHhhcCCc
Q psy12018        118 PRFQCPQCPYRAKQKANLKTHLIIKHDSV  146 (148)
Q Consensus       118 ~~~~C~~C~~~f~~~~~l~~H~~~~h~~~  146 (148)
                      ..|.|..|+|.|.-..=+.+|+...|.+.
T Consensus        76 ~K~~C~lc~KlFkg~eFV~KHI~nKH~e~  104 (214)
T PF04959_consen   76 DKWRCPLCGKLFKGPEFVRKHIFNKHPEK  104 (214)
T ss_dssp             EEEEE-SSS-EESSHHHHHHHHHHH-HHH
T ss_pred             CEECCCCCCcccCChHHHHHHHhhcCHHH
Confidence            34777777777777777777777777654


No 113
>KOG4173|consensus
Probab=68.89  E-value=2.2  Score=28.29  Aligned_cols=80  Identities=19%  Similarity=0.328  Sum_probs=52.8

Q ss_pred             cccCCC--CCCcccccccccccccCCCCCceecCccccccccchhHHhhHhhhhCC---------CCceeCC--CChhhh
Q psy12018         63 RYQCPQ--CPYRTKQKELGWESLKPNAYGMYVCDICGKVYQHKRTLYRHKKDECGQ---------EPRFQCP--QCPYRA  129 (148)
Q Consensus        63 ~~~C~~--c~~~f~~~~~~~~~~~~~~~~~~~C~~c~~~f~~~~~l~~H~~~~~~~---------~~~~~C~--~C~~~f  129 (148)
                      .+.|+.  |.+.|.+..-+.++ .++... -.|..|.+.|.....|..|+.-.+.-         ..-|+|-  .|+-.|
T Consensus        79 ~~~cqvagc~~~~d~lD~~E~h-Y~~~h~-~sCs~C~r~~Pt~hLLd~HI~E~HDs~Fqa~veRG~dMy~ClvEgCt~KF  156 (253)
T KOG4173|consen   79 AFACQVAGCCQVFDALDDYEHH-YHTLHG-NSCSFCKRAFPTGHLLDAHILEWHDSLFQALVERGQDMYQCLVEGCTEKF  156 (253)
T ss_pred             cccccccchHHHHhhhhhHHHh-hhhccc-chhHHHHHhCCchhhhhHHHHHHHHHHHHHHHHcCccHHHHHHHhhhhhh
Confidence            366765  44555554322222 111111 26999999999999999998755431         2237784  599999


Q ss_pred             hchHHHHHHHHhhcC
Q psy12018        130 KQKANLKTHLIIKHD  144 (148)
Q Consensus       130 ~~~~~l~~H~~~~h~  144 (148)
                      .+...-..|+-..|.
T Consensus       157 kT~r~RkdH~I~~Hk  171 (253)
T KOG4173|consen  157 KTSRDRKDHMIRMHK  171 (253)
T ss_pred             hhhhhhhhHHHHhcc
Confidence            999999999988775


No 114
>PF06524 NOA36:  NOA36 protein;  InterPro: IPR010531 This family consists of several NOA36 proteins which contain 29 highly conserved cysteine residues. The function of this protein is unknown.; GO: 0008270 zinc ion binding, 0005634 nucleus
Probab=68.82  E-value=1.3  Score=30.45  Aligned_cols=20  Identities=25%  Similarity=0.783  Sum_probs=12.9

Q ss_pred             CCceeCCCChhhhhchHHHH
Q psy12018        117 EPRFQCPQCPYRAKQKANLK  136 (148)
Q Consensus       117 ~~~~~C~~C~~~f~~~~~l~  136 (148)
                      .++++|+.||........|.
T Consensus       207 ~k~~PCPKCg~et~eTkdLS  226 (314)
T PF06524_consen  207 GKPIPCPKCGYETQETKDLS  226 (314)
T ss_pred             CCCCCCCCCCCcccccccce
Confidence            46778888876665554443


No 115
>KOG4167|consensus
Probab=68.29  E-value=2.1  Score=33.79  Aligned_cols=25  Identities=16%  Similarity=0.312  Sum_probs=21.0

Q ss_pred             ceeCCCChhhhhchHHHHHHHHhhc
Q psy12018        119 RFQCPQCPYRAKQKANLKTHLIIKH  143 (148)
Q Consensus       119 ~~~C~~C~~~f~~~~~l~~H~~~~h  143 (148)
                      -|.|.+|+|.|-.-..+..||+.|-
T Consensus       792 iFpCreC~kvF~KiKSrNAHMK~Hr  816 (907)
T KOG4167|consen  792 IFPCRECGKVFFKIKSRNAHMKTHR  816 (907)
T ss_pred             eeehHHHHHHHHHHhhhhHHHHHHH
Confidence            4889999999988888888888774


No 116
>TIGR01206 lysW lysine biosynthesis protein LysW. This very small, poorly characterized protein has been shown essential in Thermus thermophilus for an unusual pathway of Lys biosynthesis from aspartate by way of alpha-aminoadipate (AAA) rather than diaminopimelate. It is found also in Deinococcus radiodurans and Pyrococcus horikoshii, which appear to share the AAA pathway.
Probab=67.36  E-value=2.6  Score=21.60  Aligned_cols=10  Identities=30%  Similarity=1.142  Sum_probs=5.6

Q ss_pred             ccCCCCCCcc
Q psy12018         64 YQCPQCPYRT   73 (148)
Q Consensus        64 ~~C~~c~~~f   73 (148)
                      +.|+.|+..+
T Consensus         3 ~~CP~CG~~i   12 (54)
T TIGR01206         3 FECPDCGAEI   12 (54)
T ss_pred             cCCCCCCCEE
Confidence            4566666544


No 117
>KOG2186|consensus
Probab=66.05  E-value=2.8  Score=28.68  Aligned_cols=46  Identities=17%  Similarity=0.399  Sum_probs=34.5

Q ss_pred             ccccCccccccCChhHHhcccccccCCCCcccCCCCCCccccccccccc
Q psy12018         34 KFACDVCGKEYQYYRNLYRHKKFECGQEPRYQCPQCPYRTKQKELGWES   82 (148)
Q Consensus        34 ~~~C~~C~~~f~~~~~l~~h~~~~~~~~~~~~C~~c~~~f~~~~~~~~~   82 (148)
                      -|.|..||..... ..+-.|+....+  .-|.|-.|++.|-..+...+.
T Consensus         3 ~FtCnvCgEsvKK-p~vekH~srCrn--~~fSCIDC~k~F~~~sYknH~   48 (276)
T KOG2186|consen    3 FFTCNVCGESVKK-PQVEKHMSRCRN--AYFSCIDCGKTFERVSYKNHT   48 (276)
T ss_pred             EEehhhhhhhccc-cchHHHHHhccC--CeeEEeecccccccchhhhhh
Confidence            3789999998765 466679877766  469999999999886543333


No 118
>TIGR00280 L37a ribosomal protein L37a. This model finds eukaryotic ribosomal protein L37a and its archaeal orthologs. The nomeclature is tricky because eukaryotes have proteins called both L37 and L37a.
Probab=65.93  E-value=2.2  Score=24.38  Aligned_cols=31  Identities=29%  Similarity=0.847  Sum_probs=17.2

Q ss_pred             cccCCCCCCcccccccccccccCCCCCceecCcccccccc
Q psy12018         63 RYQCPQCPYRTKQKELGWESLKPNAYGMYVCDICGKVYQH  102 (148)
Q Consensus        63 ~~~C~~c~~~f~~~~~~~~~~~~~~~~~~~C~~c~~~f~~  102 (148)
                      .|.|+.|++.-..         -..-+.|.|..|++.|.-
T Consensus        35 ~y~CpfCgk~~vk---------R~a~GIW~C~~C~~~~AG   65 (91)
T TIGR00280        35 KYVCPFCGKKTVK---------RGSTGIWTCRKCGAKFAG   65 (91)
T ss_pred             CccCCCCCCCceE---------EEeeEEEEcCCCCCEEeC
Confidence            4777777753111         122345677777776643


No 119
>COG3357 Predicted transcriptional regulator containing an HTH domain fused to a Zn-ribbon [Transcription]
Probab=64.70  E-value=3.9  Score=23.28  Aligned_cols=14  Identities=14%  Similarity=0.636  Sum_probs=7.7

Q ss_pred             CcccCCCCCCcccc
Q psy12018         62 PRYQCPQCPYRTKQ   75 (148)
Q Consensus        62 ~~~~C~~c~~~f~~   75 (148)
                      .|..|..||..|..
T Consensus        57 ~Pa~CkkCGfef~~   70 (97)
T COG3357          57 RPARCKKCGFEFRD   70 (97)
T ss_pred             cChhhcccCccccc
Confidence            45556666655544


No 120
>KOG2785|consensus
Probab=64.61  E-value=6.5  Score=28.64  Aligned_cols=53  Identities=21%  Similarity=0.263  Sum_probs=43.3

Q ss_pred             ceecCccccccccchhHHhhHhhhhCC----------------------CCceeCCCCh---hhhhchHHHHHHHHhh
Q psy12018         90 MYVCDICGKVYQHKRTLYRHKKDECGQ----------------------EPRFQCPQCP---YRAKQKANLKTHLIIK  142 (148)
Q Consensus        90 ~~~C~~c~~~f~~~~~l~~H~~~~~~~----------------------~~~~~C~~C~---~~f~~~~~l~~H~~~~  142 (148)
                      |-.|.+|+..+........|+..++|-                      .+.+.|-.|+   +.|++-...+.||...
T Consensus       166 Pt~CLfC~~~~k~~e~~~~HM~~~HgffIPdreYL~D~~GLl~YLgeKV~~~~~CL~CN~~~~~f~sleavr~HM~~K  243 (390)
T KOG2785|consen  166 PTDCLFCDKKSKSLEENLKHMFKEHGFFIPDREYLTDEKGLLKYLGEKVGIGFICLFCNELGRPFSSLEAVRAHMRDK  243 (390)
T ss_pred             CcceeecCCCcccHHHHHHHHhhccCCcCCchHhhhchhHHHHHHHHHhccCceEEEeccccCcccccHHHHHHHhhc
Confidence            356999999999998899999988873                      2247788887   9999999999999754


No 121
>KOG4173|consensus
Probab=64.61  E-value=2.4  Score=28.05  Aligned_cols=75  Identities=21%  Similarity=0.355  Sum_probs=37.1

Q ss_pred             cccCc--cccccCChhHHhcccccccCCCCcccCCCCCCccccccccccccc-----------CCCCCceecC--ccccc
Q psy12018         35 FACDV--CGKEYQYYRNLYRHKKFECGQEPRYQCPQCPYRTKQKELGWESLK-----------PNAYGMYVCD--ICGKV   99 (148)
Q Consensus        35 ~~C~~--C~~~f~~~~~l~~h~~~~~~~~~~~~C~~c~~~f~~~~~~~~~~~-----------~~~~~~~~C~--~c~~~   99 (148)
                      +.|+.  |-..|........|--+.++    ..|..|.+.|.+.-++..|..           ..|..-|.|.  .|+-.
T Consensus        80 ~~cqvagc~~~~d~lD~~E~hY~~~h~----~sCs~C~r~~Pt~hLLd~HI~E~HDs~Fqa~veRG~dMy~ClvEgCt~K  155 (253)
T KOG4173|consen   80 FACQVAGCCQVFDALDDYEHHYHTLHG----NSCSFCKRAFPTGHLLDAHILEWHDSLFQALVERGQDMYQCLVEGCTEK  155 (253)
T ss_pred             ccccccchHHHHhhhhhHHHhhhhccc----chhHHHHHhCCchhhhhHHHHHHHHHHHHHHHHcCccHHHHHHHhhhhh
Confidence            55655  44555554444444322222    356667776666533222221           1223346663  36666


Q ss_pred             cccchhHHhhHhhh
Q psy12018        100 YQHKRTLYRHKKDE  113 (148)
Q Consensus       100 f~~~~~l~~H~~~~  113 (148)
                      |........|+-.-
T Consensus       156 FkT~r~RkdH~I~~  169 (253)
T KOG4173|consen  156 FKTSRDRKDHMIRM  169 (253)
T ss_pred             hhhhhhhhhHHHHh
Confidence            66666666665443


No 122
>COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair]
Probab=63.46  E-value=6.7  Score=31.40  Aligned_cols=45  Identities=27%  Similarity=0.481  Sum_probs=25.6

Q ss_pred             ccCccccccCCh---hHHhcccccccCCCCcccCCCCCCcccccccccccccCCCCCceecCccccc
Q psy12018         36 ACDVCGKEYQYY---RNLYRHKKFECGQEPRYQCPQCPYRTKQKELGWESLKPNAYGMYVCDICGKV   99 (148)
Q Consensus        36 ~C~~C~~~f~~~---~~l~~h~~~~~~~~~~~~C~~c~~~f~~~~~~~~~~~~~~~~~~~C~~c~~~   99 (148)
                      .|..||..+...   ..|.-|+.     .....|..||..              ...|..|+.||..
T Consensus       437 ~C~~Cg~v~~Cp~Cd~~lt~H~~-----~~~L~CH~Cg~~--------------~~~p~~Cp~Cgs~  484 (730)
T COG1198         437 LCRDCGYIAECPNCDSPLTLHKA-----TGQLRCHYCGYQ--------------EPIPQSCPECGSE  484 (730)
T ss_pred             ecccCCCcccCCCCCcceEEecC-----CCeeEeCCCCCC--------------CCCCCCCCCCCCC
Confidence            377777776554   23333332     345667777742              2335678888754


No 123
>PRK05580 primosome assembly protein PriA; Validated
Probab=62.88  E-value=6.6  Score=31.17  Aligned_cols=10  Identities=30%  Similarity=0.727  Sum_probs=5.7

Q ss_pred             CceeCCCChh
Q psy12018        118 PRFQCPQCPY  127 (148)
Q Consensus       118 ~~~~C~~C~~  127 (148)
                      .|..|+.||.
T Consensus       420 ~~~~Cp~Cg~  429 (679)
T PRK05580        420 IPKACPECGS  429 (679)
T ss_pred             CCCCCCCCcC
Confidence            4556666654


No 124
>PF05191 ADK_lid:  Adenylate kinase, active site lid;  InterPro: IPR007862 Adenylate kinases (ADK; 2.7.4.3 from EC) are phosphotransferases that catalyse the Mg-dependent reversible conversion of ATP and AMP to two molecules of ADP, an essential reaction for many processes in living cells. In large variants of adenylate kinase, the AMP and ATP substrates are buried in a domain that undergoes conformational changes from an open to a closed state when bound to substrate; the ligand is then contained within a highly specific environment required for catalysis. Adenylate kinase is a 3-domain protein consisting of a large central CORE domain flanked by a LID domain on one side and the AMP-binding NMPbind domain on the other []. The LID domain binds ATP and covers the phosphates at the active site. The substrates first bind the CORE domain, followed by closure of the active site by the LID and NMPbind domains. Comparisons of adenylate kinases have revealed a particular divergence in the active site lid. In some organisms, particularly the Gram-positive bacteria, residues in the lid domain have been mutated to cysteines and these cysteine residues (two CX(n)C motifs) are responsible for the binding of a zinc ion. The bound zinc ion in the lid domain is clearly structurally homologous to Zinc-finger domains. However, it is unclear whether the adenylate kinase lid is a novel zinc-finger DNA/RNA binding domain, or that the lid bound zinc serves a purely structural function [].; GO: 0004017 adenylate kinase activity; PDB: 3BE4_A 2OSB_B 2ORI_A 2EU8_A 3DL0_A 1P3J_A 2QAJ_A 2OO7_A 2P3S_A 3DKV_A ....
Probab=62.33  E-value=3.7  Score=19.03  Aligned_cols=11  Identities=36%  Similarity=1.298  Sum_probs=6.5

Q ss_pred             eecCccccccc
Q psy12018         91 YVCDICGKVYQ  101 (148)
Q Consensus        91 ~~C~~c~~~f~  101 (148)
                      +.|+.|++.|.
T Consensus         2 r~C~~Cg~~Yh   12 (36)
T PF05191_consen    2 RICPKCGRIYH   12 (36)
T ss_dssp             EEETTTTEEEE
T ss_pred             cCcCCCCCccc
Confidence            35666666654


No 125
>PF04780 DUF629:  Protein of unknown function (DUF629);  InterPro: IPR006865 This domain represents a region of several plant proteins of unknown function. A C2H2 zinc finger is predicted in this region in some family members, but the spacing between the cysteine residues is not conserved throughout the family.
Probab=61.83  E-value=6.2  Score=29.71  Aligned_cols=22  Identities=18%  Similarity=0.625  Sum_probs=11.2

Q ss_pred             eecCccccccccchhHHhhHhh
Q psy12018         91 YVCDICGKVYQHKRTLYRHKKD  112 (148)
Q Consensus        91 ~~C~~c~~~f~~~~~l~~H~~~  112 (148)
                      +.|+.|.+.|.....+..|+..
T Consensus        58 WiCp~CskkF~d~~~~~~H~~~   79 (466)
T PF04780_consen   58 WICPRCSKKFSDAESCLSHMEQ   79 (466)
T ss_pred             eeCCcccceeCCHHHHHHHHHH
Confidence            3455555555555555555443


No 126
>COG4391 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=60.93  E-value=13  Score=19.50  Aligned_cols=45  Identities=22%  Similarity=0.426  Sum_probs=18.8

Q ss_pred             ccccccCCCCcccCCCCCCcccccccccccccCCCCCceecCccccccc
Q psy12018         53 HKKFECGQEPRYQCPQCPYRTKQKELGWESLKPNAYGMYVCDICGKVYQ  101 (148)
Q Consensus        53 h~~~~~~~~~~~~C~~c~~~f~~~~~~~~~~~~~~~~~~~C~~c~~~f~  101 (148)
                      |..+..+ ..++.|+--+-.+.....+... ..  ++.-.|++|+..|.
T Consensus        15 ~~~I~~~-~~~l~C~g~~~p~~HPrV~L~m-g~--~gev~CPYC~t~y~   59 (62)
T COG4391          15 HETIEIG-DLPLMCPGPEPPNDHPRVFLDM-GD--EGEVVCPYCSTRYR   59 (62)
T ss_pred             ceEEEeC-CeeEEcCCCCCCCCCCEEEEEc-CC--CCcEecCccccEEE
Confidence            3334434 4556665443333332222222 11  22345666665553


No 127
>KOG3408|consensus
Probab=60.81  E-value=5.2  Score=24.13  Aligned_cols=27  Identities=22%  Similarity=0.469  Sum_probs=22.9

Q ss_pred             CCCCceecCccccccccchhHHhhHhh
Q psy12018         86 NAYGMYVCDICGKVYQHKRTLYRHKKD  112 (148)
Q Consensus        86 ~~~~~~~C~~c~~~f~~~~~l~~H~~~  112 (148)
                      .|.+.|-|..|.+.|.....|..|.++
T Consensus        53 PG~GqfyCi~CaRyFi~~~~l~~H~kt   79 (129)
T KOG3408|consen   53 PGGGQFYCIECARYFIDAKALKTHFKT   79 (129)
T ss_pred             CCCceeehhhhhhhhcchHHHHHHHhc
Confidence            355668999999999999999999774


No 128
>PF07754 DUF1610:  Domain of unknown function (DUF1610);  InterPro: IPR011668 This domain is found in archaeal species. It is likely to bind zinc via its four well-conserved cysteine residues.
Probab=60.09  E-value=4.7  Score=16.90  Aligned_cols=8  Identities=38%  Similarity=1.402  Sum_probs=4.6

Q ss_pred             cccCCCCC
Q psy12018         63 RYQCPQCP   70 (148)
Q Consensus        63 ~~~C~~c~   70 (148)
                      +|.|+.||
T Consensus        16 ~f~CPnCG   23 (24)
T PF07754_consen   16 PFPCPNCG   23 (24)
T ss_pred             eEeCCCCC
Confidence            45566555


No 129
>PRK03976 rpl37ae 50S ribosomal protein L37Ae; Reviewed
Probab=59.90  E-value=3.2  Score=23.70  Aligned_cols=30  Identities=23%  Similarity=0.672  Sum_probs=16.5

Q ss_pred             cccCCCCCCcccccccccccccCCCCCceecCccccccc
Q psy12018         63 RYQCPQCPYRTKQKELGWESLKPNAYGMYVCDICGKVYQ  101 (148)
Q Consensus        63 ~~~C~~c~~~f~~~~~~~~~~~~~~~~~~~C~~c~~~f~  101 (148)
                      .|.|+.|++.-..         -..-+.|.|..|++.|.
T Consensus        36 ~y~CpfCgk~~vk---------R~a~GIW~C~~C~~~~A   65 (90)
T PRK03976         36 KHVCPVCGRPKVK---------RVGTGIWECRKCGAKFA   65 (90)
T ss_pred             CccCCCCCCCceE---------EEEEEEEEcCCCCCEEe
Confidence            4777777653111         11234567777776664


No 130
>KOG3408|consensus
Probab=57.62  E-value=7.2  Score=23.54  Aligned_cols=30  Identities=23%  Similarity=0.247  Sum_probs=24.1

Q ss_pred             CCCCCCCccccCccccccCChhHHhccccc
Q psy12018         27 FKPKLYGKFACDVCGKEYQYYRNLYRHKKF   56 (148)
Q Consensus        27 ~~~~~~~~~~C~~C~~~f~~~~~l~~h~~~   56 (148)
                      .+-.+-.-|.|-.|.+-|.....|..|.++
T Consensus        50 ~dlPG~GqfyCi~CaRyFi~~~~l~~H~kt   79 (129)
T KOG3408|consen   50 PDLPGGGQFYCIECARYFIDAKALKTHFKT   79 (129)
T ss_pred             CCCCCCceeehhhhhhhhcchHHHHHHHhc
Confidence            344456678999999999999999999754


No 131
>COG4530 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=57.23  E-value=6.8  Score=23.20  Aligned_cols=27  Identities=11%  Similarity=0.009  Sum_probs=14.8

Q ss_pred             ccCccccccCChhHHhcccccccCCCCcccCCCCCCccc
Q psy12018         36 ACDVCGKEYQYYRNLYRHKKFECGQEPRYQCPQCPYRTK   74 (148)
Q Consensus        36 ~C~~C~~~f~~~~~l~~h~~~~~~~~~~~~C~~c~~~f~   74 (148)
                      +|+.|++.|....            ..|..|+.||+.|.
T Consensus        11 idPetg~KFYDLN------------rdPiVsPytG~s~P   37 (129)
T COG4530          11 IDPETGKKFYDLN------------RDPIVSPYTGKSYP   37 (129)
T ss_pred             cCccccchhhccC------------CCccccCcccccch
Confidence            5666666654321            34566666666653


No 132
>PF13451 zf-trcl:  Probable zinc-binding domain
Probab=57.12  E-value=2.8  Score=21.01  Aligned_cols=13  Identities=15%  Similarity=0.340  Sum_probs=6.2

Q ss_pred             cccCCCCCCcccc
Q psy12018         63 RYQCPQCPYRTKQ   75 (148)
Q Consensus        63 ~~~C~~c~~~f~~   75 (148)
                      .+.|..||..|..
T Consensus         4 ~l~C~dCg~~Fvf   16 (49)
T PF13451_consen    4 TLTCKDCGAEFVF   16 (49)
T ss_pred             eEEcccCCCeEEE
Confidence            3445555554443


No 133
>KOG2807|consensus
Probab=55.36  E-value=22  Score=25.52  Aligned_cols=24  Identities=17%  Similarity=0.407  Sum_probs=16.1

Q ss_pred             ceeCCCChhhhhchHHHHHHHHhh
Q psy12018        119 RFQCPQCPYRAKQKANLKTHLIIK  142 (148)
Q Consensus       119 ~~~C~~C~~~f~~~~~l~~H~~~~  142 (148)
                      .|.|..|...|-.-.+.-.|...|
T Consensus       345 ~y~C~~Ck~~FCldCDv~iHesLh  368 (378)
T KOG2807|consen  345 RYRCESCKNVFCLDCDVFIHESLH  368 (378)
T ss_pred             cEEchhccceeeccchHHHHhhhh
Confidence            478888888887665555565543


No 134
>PF02176 zf-TRAF:  TRAF-type zinc finger; PDB: 2EOD_A 2YUC_A 3HCU_A 3HCS_B 3HCT_A.
Probab=54.73  E-value=8.9  Score=19.56  Aligned_cols=40  Identities=25%  Similarity=0.534  Sum_probs=20.0

Q ss_pred             ceecCc-cccccccchhHHhhHhhhhCCCCceeCCC----Chhhhh
Q psy12018         90 MYVCDI-CGKVYQHKRTLYRHKKDECGQEPRFQCPQ----CPYRAK  130 (148)
Q Consensus        90 ~~~C~~-c~~~f~~~~~l~~H~~~~~~~~~~~~C~~----C~~~f~  130 (148)
                      +..|+. |+..-.....|..|+...-. .++..|..    |+..+.
T Consensus         9 ~v~C~~~cc~~~i~r~~l~~H~~~~C~-~~~v~C~~~~~GC~~~~~   53 (60)
T PF02176_consen    9 PVPCPNGCCNEMIPRKELDDHLENECP-KRPVPCPYSPYGCKERVP   53 (60)
T ss_dssp             EEE-TT--S-BEEECCCHHHHHHTTST-TSEEE-SS----S--EEE
T ss_pred             EeeCCCCCcccceeHHHHHHHHHccCC-CCcEECCCCCCCCCCccc
Confidence            356766 33332345667778774444 45677877    766554


No 135
>PF08274 PhnA_Zn_Ribbon:  PhnA Zinc-Ribbon ;  InterPro: IPR013987 The PhnA protein family includes the uncharacterised Escherichia coli protein PhnA and its homologues. The E. coli phnA gene is part of a large operon associated with alkylphosphonate uptake and carbon-phosphorus bond cleavage []. The protein is not related to the characterised phosphonoacetate hydrolase designated PhnA []. This entry represents the N-terminal domain of PhnA, which is predicted to form a zinc-ribbon.; PDB: 2AKL_A.
Probab=54.29  E-value=5.6  Score=17.66  Aligned_cols=9  Identities=56%  Similarity=1.545  Sum_probs=1.5

Q ss_pred             ccCcccccc
Q psy12018         36 ACDVCGKEY   44 (148)
Q Consensus        36 ~C~~C~~~f   44 (148)
                      .|+.|+..+
T Consensus         4 ~Cp~C~se~   12 (30)
T PF08274_consen    4 KCPLCGSEY   12 (30)
T ss_dssp             --TTT----
T ss_pred             CCCCCCCcc
Confidence            344554443


No 136
>PF12013 DUF3505:  Protein of unknown function (DUF3505);  InterPro: IPR022698  This family of proteins is functionally uncharacterised. This protein is found in eukaryotes. Proteins in this family are typically between 247 to 1018 amino acids in length. This region contains two segments that are likely to be C2H2 zinc binding domains. 
Probab=52.83  E-value=13  Score=21.89  Aligned_cols=25  Identities=36%  Similarity=0.795  Sum_probs=22.3

Q ss_pred             eec----CccccccccchhHHhhHhhhhC
Q psy12018         91 YVC----DICGKVYQHKRTLYRHKKDECG  115 (148)
Q Consensus        91 ~~C----~~c~~~f~~~~~l~~H~~~~~~  115 (148)
                      |.|    ..|+..+.+...+..|.+..+|
T Consensus        81 ~~C~~~~~~C~y~~~~~~~m~~H~~~~Hg  109 (109)
T PF12013_consen   81 YRCQCDPPHCGYITRSKKTMRKHWRKEHG  109 (109)
T ss_pred             eeeecCCCCCCcEeccHHHHHHHHHHhcC
Confidence            889    9999999999999999987764


No 137
>PF01927 Mut7-C:  Mut7-C RNAse domain;  InterPro: IPR002782 This prokaryotic family of proteins have no known function. The proteins contain four conserved cysteines that may be involved in metal binding or disulphide bridges.
Probab=52.45  E-value=20  Score=22.45  Aligned_cols=14  Identities=36%  Similarity=0.880  Sum_probs=6.6

Q ss_pred             eecCccccccccch
Q psy12018         91 YVCDICGKVYQHKR  104 (148)
Q Consensus        91 ~~C~~c~~~f~~~~  104 (148)
                      +.|+.|++.|-..+
T Consensus       125 ~~C~~C~kiyW~Gs  138 (147)
T PF01927_consen  125 WRCPGCGKIYWEGS  138 (147)
T ss_pred             EECCCCCCEecccc
Confidence            44555555544333


No 138
>COG4888 Uncharacterized Zn ribbon-containing protein [General function prediction only]
Probab=51.65  E-value=7.9  Score=22.54  Aligned_cols=43  Identities=19%  Similarity=0.298  Sum_probs=23.6

Q ss_pred             CCCCCccccCccccccCChhHHhcccccccCCCCcccCCCCCCccccc
Q psy12018         29 PKLYGKFACDVCGKEYQYYRNLYRHKKFECGQEPRYQCPQCPYRTKQK   76 (148)
Q Consensus        29 ~~~~~~~~C~~C~~~f~~~~~l~~h~~~~~~~~~~~~C~~c~~~f~~~   76 (148)
                      ...++.|.|+.|+..-.....+..-.    . .....|..||..|...
T Consensus        17 ~~L~k~FtCp~Cghe~vs~ctvkk~~----~-~g~~~Cg~CGls~e~e   59 (104)
T COG4888          17 QVLPKTFTCPRCGHEKVSSCTVKKTV----N-IGTAVCGNCGLSFECE   59 (104)
T ss_pred             ccCCceEecCccCCeeeeEEEEEecC----c-eeEEEcccCcceEEEe
Confidence            34677788888887543332222111    1 2345677777766543


No 139
>PF07800 DUF1644:  Protein of unknown function (DUF1644);  InterPro: IPR012866 This family consists of sequences found in a number of hypothetical plant proteins of unknown function. The region of interest contains nine highly conserved cysteine residues and is approximately 160 amino acids in length, which probably represent a zinc-binding domain. 
Probab=51.55  E-value=62  Score=20.72  Aligned_cols=56  Identities=14%  Similarity=0.212  Sum_probs=34.1

Q ss_pred             CceecCccccccccchhHHhhHhhhhCCCCceeCCCChhhhh-chHHHHHHHHhhcCCc
Q psy12018         89 GMYVCDICGKVYQHKRTLYRHKKDECGQEPRFQCPQCPYRAK-QKANLKTHLIIKHDSV  146 (148)
Q Consensus        89 ~~~~C~~c~~~f~~~~~l~~H~~~~~~~~~~~~C~~C~~~f~-~~~~l~~H~~~~h~~~  146 (148)
                      ....|+.|.-........ ...+.+.. .|+-.|..=+-.|. +...|++|.+..|+..
T Consensus        79 ~~L~CPLCRG~V~GWtvv-e~AR~~LN-~K~RsC~~e~C~F~GtY~eLrKHar~~HP~~  135 (162)
T PF07800_consen   79 PELACPLCRGEVKGWTVV-EPARRFLN-AKKRSCSQESCSFSGTYSELRKHARSEHPSA  135 (162)
T ss_pred             ccccCccccCceeceEEc-hHHHHHhc-cCCccCcccccccccCHHHHHHHHHhhCCCC
Confidence            346799987443322222 22444444 56667766444554 5678999999988754


No 140
>smart00154 ZnF_AN1 AN1-like Zinc finger. Zinc finger at the C-terminus of An1, a ubiquitin-like protein in Xenopus laevis.
Probab=50.87  E-value=7.6  Score=18.31  Aligned_cols=15  Identities=27%  Similarity=0.609  Sum_probs=12.5

Q ss_pred             ccccCccccccCChh
Q psy12018         34 KFACDVCGKEYQYYR   48 (148)
Q Consensus        34 ~~~C~~C~~~f~~~~   48 (148)
                      |+.|..|++.|...-
T Consensus        12 ~f~C~~C~~~FC~~H   26 (39)
T smart00154       12 GFKCRHCGNLFCGEH   26 (39)
T ss_pred             CeECCccCCcccccc
Confidence            789999999998753


No 141
>PRK03824 hypA hydrogenase nickel incorporation protein; Provisional
Probab=50.74  E-value=8.2  Score=23.84  Aligned_cols=10  Identities=20%  Similarity=0.607  Sum_probs=4.7

Q ss_pred             ccCCCCCCcc
Q psy12018         64 YQCPQCPYRT   73 (148)
Q Consensus        64 ~~C~~c~~~f   73 (148)
                      +.|..||..|
T Consensus        71 ~~C~~CG~~~   80 (135)
T PRK03824         71 LKCRNCGNEW   80 (135)
T ss_pred             EECCCCCCEE
Confidence            4455555443


No 142
>PF08271 TF_Zn_Ribbon:  TFIIB zinc-binding;  InterPro: IPR013137 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents a zinc finger motif found in transcription factor IIB (TFIIB). In eukaryotes the initiation of transcription of protein encoding genes by the polymerase II complexe (Pol II) is modulated by general and specific transcription factors. The general transcription factors operate through common promoters elements (such as the TATA box). At least seven different proteins associate to form the general transcription factors: TFIIA, -IIB, -IID, -IIE, -IIF, -IIG, and -IIH [].  TFIIB and TFIID are responsible for promoter recognition and interaction with pol II; together with Pol II, they form a minimal initiation complex capable of transcription under certain conditions. The TATA box of a Pol II promoter is bound in the initiation complex by the TBP subunit of TFIID, which bends the DNA around the C-terminal domain of TFIIB whereas the N-terminal zinc finger of TFIIB interacts with Pol II [, ]. The TFIIB zinc finger adopts a zinc ribbon fold characterised by two beta-hairpins forming two structurally similar zinc-binding sub-sites []. The zinc finger contacts the rbp1 subunit of Pol II through its dock domain, a conserved region of about 70 amino acids located close to the polymerase active site []. In the Pol II complex this surface is located near the RNA exit groove. Interestingly this sequence is best conserved in the three polymerases that utilise a TFIIB-like general transcription factor (Pol II, Pol III, and archaeal RNA polymerase) but not in Pol I [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0006355 regulation of transcription, DNA-dependent; PDB: 1VD4_A 1PFT_A 3K1F_M 3K7A_M 1RO4_A 1RLY_A 1DL6_A.
Probab=50.24  E-value=17  Score=17.36  Aligned_cols=7  Identities=57%  Similarity=1.402  Sum_probs=2.6

Q ss_pred             eecCccc
Q psy12018         91 YVCDICG   97 (148)
Q Consensus        91 ~~C~~c~   97 (148)
                      +.|..||
T Consensus        20 ~vC~~CG   26 (43)
T PF08271_consen   20 LVCPNCG   26 (43)
T ss_dssp             EEETTT-
T ss_pred             EECCCCC
Confidence            3444444


No 143
>KOG4118|consensus
Probab=48.97  E-value=10  Score=20.17  Aligned_cols=30  Identities=23%  Similarity=0.410  Sum_probs=20.9

Q ss_pred             ceeCCCChhhhhchHHHHHHHHhhcCCccC
Q psy12018        119 RFQCPQCPYRAKQKANLKTHLIIKHDSVLL  148 (148)
Q Consensus       119 ~~~C~~C~~~f~~~~~l~~H~~~~h~~~~~  148 (148)
                      .|.|.+|...-...-.+..|....|+..+|
T Consensus        38 ~~kCtVC~~~mpdpktfkqhfe~kHpk~~~   67 (74)
T KOG4118|consen   38 HHKCTVCMVQMPDPKTFKQHFENKHPKEPL   67 (74)
T ss_pred             HhhhHhhHhhCCCCchHHHHHhhcCCCCCC
Confidence            367777777666777777777777776554


No 144
>PF08790 zf-LYAR:  LYAR-type C2HC zinc finger ;  InterPro: IPR014898 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This C2HC zinc finger domain is found in LYAR proteins such as Q08288 from SWISSPROT, which are involved in cell growth regulation.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 1WJV_A.
Probab=48.64  E-value=7.9  Score=16.89  Aligned_cols=8  Identities=38%  Similarity=0.883  Sum_probs=3.5

Q ss_pred             cCcccccc
Q psy12018         93 CDICGKVY  100 (148)
Q Consensus        93 C~~c~~~f  100 (148)
                      |..|++.|
T Consensus         3 CiDC~~~F   10 (28)
T PF08790_consen    3 CIDCSKDF   10 (28)
T ss_dssp             ETTTTEEE
T ss_pred             eecCCCCc
Confidence            44444444


No 145
>PF10013 DUF2256:  Uncharacterized protein conserved in bacteria (DUF2256);  InterPro: IPR017136 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function.
Probab=48.25  E-value=11  Score=18.21  Aligned_cols=16  Identities=19%  Similarity=0.893  Sum_probs=12.0

Q ss_pred             ecCccccccccchhHH
Q psy12018         92 VCDICGKVYQHKRTLY  107 (148)
Q Consensus        92 ~C~~c~~~f~~~~~l~  107 (148)
                      .|..|++.|.+...+.
T Consensus        10 ~C~~C~rpf~WRKKW~   25 (42)
T PF10013_consen   10 ICPVCGRPFTWRKKWA   25 (42)
T ss_pred             cCcccCCcchHHHHHH
Confidence            5888998888766554


No 146
>PF07282 OrfB_Zn_ribbon:  Putative transposase DNA-binding domain;  InterPro: IPR010095 This entry represents a region of a sequence similarity between a family of putative transposases of Thermoanaerobacter tengcongensis, smaller related proteins from Bacillus anthracis, putative transposes described by IPR001959 from INTERPRO, and other proteins. More information about these proteins can be found at Protein of the Month: Transposase [].
Probab=48.22  E-value=18  Score=19.17  Aligned_cols=9  Identities=33%  Similarity=0.962  Sum_probs=4.0

Q ss_pred             eecCccccc
Q psy12018         91 YVCDICGKV   99 (148)
Q Consensus        91 ~~C~~c~~~   99 (148)
                      |.|+.||..
T Consensus        47 ~~C~~Cg~~   55 (69)
T PF07282_consen   47 FTCPNCGFE   55 (69)
T ss_pred             EEcCCCCCE
Confidence            444444433


No 147
>smart00440 ZnF_C2C2 C2C2 Zinc finger. Nucleic-acid-binding motif in transcriptional elongation factor TFIIS and RNA polymerases.
Probab=47.76  E-value=22  Score=16.81  Aligned_cols=9  Identities=56%  Similarity=1.379  Sum_probs=4.3

Q ss_pred             eecCccccc
Q psy12018         91 YVCDICGKV   99 (148)
Q Consensus        91 ~~C~~c~~~   99 (148)
                      |.|..|+..
T Consensus        29 y~C~~C~~~   37 (40)
T smart00440       29 YVCTKCGHR   37 (40)
T ss_pred             EEeCCCCCE
Confidence            455555533


No 148
>PF01096 TFIIS_C:  Transcription factor S-II (TFIIS);  InterPro: IPR001222 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents a zinc finger motif found in transcription factor IIs (TFIIS). In eukaryotes the initiation of transcription of protein encoding genes by polymerase II (Pol II) is modulated by general and specific transcription factors. The general transcription factors operate through common promoters elements (such as the TATA box). At least eight different proteins associate to form the general transcription factors: TFIIA, -IIB, -IID, -IIE, -IIF, -IIG, -IIH and -IIS []. During mRNA elongation, Pol II can encounter DNA sequences that cause reverse movement of the enzyme. Such backtracking involves extrusion of the RNA 3'-end into the pore, and can lead to transcriptional arrest. Escape from arrest requires cleavage of the extruded RNA with the help of TFIIS, which induces mRNA cleavage by enhancing the intrinsic nuclease activity of RNA polymerase (Pol) II, past template-encoded pause sites []. TFIIS extends from the polymerase surface via a pore to the internal active site. Two essential and invariant acidic residues in a TFIIS loop complement the Pol II active site and could position a metal ion and a water molecule for hydrolytic RNA cleavage. TFIIS also induces extensive structural changes in Pol II that would realign nucleic acids in the active centre.  TFIIS is a protein of about 300 amino acids. It contains three regions: a variable N-terminal domain not required for TFIIS activity; a conserved central domain required for Pol II binding; and a conserved C-terminal C4-type zinc finger essential for RNA cleavage. The zinc finger folds in a conformation termed a zinc ribbon [] characterised by a three-stranded antiparallel beta-sheet and two beta-hairpins. A backbone model for Pol II-TFIIS complex was obtained from X-ray analysis. It shows that a beta hairpin protrudes from the zinc finger and complements the pol II active site [].  Some viral proteins also contain the TFIIS zinc ribbon C-terminal domain. The Vaccinia virus protein, unlike its eukaryotic homologue, is an integral RNA polymerase subunit rather than a readily separable transcription factor []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003676 nucleic acid binding, 0008270 zinc ion binding, 0006351 transcription, DNA-dependent; PDB: 3M4O_I 3S14_I 2E2J_I 4A3J_I 3HOZ_I 1TWA_I 3S1Q_I 3S1N_I 1TWG_I 3I4M_I ....
Probab=46.31  E-value=15  Score=17.26  Aligned_cols=9  Identities=56%  Similarity=1.235  Sum_probs=4.8

Q ss_pred             eecCccccc
Q psy12018         91 YVCDICGKV   99 (148)
Q Consensus        91 ~~C~~c~~~   99 (148)
                      |.|..|+..
T Consensus        29 y~C~~C~~~   37 (39)
T PF01096_consen   29 YVCCNCGHR   37 (39)
T ss_dssp             EEESSSTEE
T ss_pred             EEeCCCCCe
Confidence            555555543


No 149
>cd00924 Cyt_c_Oxidase_Vb Cytochrome c oxidase subunit Vb.  Cytochrome c oxidase (CcO), the terminal oxidase in the respiratory chains of eukaryotes and most bacteria, is a multi-chain transmembrane protein located in the inner membrane of mitochondria and the cell membrane of prokaryotes.  It catalyzes the reduction of O2 and simultaneously pumps protons across the membrane.  The number of subunits varies from three to five in bacteria and up to 13 in mammalian mitochondria. Subunits I, II, and III of mammalian CcO are encoded within the mitochondrial genome and the remaining 10 subunits are encoded within the nuclear genome.  Found only in eukaryotes, subunit Vb is one of three mammalian subunits that lacks a transmembrane region.  Subunit Vb is located on the matrix side of the membrane and binds the regulatory subunit of protein kinase A.  The abnormally extended conformation is stable only in the CcO assembly.
Probab=45.29  E-value=11  Score=21.92  Aligned_cols=15  Identities=20%  Similarity=0.505  Sum_probs=11.0

Q ss_pred             CCccccCccccccCC
Q psy12018         32 YGKFACDVCGKEYQY   46 (148)
Q Consensus        32 ~~~~~C~~C~~~f~~   46 (148)
                      .++++|..||..|.-
T Consensus        77 g~~~rC~eCG~~fkL   91 (97)
T cd00924          77 GKPKRCPECGHVFKL   91 (97)
T ss_pred             CCceeCCCCCcEEEE
Confidence            367888888887743


No 150
>PF09845 DUF2072:  Zn-ribbon containing protein (DUF2072);  InterPro: IPR018645  This archaeal Zinc-ribbon containing proteins have no known function. 
Probab=45.12  E-value=10  Score=23.27  Aligned_cols=15  Identities=20%  Similarity=0.614  Sum_probs=12.3

Q ss_pred             ccccCccccccCChh
Q psy12018         34 KFACDVCGKEYQYYR   48 (148)
Q Consensus        34 ~~~C~~C~~~f~~~~   48 (148)
                      |++|..||+.|..-+
T Consensus         1 PH~Ct~Cg~~f~dgs   15 (131)
T PF09845_consen    1 PHQCTKCGRVFEDGS   15 (131)
T ss_pred             CcccCcCCCCcCCCc
Confidence            678999999998654


No 151
>PRK12380 hydrogenase nickel incorporation protein HybF; Provisional
Probab=45.03  E-value=13  Score=22.18  Aligned_cols=10  Identities=20%  Similarity=0.358  Sum_probs=4.7

Q ss_pred             ccCCCCCCcc
Q psy12018         64 YQCPQCPYRT   73 (148)
Q Consensus        64 ~~C~~c~~~f   73 (148)
                      ..|..|+..|
T Consensus        71 ~~C~~Cg~~~   80 (113)
T PRK12380         71 AWCWDCSQVV   80 (113)
T ss_pred             EEcccCCCEE
Confidence            4455555433


No 152
>PF13453 zf-TFIIB:  Transcription factor zinc-finger
Probab=44.93  E-value=24  Score=16.61  Aligned_cols=15  Identities=27%  Similarity=0.452  Sum_probs=6.2

Q ss_pred             eCCCChhhhhchHHH
Q psy12018        121 QCPQCPYRAKQKANL  135 (148)
Q Consensus       121 ~C~~C~~~f~~~~~l  135 (148)
                      .|..|+-.+-....|
T Consensus        21 ~C~~C~G~W~d~~el   35 (41)
T PF13453_consen   21 VCPSCGGIWFDAGEL   35 (41)
T ss_pred             ECCCCCeEEccHHHH
Confidence            344444444433333


No 153
>COG3364 Zn-ribbon containing protein [General function prediction only]
Probab=44.64  E-value=11  Score=22.10  Aligned_cols=16  Identities=19%  Similarity=0.449  Sum_probs=12.7

Q ss_pred             CccccCccccccCChh
Q psy12018         33 GKFACDVCGKEYQYYR   48 (148)
Q Consensus        33 ~~~~C~~C~~~f~~~~   48 (148)
                      +|++|..||..|..-+
T Consensus         1 MpH~CtrCG~vf~~g~   16 (112)
T COG3364           1 MPHQCTRCGEVFDDGS   16 (112)
T ss_pred             CCceeccccccccccc
Confidence            4788999999988743


No 154
>PRK03564 formate dehydrogenase accessory protein FdhE; Provisional
Probab=44.62  E-value=14  Score=26.33  Aligned_cols=36  Identities=19%  Similarity=0.295  Sum_probs=18.9

Q ss_pred             CCccccCccccccCChhHHhcccccccCCCCcccCCCCCC
Q psy12018         32 YGKFACDVCGKEYQYYRNLYRHKKFECGQEPRYQCPQCPY   71 (148)
Q Consensus        32 ~~~~~C~~C~~~f~~~~~l~~h~~~~~~~~~~~~C~~c~~   71 (148)
                      +..-.|++||..= ..+ + .+.....| .+-..|+.|+-
T Consensus       185 ~~~~~CPvCGs~P-~~s-~-v~~~~~~G-~RyL~CslC~t  220 (309)
T PRK03564        185 EQRQFCPVCGSMP-VSS-V-VQIGTTQG-LRYLHCNLCES  220 (309)
T ss_pred             cCCCCCCCCCCcc-hhh-e-eeccCCCC-ceEEEcCCCCC
Confidence            3456799999751 111 1 12222223 45667777764


No 155
>TIGR00100 hypA hydrogenase nickel insertion protein HypA. In Hpylori, hypA mutant abolished hydrogenase activity and decrease in urease activity. Nickel supplementation in media restored urease activity and partial hydrogenase activity. HypA probably involved in inserting Ni in enzymes.
Probab=44.34  E-value=11  Score=22.58  Aligned_cols=11  Identities=18%  Similarity=0.691  Sum_probs=5.4

Q ss_pred             ccCCCCCCccc
Q psy12018         64 YQCPQCPYRTK   74 (148)
Q Consensus        64 ~~C~~c~~~f~   74 (148)
                      ..|+.|+..|.
T Consensus        71 ~~C~~Cg~~~~   81 (115)
T TIGR00100        71 CECEDCSEEVS   81 (115)
T ss_pred             EEcccCCCEEe
Confidence            44555554443


No 156
>smart00661 RPOL9 RNA polymerase subunit 9.
Probab=44.26  E-value=24  Score=17.34  Aligned_cols=9  Identities=44%  Similarity=1.172  Sum_probs=4.3

Q ss_pred             eecCccccc
Q psy12018         91 YVCDICGKV   99 (148)
Q Consensus        91 ~~C~~c~~~   99 (148)
                      +.|+.|+..
T Consensus        21 ~vC~~Cg~~   29 (52)
T smart00661       21 FVCRKCGYE   29 (52)
T ss_pred             EECCcCCCe
Confidence            445555533


No 157
>PF14369 zf-RING_3:  zinc-finger
Probab=43.98  E-value=24  Score=16.15  Aligned_cols=11  Identities=27%  Similarity=0.715  Sum_probs=7.6

Q ss_pred             cCCCCCCcccc
Q psy12018         65 QCPQCPYRTKQ   75 (148)
Q Consensus        65 ~C~~c~~~f~~   75 (148)
                      .|+.|+..|..
T Consensus        23 ~CP~C~~gFvE   33 (35)
T PF14369_consen   23 ACPRCHGGFVE   33 (35)
T ss_pred             CCcCCCCcEeE
Confidence            58888777753


No 158
>PF04216 FdhE:  Protein involved in formate dehydrogenase formation;  InterPro: IPR006452 This family of sequences describe an accessory protein required for the assembly of formate dehydrogenase of certain proteobacteria although not present in the final complex []. The exact nature of the function of FdhE in the assembly of the complex is unknown, but considering the presence of selenocysteine, molybdopterin, iron-sulphur clusters and cytochrome b556, it is likely to be involved in the insertion of cofactors. ; GO: 0005737 cytoplasm; PDB: 2FIY_B.
Probab=43.77  E-value=9.6  Score=26.78  Aligned_cols=77  Identities=21%  Similarity=0.340  Sum_probs=27.0

Q ss_pred             ccccCccccccCChhHHhcccccccCCCCcccCCCCCCcccccccccccccCCCCCceecCccccccccc-hhHHhhHhh
Q psy12018         34 KFACDVCGKEYQYYRNLYRHKKFECGQEPRYQCPQCPYRTKQKELGWESLKPNAYGMYVCDICGKVYQHK-RTLYRHKKD  112 (148)
Q Consensus        34 ~~~C~~C~~~f~~~~~l~~h~~~~~~~~~~~~C~~c~~~f~~~~~~~~~~~~~~~~~~~C~~c~~~f~~~-~~l~~H~~~  112 (148)
                      .-.|++||.. ...+.|..-..  .| .+-..|+.|+-.....             +..|+.||..-... ..+..  ..
T Consensus       172 ~g~CPvCGs~-P~~s~l~~~~~--~G-~R~L~Cs~C~t~W~~~-------------R~~Cp~Cg~~~~~~l~~~~~--e~  232 (290)
T PF04216_consen  172 RGYCPVCGSP-PVLSVLRGGER--EG-KRYLHCSLCGTEWRFV-------------RIKCPYCGNTDHEKLEYFTV--EG  232 (290)
T ss_dssp             -SS-TTT----EEEEEEE---------EEEEEETTT--EEE---------------TTS-TTT---SS-EEE--------
T ss_pred             CCcCCCCCCc-CceEEEecCCC--Cc-cEEEEcCCCCCeeeec-------------CCCCcCCCCCCCcceeeEec--CC
Confidence            3578888874 11111111110  13 4567788887543321             24699998553222 11111  11


Q ss_pred             hhCCCCceeCCCChhhhh
Q psy12018        113 ECGQEPRFQCPQCPYRAK  130 (148)
Q Consensus       113 ~~~~~~~~~C~~C~~~f~  130 (148)
                      ..+ .+...|..|+.-++
T Consensus       233 ~~~-~rve~C~~C~~YlK  249 (290)
T PF04216_consen  233 EPA-YRVEVCESCGSYLK  249 (290)
T ss_dssp             --S-EEEEEETTTTEEEE
T ss_pred             CCc-EEEEECCcccchHH
Confidence            112 45578998975443


No 159
>COG1571 Predicted DNA-binding protein containing a Zn-ribbon domain [General function prediction only]
Probab=43.57  E-value=17  Score=27.04  Aligned_cols=12  Identities=25%  Similarity=0.695  Sum_probs=6.0

Q ss_pred             ceecCccccccc
Q psy12018         90 MYVCDICGKVYQ  101 (148)
Q Consensus        90 ~~~C~~c~~~f~  101 (148)
                      -|+|+.|+..+.
T Consensus       367 g~rC~kCg~~~~  378 (421)
T COG1571         367 GFRCKKCGTRAR  378 (421)
T ss_pred             CcccccccccCC
Confidence            355555554443


No 160
>PF13824 zf-Mss51:  Zinc-finger of mitochondrial splicing suppressor 51
Probab=43.10  E-value=25  Score=18.13  Aligned_cols=9  Identities=33%  Similarity=1.342  Sum_probs=4.6

Q ss_pred             cccCCCCCC
Q psy12018         63 RYQCPQCPY   71 (148)
Q Consensus        63 ~~~C~~c~~   71 (148)
                      .|.|+.||-
T Consensus        14 ~~~Cp~cGi   22 (55)
T PF13824_consen   14 NFECPDCGI   22 (55)
T ss_pred             CCcCCCCCC
Confidence            455555554


No 161
>PF08209 Sgf11:  Sgf11 (transcriptional regulation protein);  InterPro: IPR013246 The Sgf11 family is a SAGA complex subunit in Saccharomyces cerevisiae (Baker's yeast). The SAGA complex is a multisubunit protein complex involved in transcriptional regulation. SAGA combines proteins involved in interactions with DNA-bound activators and TATA-binding protein (TBP), as well as enzymes for histone acetylation and deubiquitylation [].; PDB: 3M99_B 2LO2_A 3MHH_C 3MHS_C.
Probab=43.05  E-value=36  Score=15.46  Aligned_cols=23  Identities=17%  Similarity=0.327  Sum_probs=14.0

Q ss_pred             eecCccccccccchhHHhhHhhhh
Q psy12018         91 YVCDICGKVYQHKRTLYRHKKDEC  114 (148)
Q Consensus        91 ~~C~~c~~~f~~~~~l~~H~~~~~  114 (148)
                      +.|+.|++.+. .+.+..|+..-.
T Consensus         5 ~~C~nC~R~v~-a~RfA~HLekCm   27 (33)
T PF08209_consen    5 VECPNCGRPVA-ASRFAPHLEKCM   27 (33)
T ss_dssp             EE-TTTSSEEE-GGGHHHHHHHHT
T ss_pred             EECCCCcCCcc-hhhhHHHHHHHH
Confidence            67888887754 455666765443


No 162
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only]
Probab=42.94  E-value=12  Score=27.10  Aligned_cols=76  Identities=20%  Similarity=0.185  Sum_probs=43.2

Q ss_pred             cccCccccccCChhHHhcccccccCCCCcccCCCCCCc----ccccccccccccCCCCCceecCc--cc----cccccch
Q psy12018         35 FACDVCGKEYQYYRNLYRHKKFECGQEPRYQCPQCPYR----TKQKELGWESLKPNAYGMYVCDI--CG----KVYQHKR  104 (148)
Q Consensus        35 ~~C~~C~~~f~~~~~l~~h~~~~~~~~~~~~C~~c~~~----f~~~~~~~~~~~~~~~~~~~C~~--c~----~~f~~~~  104 (148)
                      ..|..|..-|.....|..|.+..+  |+-+.|.+-+..    |++...+..|   .....|.|-.  |.    ..|....
T Consensus       221 P~C~FC~~~FYdDDEL~~HcR~~H--E~ChICD~v~p~~~QYFK~Y~~Le~H---F~~~hy~ct~qtc~~~k~~vf~~~~  295 (493)
T COG5236         221 PLCIFCKIYFYDDDELRRHCRLRH--EACHICDMVGPIRYQYFKSYEDLEAH---FRNAHYCCTFQTCRVGKCYVFPYHT  295 (493)
T ss_pred             chhhhccceecChHHHHHHHHhhh--hhhhhhhccCccchhhhhCHHHHHHH---hhcCceEEEEEEEecCcEEEeccHH
Confidence            468888888888888888887644  344555443311    2221122222   2223355533  43    3577777


Q ss_pred             hHHhhHhhhhC
Q psy12018        105 TLYRHKKDECG  115 (148)
Q Consensus       105 ~l~~H~~~~~~  115 (148)
                      .|..|+...++
T Consensus       296 el~~h~~~~h~  306 (493)
T COG5236         296 ELLEHLTRFHK  306 (493)
T ss_pred             HHHHHHHHHhh
Confidence            78888776655


No 163
>PF12760 Zn_Tnp_IS1595:  Transposase zinc-ribbon domain;  InterPro: IPR024442 This zinc binding domain is found in a range of transposase proteins such as ISSPO8, ISSOD11, ISRSSP2 etc. It may be a zinc-binding beta ribbon domain that could bind DNA.
Probab=42.85  E-value=25  Score=17.02  Aligned_cols=10  Identities=40%  Similarity=1.019  Sum_probs=5.4

Q ss_pred             CCceecCccc
Q psy12018         88 YGMYVCDICG   97 (148)
Q Consensus        88 ~~~~~C~~c~   97 (148)
                      ...|.|..|+
T Consensus        35 ~~~~~C~~C~   44 (46)
T PF12760_consen   35 RGRYRCKACR   44 (46)
T ss_pred             CCeEECCCCC
Confidence            3446666654


No 164
>PRK12496 hypothetical protein; Provisional
Probab=42.54  E-value=18  Score=23.24  Aligned_cols=29  Identities=31%  Similarity=0.489  Sum_probs=18.8

Q ss_pred             CceecCccccccccchhHHhhHhhhhCCCCceeCCCChhhhh
Q psy12018         89 GMYVCDICGKVYQHKRTLYRHKKDECGQEPRFQCPQCPYRAK  130 (148)
Q Consensus        89 ~~~~C~~c~~~f~~~~~l~~H~~~~~~~~~~~~C~~C~~~f~  130 (148)
                      +.|.|..|++.|....             ..-.|+.||....
T Consensus       126 w~~~C~gC~~~~~~~~-------------~~~~C~~CG~~~~  154 (164)
T PRK12496        126 WRKVCKGCKKKYPEDY-------------PDDVCEICGSPVK  154 (164)
T ss_pred             eeEECCCCCccccCCC-------------CCCcCCCCCChhh
Confidence            4588999998885311             1135999986543


No 165
>COG3677 Transposase and inactivated derivatives [DNA replication, recombination, and repair]
Probab=42.52  E-value=21  Score=21.90  Aligned_cols=14  Identities=29%  Similarity=0.831  Sum_probs=8.3

Q ss_pred             CceecCcccccccc
Q psy12018         89 GMYVCDICGKVYQH  102 (148)
Q Consensus        89 ~~~~C~~c~~~f~~  102 (148)
                      ..|+|..|++.|..
T Consensus        52 qRyrC~~C~~tf~~   65 (129)
T COG3677          52 QRYKCKSCGSTFTV   65 (129)
T ss_pred             cccccCCcCcceee
Confidence            34666666666643


No 166
>PF01428 zf-AN1:  AN1-like Zinc finger;  InterPro: IPR000058 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents the AN1-type zinc finger domain, which has a dimetal (zinc)-bound alpha/beta fold. This domain was first identified as a zinc finger at the C terminus of AN1 Q91889 from SWISSPROT, a ubiquitin-like protein in Xenopus laevis []. The AN1-type zinc finger contains six conserved cysteines and two histidines that could potentially coordinate 2 zinc atoms. Certain stress-associated proteins (SAP) contain AN1 domain, often in combination with A20 zinc finger domains (SAP8) or C2H2 domains (SAP16) []. For example, the human protein Znf216 has an A20 zinc-finger at the N terminus and an AN1 zinc-finger at the C terminus, acting to negatively regulate the NFkappaB activation pathway and to interact with components of the immune response like RIP, IKKgamma and TRAF6. The interact of Znf216 with IKK-gamma and RIP is mediated by the A20 zinc-finger domain, while its interaction with TRAF6 is mediated by the AN1 zinc-finger domain; therefore, both zinc-finger domains are involved in regulating the immune response []. The AN1 zinc finger domain is also found in proteins containing a ubiquitin-like domain, which are involved in the ubiquitination pathway []. Proteins containing an AN1-type zinc finger include:   Ascidian posterior end mark 6 (pem-6) protein []. Human AWP1 protein (associated with PRK1), which is expressed during early embryogenesis []. Human immunoglobulin mu binding protein 2 (SMUBP-2), mutations in which cause muscular atrophy with respiratory distress type 1 [].   More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 1WFP_A 1WYS_A 1WG2_A 1WFH_A 1X4W_A 1WFE_A 1WFL_A 1X4V_A.
Probab=42.44  E-value=8.5  Score=18.46  Aligned_cols=16  Identities=31%  Similarity=0.715  Sum_probs=10.6

Q ss_pred             CccccCccccccCChh
Q psy12018         33 GKFACDVCGKEYQYYR   48 (148)
Q Consensus        33 ~~~~C~~C~~~f~~~~   48 (148)
                      .|+.|..|++.|-..-
T Consensus        12 ~~~~C~~C~~~FC~~H   27 (43)
T PF01428_consen   12 LPFKCKHCGKSFCLKH   27 (43)
T ss_dssp             SHEE-TTTS-EE-TTT
T ss_pred             CCeECCCCCcccCccc
Confidence            6889999999998763


No 167
>PLN02294 cytochrome c oxidase subunit Vb
Probab=42.27  E-value=13  Score=23.93  Aligned_cols=15  Identities=27%  Similarity=0.716  Sum_probs=8.8

Q ss_pred             CCccccCccccccCC
Q psy12018         32 YGKFACDVCGKEYQY   46 (148)
Q Consensus        32 ~~~~~C~~C~~~f~~   46 (148)
                      .++++|..||..|.-
T Consensus       139 Gkp~RCpeCG~~fkL  153 (174)
T PLN02294        139 GKSFECPVCTQYFEL  153 (174)
T ss_pred             CCceeCCCCCCEEEE
Confidence            346666666666543


No 168
>PF13878 zf-C2H2_3:  zinc-finger of acetyl-transferase ESCO
Probab=42.17  E-value=26  Score=16.66  Aligned_cols=10  Identities=30%  Similarity=0.816  Sum_probs=4.8

Q ss_pred             eCCCChhhhh
Q psy12018        121 QCPQCPYRAK  130 (148)
Q Consensus       121 ~C~~C~~~f~  130 (148)
                      .|..||..|.
T Consensus        15 ~C~~CgM~Y~   24 (41)
T PF13878_consen   15 TCPTCGMLYS   24 (41)
T ss_pred             CCCCCCCEEC
Confidence            4555554443


No 169
>KOG2482|consensus
Probab=42.13  E-value=13  Score=26.79  Aligned_cols=52  Identities=23%  Similarity=0.413  Sum_probs=36.4

Q ss_pred             eecCcccccc-ccchhHHhhHhhhhCCC---------------------CceeCCCChhhhhchHHHHHHHHhh
Q psy12018         91 YVCDICGKVY-QHKRTLYRHKKDECGQE---------------------PRFQCPQCPYRAKQKANLKTHLIIK  142 (148)
Q Consensus        91 ~~C~~c~~~f-~~~~~l~~H~~~~~~~~---------------------~~~~C~~C~~~f~~~~~l~~H~~~~  142 (148)
                      -+|-.|...+ ..++.+..|...-++-.                     -.++|-.|.+.|+.+..|..||+..
T Consensus       145 lqClFCn~e~lgnRs~~l~Hlf~~H~lniGlpDniVyvnelLehLkekL~r~~CLyCekifrdkntLkeHMrkK  218 (423)
T KOG2482|consen  145 LQCLFCNNEGLGNRSEILEHLFHVHGLNIGLPDNIVYVNELLEHLKEKLERLRCLYCEKIFRDKNTLKEHMRKK  218 (423)
T ss_pred             eEEEEecchhcccHHHHHHHHHHHhhhccCCCcceeeHHHHHHHHHHHHhhheeeeeccccCCcHHHHHHHHhc
Confidence            4788888554 34455556655433310                     1378999999999999999999854


No 170
>PRK00432 30S ribosomal protein S27ae; Validated
Probab=42.02  E-value=26  Score=17.58  Aligned_cols=9  Identities=33%  Similarity=0.958  Sum_probs=4.4

Q ss_pred             ceecCcccc
Q psy12018         90 MYVCDICGK   98 (148)
Q Consensus        90 ~~~C~~c~~   98 (148)
                      .+.|..|+.
T Consensus        37 r~~C~~Cgy   45 (50)
T PRK00432         37 RWHCGKCGY   45 (50)
T ss_pred             cEECCCcCC
Confidence            345555553


No 171
>COG1655 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=41.93  E-value=7.9  Score=26.26  Aligned_cols=7  Identities=43%  Similarity=1.151  Sum_probs=4.8

Q ss_pred             eeCCCCh
Q psy12018        120 FQCPQCP  126 (148)
Q Consensus       120 ~~C~~C~  126 (148)
                      +.|+.|+
T Consensus        63 vvCP~C~   69 (267)
T COG1655          63 VVCPICY   69 (267)
T ss_pred             EEcchhh
Confidence            5677775


No 172
>PF04423 Rad50_zn_hook:  Rad50 zinc hook motif;  InterPro: IPR007517 The Mre11 complex (Mre11 Rad50 Nbs1) is central to chromosomal maintenance and functions in homologous recombination, telomere maintenance and sister chromatid association. The Rad50 coiled-coil region contains a dimer interface at the apex of the coiled coils in which pairs of conserved Cys-X-X-Cys motifs form interlocking hooks that bind one Zn ion. This alignment includes the zinc hook motif and a short stretch of coiled-coil on either side.; GO: 0004518 nuclease activity, 0005524 ATP binding, 0008270 zinc ion binding, 0006281 DNA repair; PDB: 1L8D_B.
Probab=41.69  E-value=11  Score=18.97  Aligned_cols=12  Identities=25%  Similarity=0.974  Sum_probs=6.1

Q ss_pred             ecCccccccccc
Q psy12018         92 VCDICGKVYQHK  103 (148)
Q Consensus        92 ~C~~c~~~f~~~  103 (148)
                      .|+.|++.|...
T Consensus        22 ~CPlC~r~l~~e   33 (54)
T PF04423_consen   22 CCPLCGRPLDEE   33 (54)
T ss_dssp             E-TTT--EE-HH
T ss_pred             cCCCCCCCCCHH
Confidence            788898888654


No 173
>COG2879 Uncharacterized small protein [Function unknown]
Probab=41.22  E-value=31  Score=18.24  Aligned_cols=18  Identities=22%  Similarity=0.172  Sum_probs=14.5

Q ss_pred             hchHHHHHHHHhhcCCcc
Q psy12018        130 KQKANLKTHLIIKHDSVL  147 (148)
Q Consensus       130 ~~~~~l~~H~~~~h~~~~  147 (148)
                      ++.+.+..|++.+|++.+
T Consensus        23 pdYdnYVehmr~~hPd~p   40 (65)
T COG2879          23 PDYDNYVEHMRKKHPDKP   40 (65)
T ss_pred             CcHHHHHHHHHHhCcCCC
Confidence            466788899999998765


No 174
>smart00132 LIM Zinc-binding domain present in Lin-11, Isl-1, Mec-3. Zinc-binding domain family. Some LIM domains bind protein partners via tyrosine-containing motifs. LIM domains are found in many key regulators of developmental pathways.
Probab=41.19  E-value=28  Score=15.41  Aligned_cols=6  Identities=50%  Similarity=1.459  Sum_probs=2.3

Q ss_pred             ecCccc
Q psy12018         92 VCDICG   97 (148)
Q Consensus        92 ~C~~c~   97 (148)
                      .|..|+
T Consensus        29 ~C~~C~   34 (39)
T smart00132       29 KCSKCG   34 (39)
T ss_pred             CCcccC
Confidence            333333


No 175
>PF01363 FYVE:  FYVE zinc finger;  InterPro: IPR000306 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The FYVE zinc finger is named after four proteins that it has been found in: Fab1, YOTB/ZK632.12, Vac1, and EEA1. The FYVE finger has been shown to bind two zinc ions []. The FYVE finger has eight potential zinc coordinating cysteine positions. Many members of this family also include two histidines in a motif R+HHC+XCG, where + represents a charged residue and X any residue. FYVE-type domains are divided into two known classes: FYVE domains that specifically bind to phosphatidylinositol 3-phosphate in lipid bilayers and FYVE-related domains of undetermined function []. Those that bind to phosphatidylinositol 3-phosphate are often found in proteins targeted to lipid membranes that are involved in regulating membrane traffic [, , ]. Most FYVE domains target proteins to endosomes by binding specifically to phosphatidylinositol-3-phosphate at the membrane surface. By contrast, the CARP2 FYVE-like domain is not optimized to bind to phosphoinositides or insert into lipid bilayers. FYVE domains are distinguished from other zinc fingers by three signature sequences: an N-terminal WxxD motif, a basic R(R/K)HHCR patch, and a C-terminal RVC motif. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0046872 metal ion binding; PDB: 1HYI_A 1JOC_B 1HYJ_A 1DVP_A 3ZYQ_A 4AVX_A 1VFY_A 3T7L_A 1X4U_A 1WFK_A ....
Probab=40.58  E-value=21  Score=18.82  Aligned_cols=8  Identities=50%  Similarity=1.630  Sum_probs=1.8

Q ss_pred             cCcccccc
Q psy12018         37 CDVCGKEY   44 (148)
Q Consensus        37 C~~C~~~f   44 (148)
                      |..|++.|
T Consensus        12 C~~C~~~F   19 (69)
T PF01363_consen   12 CMICGKKF   19 (69)
T ss_dssp             -TTT--B-
T ss_pred             CcCcCCcC
Confidence            44444444


No 176
>KOG2593|consensus
Probab=40.39  E-value=18  Score=26.94  Aligned_cols=15  Identities=27%  Similarity=0.755  Sum_probs=7.4

Q ss_pred             CccccCccccccCCh
Q psy12018         33 GKFACDVCGKEYQYY   47 (148)
Q Consensus        33 ~~~~C~~C~~~f~~~   47 (148)
                      ..|.|+.|.+.|...
T Consensus       127 ~~Y~Cp~C~kkyt~L  141 (436)
T KOG2593|consen  127 AGYVCPNCQKKYTSL  141 (436)
T ss_pred             ccccCCccccchhhh
Confidence            345555555555443


No 177
>KOG2785|consensus
Probab=40.29  E-value=23  Score=25.96  Aligned_cols=25  Identities=20%  Similarity=0.289  Sum_probs=20.7

Q ss_pred             CCceeCCCChhhhhchHHHHHHHHh
Q psy12018        117 EPRFQCPQCPYRAKQKANLKTHLII  141 (148)
Q Consensus       117 ~~~~~C~~C~~~f~~~~~l~~H~~~  141 (148)
                      +-++.|..|.+.|.+......|+..
T Consensus        66 ~~~~~c~~c~k~~~s~~a~~~hl~S   90 (390)
T KOG2785|consen   66 ESVVYCEACNKSFASPKAHENHLKS   90 (390)
T ss_pred             ccceehHHhhccccChhhHHHHHHH
Confidence            4578899999999998888888764


No 178
>COG1675 TFA1 Transcription initiation factor IIE, alpha subunit [Transcription]
Probab=39.23  E-value=22  Score=23.16  Aligned_cols=14  Identities=29%  Similarity=0.738  Sum_probs=7.6

Q ss_pred             CcccCCCCCCcccc
Q psy12018         62 PRYQCPQCPYRTKQ   75 (148)
Q Consensus        62 ~~~~C~~c~~~f~~   75 (148)
                      .-|.|+.|...+..
T Consensus       112 ~~y~C~~~~~r~sf  125 (176)
T COG1675         112 NYYVCPNCHVKYSF  125 (176)
T ss_pred             CceeCCCCCCcccH
Confidence            34666666554443


No 179
>TIGR01562 FdhE formate dehydrogenase accessory protein FdhE. The only sequence scoring between trusted and noise is that from Aquifex aeolicus, which shows certain structural differences from the proteobacterial forms in the alignment. However it is notable that A. aeolicus also has a sequence scoring above trusted to the alpha subunit of formate dehydrogenase (TIGR01553).
Probab=39.11  E-value=35  Score=24.39  Aligned_cols=52  Identities=19%  Similarity=0.337  Sum_probs=27.1

Q ss_pred             CCccccCccccccCChhHHhcccccccCCCCcccCCCCCCcccccccccccccCCCCCceecCccccc
Q psy12018         32 YGKFACDVCGKEYQYYRNLYRHKKFECGQEPRYQCPQCPYRTKQKELGWESLKPNAYGMYVCDICGKV   99 (148)
Q Consensus        32 ~~~~~C~~C~~~f~~~~~l~~h~~~~~~~~~~~~C~~c~~~f~~~~~~~~~~~~~~~~~~~C~~c~~~   99 (148)
                      ...-.|++||..= ..+-+ .......| .+-..|+.|+-....             .+-+|+.||..
T Consensus       182 ~~~~~CPvCGs~P-~~s~~-~~~~~~~G-~RyL~CslC~teW~~-------------~R~~C~~Cg~~  233 (305)
T TIGR01562       182 ESRTLCPACGSPP-VASMV-RQGGKETG-LRYLSCSLCATEWHY-------------VRVKCSHCEES  233 (305)
T ss_pred             CCCCcCCCCCChh-hhhhh-cccCCCCC-ceEEEcCCCCCcccc-------------cCccCCCCCCC
Confidence            3345799998751 11111 11111223 556778888753222             13579999964


No 180
>PRK00564 hypA hydrogenase nickel incorporation protein; Provisional
Probab=39.06  E-value=18  Score=21.74  Aligned_cols=10  Identities=20%  Similarity=0.893  Sum_probs=4.7

Q ss_pred             cccCcccccc
Q psy12018         35 FACDVCGKEY   44 (148)
Q Consensus        35 ~~C~~C~~~f   44 (148)
                      ..|..|+..|
T Consensus        72 ~~C~~Cg~~~   81 (117)
T PRK00564         72 LECKDCSHVF   81 (117)
T ss_pred             EEhhhCCCcc
Confidence            4455555443


No 181
>PF07503 zf-HYPF:  HypF finger;  InterPro: IPR011125 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  Proteins of the HypF family are involved in the maturation and regulation of hydrogenase []. In the N terminus they appear to have two zinc finger domains that are similar to those found in the DnaJ chaperone []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 3TTD_A 3TSQ_A 3TTC_A 3TSP_A 3TTF_A 3TSU_A.
Probab=38.63  E-value=3.6  Score=18.99  Aligned_cols=11  Identities=27%  Similarity=0.594  Sum_probs=5.0

Q ss_pred             ceeCCCChhhh
Q psy12018        119 RFQCPQCPYRA  129 (148)
Q Consensus       119 ~~~C~~C~~~f  129 (148)
                      +..|..||-.+
T Consensus        21 ~isC~~CGPr~   31 (35)
T PF07503_consen   21 FISCTNCGPRY   31 (35)
T ss_dssp             T--BTTCC-SC
T ss_pred             CccCCCCCCCE
Confidence            45677776554


No 182
>PF05495 zf-CHY:  CHY zinc finger;  InterPro: IPR008913 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  Pirh2 is an eukaryotic ubiquitin protein ligase, which has been shown to promote p53 degradation in mammals. Pirh2 physically interacts with p53 and promotes ubiquitination of p53 independently of MDM2. Like MDM2, Pirh2 is thought to participate in an autoregulatory feedback loop that controls p53 function. Pirh2 proteins contain three distinct zinc fingers, the CHY-type, the CTCHY-type which is C-terminal to the CHY-type zinc finger and a RING finger. The CHY-type zinc finger has no currently known function []. As well as Pirh2, the CHY-type zinc finger is also found in the following proteins:   Yeast helper of Tim protein 13. Hot13 may have a role in the assembly and recycling of the small Tims, a complex of the mitochondrial intermembrane space that participates in the TIM22 import pathway for assembly of the inner membrane [] Several plant hypothetical proteins that also contain haemerythrin cation binding domains Several protozoan hypothetical proteins that also contain a Myb domain   The solution structure of this zinc finger has been solved and binds 3 zinc atoms as shown in the following schematic representation:   ++---------+-----+ || | | CXHYxxxxxxxxxCCxxxxxCxxCHxxxxxHxxxxxxxxxxxCxxCxxxxxxxxxCxxC | | | | | | | | +-+-----------------+--+ +--+---------+--+ 'C': conserved cysteine involved in the binding of one zinc atom. 'H': conserved histidine involved in the binding of one zinc atom.  More information about these proteins can be found at Protein of the Month: Zinc Fingers []; GO: 0008270 zinc ion binding; PDB: 2DKT_A 2K2C_A.
Probab=38.09  E-value=27  Score=18.89  Aligned_cols=13  Identities=31%  Similarity=0.585  Sum_probs=6.8

Q ss_pred             cccCccccccCCh
Q psy12018         35 FACDVCGKEYQYY   47 (148)
Q Consensus        35 ~~C~~C~~~f~~~   47 (148)
                      ++++-|++.|.-.
T Consensus        11 ~~~~cC~~~y~C~   23 (71)
T PF05495_consen   11 IRFPCCGKYYPCR   23 (71)
T ss_dssp             EEETTTTEEESSH
T ss_pred             EECCcccCeecHH
Confidence            4455556655544


No 183
>PRK04023 DNA polymerase II large subunit; Validated
Probab=37.95  E-value=82  Score=26.68  Aligned_cols=10  Identities=20%  Similarity=0.620  Sum_probs=6.3

Q ss_pred             ceeCCCChhh
Q psy12018        119 RFQCPQCPYR  128 (148)
Q Consensus       119 ~~~C~~C~~~  128 (148)
                      ++.|+.||..
T Consensus       663 ~y~CPKCG~E  672 (1121)
T PRK04023        663 EDECEKCGRE  672 (1121)
T ss_pred             CCcCCCCCCC
Confidence            3567777653


No 184
>PF01155 HypA:  Hydrogenase expression/synthesis hypA family;  InterPro: IPR000688 Bacterial membrane-bound nickel-dependent hydrogenases requires a number of accessory proteins which are involved in their maturation. The exact role of these proteins is not yet clear, but some seem to be required for the incorporation of the nickel ions []. One of these proteins is generally known as hypA. It is a protein of about 12 to 14 kDa that contains, in its C-terminal region, four conserved cysteines that form a zinc-finger like motif. Escherichia coli has two proteins that belong to this family, hypA and hybF. A homologue, MJ0214, has also been found in a number of archaeal species, including the genome of Methanocaldococcus jannaschii (Methanococcus jannaschii).; GO: 0016151 nickel ion binding, 0006464 protein modification process; PDB: 2KDX_A 3A44_D 3A43_B.
Probab=37.65  E-value=11  Score=22.46  Aligned_cols=11  Identities=36%  Similarity=1.044  Sum_probs=4.8

Q ss_pred             cccCccccccC
Q psy12018         35 FACDVCGKEYQ   45 (148)
Q Consensus        35 ~~C~~C~~~f~   45 (148)
                      ..|..|+..|.
T Consensus        71 ~~C~~Cg~~~~   81 (113)
T PF01155_consen   71 ARCRDCGHEFE   81 (113)
T ss_dssp             EEETTTS-EEE
T ss_pred             EECCCCCCEEe
Confidence            44555555443


No 185
>KOG3214|consensus
Probab=37.60  E-value=13  Score=21.65  Aligned_cols=13  Identities=15%  Similarity=0.360  Sum_probs=7.4

Q ss_pred             eeCCCChhhhhch
Q psy12018        120 FQCPQCPYRAKQK  132 (148)
Q Consensus       120 ~~C~~C~~~f~~~  132 (148)
                      ..|.+|+.+|.+.
T Consensus        48 ~sC~iC~esFqt~   60 (109)
T KOG3214|consen   48 ASCRICEESFQTT   60 (109)
T ss_pred             eeeeehhhhhccc
Confidence            4566666666543


No 186
>COG4338 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=36.90  E-value=13  Score=18.42  Aligned_cols=16  Identities=13%  Similarity=0.740  Sum_probs=11.8

Q ss_pred             ecCccccccccchhHH
Q psy12018         92 VCDICGKVYQHKRTLY  107 (148)
Q Consensus        92 ~C~~c~~~f~~~~~l~  107 (148)
                      .|+.|++.|.+...+.
T Consensus        14 ICpvCqRPFsWRkKW~   29 (54)
T COG4338          14 ICPVCQRPFSWRKKWA   29 (54)
T ss_pred             hhhhhcCchHHHHHHH
Confidence            5889999988765543


No 187
>PF14803 Nudix_N_2:  Nudix N-terminal; PDB: 3CNG_C.
Probab=36.52  E-value=30  Score=15.78  Aligned_cols=7  Identities=57%  Similarity=1.497  Sum_probs=3.2

Q ss_pred             eecCccc
Q psy12018         91 YVCDICG   97 (148)
Q Consensus        91 ~~C~~c~   97 (148)
                      +.|+.|+
T Consensus        23 ~vC~~Cg   29 (34)
T PF14803_consen   23 LVCPACG   29 (34)
T ss_dssp             EEETTTT
T ss_pred             eECCCCC
Confidence            4444444


No 188
>PF11789 zf-Nse:  Zinc-finger of the MIZ type in Nse subunit; PDB: 2YU4_A 3HTK_C.
Probab=36.06  E-value=66  Score=16.54  Aligned_cols=45  Identities=16%  Similarity=0.344  Sum_probs=21.5

Q ss_pred             CCcccCCCCCCcccccccccccccCCCCCceecCccccccccchhHHhhHhhhhCCCCceeCCC
Q psy12018         61 EPRYQCPQCPYRTKQKELGWESLKPNAYGMYVCDICGKVYQHKRTLYRHKKDECGQEPRFQCPQ  124 (148)
Q Consensus        61 ~~~~~C~~c~~~f~~~~~~~~~~~~~~~~~~~C~~c~~~f~~~~~l~~H~~~~~~~~~~~~C~~  124 (148)
                      ...+.|++..+.|..              |.....|+-.|...+.+ .++    +......|++
T Consensus         9 ~~~~~CPiT~~~~~~--------------PV~s~~C~H~fek~aI~-~~i----~~~~~~~CPv   53 (57)
T PF11789_consen    9 TISLKCPITLQPFED--------------PVKSKKCGHTFEKEAIL-QYI----QRNGSKRCPV   53 (57)
T ss_dssp             B--SB-TTTSSB-SS--------------EEEESSS--EEEHHHHH-HHC----TTTS-EE-SC
T ss_pred             EeccCCCCcCChhhC--------------CcCcCCCCCeecHHHHH-HHH----HhcCCCCCCC
Confidence            456778776665554              45566788787655443 343    2244577876


No 189
>KOG2071|consensus
Probab=35.79  E-value=24  Score=27.47  Aligned_cols=27  Identities=22%  Similarity=0.441  Sum_probs=22.3

Q ss_pred             CCceeCCCChhhhhchHHHHHHHHhhc
Q psy12018        117 EPRFQCPQCPYRAKQKANLKTHLIIKH  143 (148)
Q Consensus       117 ~~~~~C~~C~~~f~~~~~l~~H~~~~h  143 (148)
                      ..|..|..||..|........||-+|-
T Consensus       416 ~~pnqC~~CG~R~~~~ee~sk~md~H~  442 (579)
T KOG2071|consen  416 DSPNQCKSCGLRFDDSEERSKHMDIHD  442 (579)
T ss_pred             CCcchhcccccccccchhhhhHhhhhh
Confidence            457899999999999888888877664


No 190
>COG1594 RPB9 DNA-directed RNA polymerase, subunit M/Transcription elongation factor TFIIS [Transcription]
Probab=35.66  E-value=36  Score=20.35  Aligned_cols=18  Identities=33%  Similarity=0.545  Sum_probs=12.7

Q ss_pred             CCCccccCccccccCChh
Q psy12018         31 LYGKFACDVCGKEYQYYR   48 (148)
Q Consensus        31 ~~~~~~C~~C~~~f~~~~   48 (148)
                      +..-+.|..||-.+....
T Consensus        19 ~~~~l~C~kCgye~~~~~   36 (113)
T COG1594          19 EGGKLVCRKCGYEEEASN   36 (113)
T ss_pred             CCcEEECCCCCcchhccc
Confidence            344788999998766553


No 191
>PF11672 DUF3268:  Protein of unknown function (DUF3268);  InterPro: IPR021686 This entry is represented by Listeria phage P100, Gp150. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches.
Probab=35.37  E-value=47  Score=19.53  Aligned_cols=7  Identities=57%  Similarity=1.507  Sum_probs=3.4

Q ss_pred             eecCccc
Q psy12018         91 YVCDICG   97 (148)
Q Consensus        91 ~~C~~c~   97 (148)
                      |.|..|+
T Consensus        32 y~C~~C~   38 (102)
T PF11672_consen   32 YVCTPCD   38 (102)
T ss_pred             EECCCCC
Confidence            4454444


No 192
>PF01286 XPA_N:  XPA protein N-terminal;  InterPro: IPR022652 Xeroderma pigmentosum (XP) [] is a human autosomal recessive disease, characterised by a high incidence of sunlight-induced skin cancer. Skin cells of individual's with this condition are hypersensitive to ultraviolet light, due to defects in the incision step of DNA excision repair. There are a minimum of seven genetic complementation groups involved in this pathway: XP-A to XP-G. XP-A is the most severe form of the disease and is due to defects in a 30 kDa nuclear protein called XPA (or XPAC) []. The sequence of the XPA protein is conserved from higher eukaryotes [] to yeast (gene RAD14) []. XPA is a hydrophilic protein of 247 to 296 amino-acid residues which has a C4-type zinc finger motif in its central section. This entry contains the zinc-finger containing region in the XPA protein. It is found N-terminal to PF05181 from PFAM ; PDB: 1D4U_A 1XPA_A.
Probab=35.15  E-value=13  Score=16.99  Aligned_cols=12  Identities=17%  Similarity=0.506  Sum_probs=5.5

Q ss_pred             eCCCChhhhhch
Q psy12018        121 QCPQCPYRAKQK  132 (148)
Q Consensus       121 ~C~~C~~~f~~~  132 (148)
                      .|.+|++.|..+
T Consensus         5 ~C~eC~~~f~dS   16 (34)
T PF01286_consen    5 KCDECGKPFMDS   16 (34)
T ss_dssp             E-TTT--EES-S
T ss_pred             hHhHhCCHHHHH
Confidence            577777777654


No 193
>COG2331 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=35.02  E-value=14  Score=20.40  Aligned_cols=10  Identities=40%  Similarity=1.222  Sum_probs=5.4

Q ss_pred             eecCcccccc
Q psy12018         91 YVCDICGKVY  100 (148)
Q Consensus        91 ~~C~~c~~~f  100 (148)
                      |+|..|+..|
T Consensus        13 Y~c~~cg~~~   22 (82)
T COG2331          13 YECTECGNRF   22 (82)
T ss_pred             EeecccchHH
Confidence            5556665443


No 194
>COG3091 SprT Zn-dependent metalloprotease, SprT family [General function prediction only]
Probab=34.85  E-value=20  Score=22.70  Aligned_cols=8  Identities=50%  Similarity=1.456  Sum_probs=4.2

Q ss_pred             ceecCccc
Q psy12018         90 MYVCDICG   97 (148)
Q Consensus        90 ~~~C~~c~   97 (148)
                      .|.|..|+
T Consensus       140 ~YrC~~C~  147 (156)
T COG3091         140 VYRCGKCG  147 (156)
T ss_pred             eEEeccCC
Confidence            45555554


No 195
>COG1773 Rubredoxin [Energy production and conversion]
Probab=34.67  E-value=15  Score=18.92  Aligned_cols=10  Identities=30%  Similarity=0.966  Sum_probs=6.0

Q ss_pred             eeCCCChhhh
Q psy12018        120 FQCPQCPYRA  129 (148)
Q Consensus       120 ~~C~~C~~~f  129 (148)
                      |+|..||..|
T Consensus         4 ~~C~~CG~vY   13 (55)
T COG1773           4 WRCSVCGYVY   13 (55)
T ss_pred             eEecCCceEe
Confidence            5666666554


No 196
>KOG2482|consensus
Probab=33.95  E-value=24  Score=25.60  Aligned_cols=23  Identities=30%  Similarity=0.626  Sum_probs=20.7

Q ss_pred             ceecCccccccccchhHHhhHhh
Q psy12018         90 MYVCDICGKVYQHKRTLYRHKKD  112 (148)
Q Consensus        90 ~~~C~~c~~~f~~~~~l~~H~~~  112 (148)
                      .+.|..|++.|..+..|..|++.
T Consensus       195 r~~CLyCekifrdkntLkeHMrk  217 (423)
T KOG2482|consen  195 RLRCLYCEKIFRDKNTLKEHMRK  217 (423)
T ss_pred             hheeeeeccccCCcHHHHHHHHh
Confidence            36899999999999999999883


No 197
>PF06397 Desulfoferrod_N:  Desulfoferrodoxin, N-terminal domain;  InterPro: IPR004462 This domain is found as essentially the full length of desulforedoxin, a 37-residue homodimeric non-haem iron protein. It is also found as the N-terminal domain of desulfoferrodoxin (rbo), a homodimeric non-haem iron protein with 2 Fe atoms per monomer in different oxidation states. This domain binds the ferric rather than the ferrous Fe of desulfoferrodoxin. Neelaredoxin, a monomeric blue non-haem iron protein, lacks this domain.; GO: 0005506 iron ion binding; PDB: 1DFX_A 1VZI_B 2JI2_D 1VZH_B 2JI3_C 2JI1_C 1VZG_A 1CFW_A 2LK5_B 1DHG_B ....
Probab=33.52  E-value=16  Score=17.03  Aligned_cols=11  Identities=27%  Similarity=0.878  Sum_probs=4.7

Q ss_pred             CccccCccccc
Q psy12018         33 GKFACDVCGKE   43 (148)
Q Consensus        33 ~~~~C~~C~~~   43 (148)
                      +-|+|..||..
T Consensus         5 ~~YkC~~CGni   15 (36)
T PF06397_consen    5 EFYKCEHCGNI   15 (36)
T ss_dssp             EEEE-TTT--E
T ss_pred             cEEEccCCCCE
Confidence            34666666655


No 198
>cd00065 FYVE FYVE domain; Zinc-binding domain; targets proteins to membrane lipids via interaction with phosphatidylinositol-3-phosphate, PI3P; present in Fab1, YOTB, Vac1, and EEA1;
Probab=33.30  E-value=28  Score=17.42  Aligned_cols=26  Identities=19%  Similarity=0.487  Sum_probs=14.6

Q ss_pred             cCCCCCCcccccccccccccCCCCCceecCccccccc
Q psy12018         65 QCPQCPYRTKQKELGWESLKPNAYGMYVCDICGKVYQ  101 (148)
Q Consensus        65 ~C~~c~~~f~~~~~~~~~~~~~~~~~~~C~~c~~~f~  101 (148)
                      .|..|++.|...           .+.+.|..||+.|-
T Consensus         4 ~C~~C~~~F~~~-----------~rk~~Cr~Cg~~~C   29 (57)
T cd00065           4 SCMGCGKPFTLT-----------RRRHHCRNCGRIFC   29 (57)
T ss_pred             cCcccCccccCC-----------ccccccCcCcCCcC
Confidence            466677666641           22345666666654


No 199
>PRK03681 hypA hydrogenase nickel incorporation protein; Validated
Probab=32.75  E-value=24  Score=21.09  Aligned_cols=10  Identities=20%  Similarity=0.521  Sum_probs=4.6

Q ss_pred             ccCCCCCCcc
Q psy12018         64 YQCPQCPYRT   73 (148)
Q Consensus        64 ~~C~~c~~~f   73 (148)
                      ..|..|+..|
T Consensus        71 ~~C~~Cg~~~   80 (114)
T PRK03681         71 CWCETCQQYV   80 (114)
T ss_pred             EEcccCCCee
Confidence            4455555433


No 200
>TIGR00143 hypF [NiFe] hydrogenase maturation protein HypF. A previously described regulatory effect of HypF mutatation is attributable to loss of activity of a regulatory hydrogenase. A zinc finger-like region CXXCX(18)CXXCX(24)CXXCX(18)CXXC region further supported the regulatory hypothesis. However, more recent work (PUBMED:11375153) shows the direct effect is on the activity of expressed hydrogenases with nickel/iron centers, rather than on expression.
Probab=32.42  E-value=25  Score=28.32  Aligned_cols=80  Identities=19%  Similarity=0.250  Sum_probs=44.6

Q ss_pred             cccCccccccCChhHHhcccccccCCCCc-ccCCCCCCcccccccccccccCC-CCCceecCccccccccchhHHhhHhh
Q psy12018         35 FACDVCGKEYQYYRNLYRHKKFECGQEPR-YQCPQCPYRTKQKELGWESLKPN-AYGMYVCDICGKVYQHKRTLYRHKKD  112 (148)
Q Consensus        35 ~~C~~C~~~f~~~~~l~~h~~~~~~~~~~-~~C~~c~~~f~~~~~~~~~~~~~-~~~~~~C~~c~~~f~~~~~l~~H~~~  112 (148)
                      -.|+.|-+.+....+-+     +   .-| ..|..||-.|.-...+..-..++ ...--.|+.|.+.+....+.+-|   
T Consensus        69 a~C~~Cl~E~~dp~~Rr-----y---~YpF~nCt~CGPr~~i~~~lpydr~~t~m~~f~~C~~C~~ey~~p~~rr~h---  137 (711)
T TIGR00143        69 ATCSDCLEEMLDKNDRR-----Y---LYPFISCTHCGPRFTIIEALPYDRENTSMADFPLCPDCAKEYKDPLDRRFH---  137 (711)
T ss_pred             hhHHHHHHHhcCCCccc-----c---cCCcccccCCCCCeEEeecCCCCCCCcCCCCCcCCHHHHHHhcCCccccCC---
Confidence            46777876655543211     1   123 34889998887654222122222 22223688888887766543322   


Q ss_pred             hhCCCCceeCCCChhhh
Q psy12018        113 ECGQEPRFQCPQCPYRA  129 (148)
Q Consensus       113 ~~~~~~~~~C~~C~~~f  129 (148)
                          -.+..|..||-..
T Consensus       138 ----~~~~~C~~Cgp~l  150 (711)
T TIGR00143       138 ----AQPIACPRCGPQL  150 (711)
T ss_pred             ----CCCccCCCCCcEE
Confidence                3467899998544


No 201
>PF09332 Mcm10:  Mcm10 replication factor;  InterPro: IPR015411 Mcm10 is a eukaryotic DNA replication factor that regulates the stability and chromatin association of DNA polymerase alpha []. ; PDB: 2KWQ_A.
Probab=31.45  E-value=19  Score=26.11  Aligned_cols=42  Identities=19%  Similarity=0.347  Sum_probs=16.2

Q ss_pred             ccccCccccccCChhHHh---cc-cccccCCCCcccCCCCCCcccc
Q psy12018         34 KFACDVCGKEYQYYRNLY---RH-KKFECGQEPRYQCPQCPYRTKQ   75 (148)
Q Consensus        34 ~~~C~~C~~~f~~~~~l~---~h-~~~~~~~~~~~~C~~c~~~f~~   75 (148)
                      -+.|..|..++.......   .| +..+.+...-|.|..|++...+
T Consensus       252 av~C~~C~yt~~~~~~~C~~~~H~l~~~~a~KRFFkC~~C~~Rt~s  297 (344)
T PF09332_consen  252 AVTCKQCKYTAFKPSDRCKEEGHPLKWHDAVKRFFKCKDCGNRTIS  297 (344)
T ss_dssp             EEEETTT--EESS--HHHHHTT--EEEEEEE-EEEE-T-TS-EEEE
T ss_pred             EEEcCCCCCcccCcchhHHhcCCceEEeeeeeeeEECCCCCCeeee
Confidence            456777766555544442   22 1222232345677777765443


No 202
>KOG1842|consensus
Probab=31.36  E-value=23  Score=26.61  Aligned_cols=32  Identities=19%  Similarity=0.328  Sum_probs=26.1

Q ss_pred             CCCCCccccCccccccCChhHHhcccccccCC
Q psy12018         29 PKLYGKFACDVCGKEYQYYRNLYRHKKFECGQ   60 (148)
Q Consensus        29 ~~~~~~~~C~~C~~~f~~~~~l~~h~~~~~~~   60 (148)
                      ..+-..|.|+.|...|.....|..|....+++
T Consensus        10 ~~i~egflCPiC~~dl~~~~~L~~H~d~eH~~   41 (505)
T KOG1842|consen   10 GEILEGFLCPICLLDLPNLSALNDHLDVEHFE   41 (505)
T ss_pred             chhhhcccCchHhhhhhhHHHHHHHHhhhccc
Confidence            34456799999999999999999998765543


No 203
>COG5152 Uncharacterized conserved protein, contains RING and CCCH-type Zn-fingers [General function prediction only]
Probab=31.15  E-value=26  Score=23.27  Aligned_cols=16  Identities=13%  Similarity=0.347  Sum_probs=10.9

Q ss_pred             CCcccCCCCCCccccc
Q psy12018         61 EPRYQCPQCPYRTKQK   76 (148)
Q Consensus        61 ~~~~~C~~c~~~f~~~   76 (148)
                      .-||.|.+|.+.|.+.
T Consensus       194 ~IPF~C~iCKkdy~sp  209 (259)
T COG5152         194 KIPFLCGICKKDYESP  209 (259)
T ss_pred             CCceeehhchhhccch
Confidence            3577777777776654


No 204
>KOG2907|consensus
Probab=30.92  E-value=33  Score=20.51  Aligned_cols=10  Identities=30%  Similarity=0.939  Sum_probs=5.0

Q ss_pred             eecCcccccc
Q psy12018         91 YVCDICGKVY  100 (148)
Q Consensus        91 ~~C~~c~~~f  100 (148)
                      |.|+.|+..|
T Consensus       103 YTC~kC~~k~  112 (116)
T KOG2907|consen  103 YTCPKCKYKF  112 (116)
T ss_pred             EEcCccceee
Confidence            4555555443


No 205
>TIGR00686 phnA alkylphosphonate utilization operon protein PhnA. The protein family includes an uncharacterized member designated phnA in Escherichia coli, part of a large operon associated with alkylphosphonate uptake and carbon-phosphorus bond cleavage. This protein is not related to the characterized phosphonoacetate hydrolase designated PhnA by Kulakova, et al. (2001, 1997).
Probab=30.85  E-value=31  Score=20.45  Aligned_cols=29  Identities=17%  Similarity=0.511  Sum_probs=16.6

Q ss_pred             cCCCCCCcccccccccccccCCCCCceecCccccccccc
Q psy12018         65 QCPQCPYRTKQKELGWESLKPNAYGMYVCDICGKVYQHK  103 (148)
Q Consensus        65 ~C~~c~~~f~~~~~~~~~~~~~~~~~~~C~~c~~~f~~~  103 (148)
                      .||.|+..+....          ...|.|++|+..+...
T Consensus         4 ~CP~C~seytY~d----------g~~~iCpeC~~EW~~~   32 (109)
T TIGR00686         4 PCPKCNSEYTYHD----------GTQLICPSCLYEWNEN   32 (109)
T ss_pred             cCCcCCCcceEec----------CCeeECcccccccccc
Confidence            4777766555431          2237788887665433


No 206
>KOG4124|consensus
Probab=30.63  E-value=23  Score=25.76  Aligned_cols=24  Identities=33%  Similarity=0.656  Sum_probs=18.0

Q ss_pred             CCCccccCc--cccccCChhHHhccc
Q psy12018         31 LYGKFACDV--CGKEYQYYRNLYRHK   54 (148)
Q Consensus        31 ~~~~~~C~~--C~~~f~~~~~l~~h~   54 (148)
                      .+++|.|.+  |.+.+.....|..|.
T Consensus       346 ~~~~~~~~vp~~~~~~~n~ng~~~~~  371 (442)
T KOG4124|consen  346 VDKPYKCPVPNCDKAYKNQNGLKYHK  371 (442)
T ss_pred             ecCCCCCCCCcchhhcccCcceeecc
Confidence            467888877  888888877776664


No 207
>PRK10220 hypothetical protein; Provisional
Probab=29.93  E-value=35  Score=20.31  Aligned_cols=29  Identities=28%  Similarity=0.865  Sum_probs=17.3

Q ss_pred             cCCCCCCcccccccccccccCCCCCceecCccccccccc
Q psy12018         65 QCPQCPYRTKQKELGWESLKPNAYGMYVCDICGKVYQHK  103 (148)
Q Consensus        65 ~C~~c~~~f~~~~~~~~~~~~~~~~~~~C~~c~~~f~~~  103 (148)
                      .||+|+..+....          ...|.|++|+..+...
T Consensus         5 ~CP~C~seytY~d----------~~~~vCpeC~hEW~~~   33 (111)
T PRK10220          5 HCPKCNSEYTYED----------NGMYICPECAHEWNDA   33 (111)
T ss_pred             cCCCCCCcceEcC----------CCeEECCcccCcCCcc
Confidence            5777776555431          2247788887666543


No 208
>KOG2231|consensus
Probab=29.58  E-value=31  Score=27.45  Aligned_cols=43  Identities=21%  Similarity=0.239  Sum_probs=27.8

Q ss_pred             cchhHHhhHhhhhCCCC----ceeCCCChhhhhchHHHHHHHHhhcC
Q psy12018        102 HKRTLYRHKKDECGQEP----RFQCPQCPYRAKQKANLKTHLIIKHD  144 (148)
Q Consensus       102 ~~~~l~~H~~~~~~~~~----~~~C~~C~~~f~~~~~l~~H~~~~h~  144 (148)
                      ....|..|+..-..+++    .-.|..|...|-....|.+|++..|-
T Consensus       161 t~~el~~h~~~gd~d~~s~rGhp~C~~C~~~fld~~el~rH~~~~h~  207 (669)
T KOG2231|consen  161 TRAELNLHLMFGDPDDESCRGHPLCKFCHERFLDDDELYRHLRFDHE  207 (669)
T ss_pred             hHHHHHHHHhcCCCccccccCCccchhhhhhhccHHHHHHhhcccee
Confidence            34556666553222121    13577888999999999999987664


No 209
>COG5112 UFD2 U1-like Zn-finger-containing protein [General function prediction only]
Probab=29.37  E-value=34  Score=20.18  Aligned_cols=28  Identities=25%  Similarity=0.343  Sum_probs=21.9

Q ss_pred             CCCCCccccCccccccCChhHHhccccc
Q psy12018         29 PKLYGKFACDVCGKEYQYYRNLYRHKKF   56 (148)
Q Consensus        29 ~~~~~~~~C~~C~~~f~~~~~l~~h~~~   56 (148)
                      -.+-+-+-|-+|.+-|.....|..|.+.
T Consensus        50 lPGlGqhYCieCaryf~t~~aL~~Hkkg   77 (126)
T COG5112          50 LPGLGQHYCIECARYFITEKALMEHKKG   77 (126)
T ss_pred             CCCCceeeeehhHHHHHHHHHHHHHhcc
Confidence            3345568899999999999999888643


No 210
>PF03811 Zn_Tnp_IS1:  InsA N-terminal domain;  InterPro: IPR003220 Insertion elements are mobile elements in DNA, usually encoding proteins required for transposition, for example transposases. Protein InsA is absolutely required for transposition of insertion element 1. This entry represents a short zinc binding domain found in IS1 InsA family protein. It is found at the N terminus of the protein and may be a DNA-binding domain.; GO: 0006313 transposition, DNA-mediated
Probab=29.03  E-value=20  Score=16.62  Aligned_cols=8  Identities=38%  Similarity=0.949  Sum_probs=4.0

Q ss_pred             CceecCcc
Q psy12018         89 GMYVCDIC   96 (148)
Q Consensus        89 ~~~~C~~c   96 (148)
                      -.|.|..|
T Consensus        28 qryrC~~C   35 (36)
T PF03811_consen   28 QRYRCKDC   35 (36)
T ss_pred             EeEecCcC
Confidence            34555544


No 211
>COG5151 SSL1 RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, subunit SSL1 [Transcription / DNA replication, recombination, and repair]
Probab=28.27  E-value=49  Score=23.75  Aligned_cols=24  Identities=21%  Similarity=0.458  Sum_probs=16.4

Q ss_pred             ceeCCCChhhhhchHHHHHHHHhh
Q psy12018        119 RFQCPQCPYRAKQKANLKTHLIIK  142 (148)
Q Consensus       119 ~~~C~~C~~~f~~~~~l~~H~~~~  142 (148)
                      .|+|..|...|-.....-.|...|
T Consensus       388 rY~Ce~CK~~FC~dCdvfiHe~Lh  411 (421)
T COG5151         388 RYQCELCKSTFCSDCDVFIHETLH  411 (421)
T ss_pred             ceechhhhhhhhhhhHHHHHHHHh
Confidence            488888888887666655665443


No 212
>TIGR00627 tfb4 transcription factor tfb4. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=27.88  E-value=40  Score=23.78  Aligned_cols=9  Identities=44%  Similarity=1.265  Sum_probs=4.1

Q ss_pred             eecCccccc
Q psy12018         91 YVCDICGKV   99 (148)
Q Consensus        91 ~~C~~c~~~   99 (148)
                      |.|+.|...
T Consensus       256 yvCs~Clsi  264 (279)
T TIGR00627       256 FVCSVCLSV  264 (279)
T ss_pred             EECCCccCC
Confidence            444444433


No 213
>PF10276 zf-CHCC:  Zinc-finger domain;  InterPro: IPR019401 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.   This entry represents a short conserved zinc-finger domain. It contains the sequence motif Cx8Hx14Cx2C. ; PDB: 2JVM_A 2JRR_A 2JZ8_A.
Probab=27.32  E-value=36  Score=16.22  Aligned_cols=11  Identities=45%  Similarity=1.029  Sum_probs=6.2

Q ss_pred             ceecCcccccc
Q psy12018         90 MYVCDICGKVY  100 (148)
Q Consensus        90 ~~~C~~c~~~f  100 (148)
                      .-.|++|+..|
T Consensus        29 ~~~CpYCg~~y   39 (40)
T PF10276_consen   29 PVVCPYCGTRY   39 (40)
T ss_dssp             EEEETTTTEEE
T ss_pred             eEECCCCCCEE
Confidence            35566666554


No 214
>PTZ00448 hypothetical protein; Provisional
Probab=27.16  E-value=43  Score=24.61  Aligned_cols=23  Identities=17%  Similarity=0.400  Sum_probs=18.9

Q ss_pred             ceeCCCChhhhhchHHHHHHHHh
Q psy12018        119 RFQCPQCPYRAKQKANLKTHLII  141 (148)
Q Consensus       119 ~~~C~~C~~~f~~~~~l~~H~~~  141 (148)
                      .|.|..|+-.|.+....+.|.+.
T Consensus       314 ~~tC~~C~v~F~~~~~qR~H~KS  336 (373)
T PTZ00448        314 MLLCRKCNIQLMDHNAFKQHYRS  336 (373)
T ss_pred             CccccccccccCCHHHHHHHhhh
Confidence            57899999999888888888763


No 215
>smart00064 FYVE Protein present in Fab1, YOTB, Vac1, and EEA1. The FYVE zinc finger is named after four proteins where it was first found: Fab1, YOTB/ZK632.12, Vac1, and EEA1. The FYVE finger has been shown to bind two Zn2+ ions. The FYVE finger has eight potential zinc coordinating cysteine positions. The FYVE finger is structurally related to the PF05290 Baculo_IE-1:  Baculovirus immediate-early protein (IE-0);  InterPro: IPR007954 This entry contains the Baculovirus immediate-early protein IE-0.
Probab=26.93  E-value=40  Score=20.91  Aligned_cols=15  Identities=20%  Similarity=0.572  Sum_probs=9.6

Q ss_pred             CCcccCCCCCCcccc
Q psy12018         61 EPRYQCPQCPYRTKQ   75 (148)
Q Consensus        61 ~~~~~C~~c~~~f~~   75 (148)
                      .+.|+|.+|......
T Consensus        78 ~~lYeCnIC~etS~e   92 (140)
T PF05290_consen   78 PKLYECNICKETSAE   92 (140)
T ss_pred             CCceeccCcccccch
Confidence            366777777765443


No 217
>KOG0402|consensus
Probab=26.71  E-value=25  Score=19.72  Aligned_cols=29  Identities=34%  Similarity=0.824  Sum_probs=15.1

Q ss_pred             ccCCCCCCcccccccccccccCCCCCceecCccccccc
Q psy12018         64 YQCPQCPYRTKQKELGWESLKPNAYGMYVCDICGKVYQ  101 (148)
Q Consensus        64 ~~C~~c~~~f~~~~~~~~~~~~~~~~~~~C~~c~~~f~  101 (148)
                      |.|+.||+.-.-.         .....|.|..|.+.+.
T Consensus        37 y~CsfCGK~~vKR---------~AvGiW~C~~C~kv~a   65 (92)
T KOG0402|consen   37 YTCSFCGKKTVKR---------KAVGIWKCGSCKKVVA   65 (92)
T ss_pred             hhhhhcchhhhhh---------hceeEEecCCccceec
Confidence            6777777632211         1223466666666553


No 218
>PF05129 Elf1:  Transcription elongation factor Elf1 like;  InterPro: IPR007808 This family of uncharacterised, mostly short, proteins contain a putative zinc binding domain with four conserved cysteines.; PDB: 1WII_A.
Probab=26.49  E-value=39  Score=18.86  Aligned_cols=10  Identities=30%  Similarity=1.222  Sum_probs=3.6

Q ss_pred             eecCcccccc
Q psy12018         91 YVCDICGKVY  100 (148)
Q Consensus        91 ~~C~~c~~~f  100 (148)
                      ..|..|+..|
T Consensus        47 ~~C~~Cg~~~   56 (81)
T PF05129_consen   47 LSCRVCGESF   56 (81)
T ss_dssp             EEESSS--EE
T ss_pred             EEecCCCCeE
Confidence            3444444443


No 219
>PF01215 COX5B:  Cytochrome c oxidase subunit Vb This family consists of chains F and S ;  InterPro: IPR002124 Cytochrome c oxidase (1.9.3.1 from EC) is an oligomeric enzymatic complex which is a component of the respiratory chain complex and is involved in the transfer of electrons from cytochrome c to oxygen []. In eukaryotes this enzyme complex is located in the mitochondrial inner membrane; in aerobic prokaryotes it is found in the plasma membrane.  In eukaryotes, in addition to the three large subunits, I, II and III, that form the catalytic centre of the enzyme complex, there are a variable number of small polypeptidic subunits. One of these subunits, which is known as Vb in mammals, V in Dictyostelium discoideum (Slime mold) and IV in yeast, binds a zinc atom. The sequence of subunit Vb is well conserved and includes three conserved cysteines that coordinate the zinc ion [, ]. Two of these cysteines are clustered in the C-terminal section of the subunit.; GO: 0004129 cytochrome-c oxidase activity, 0005740 mitochondrial envelope; PDB: 2EIL_S 2ZXW_S 3ASN_S 1OCO_S 3AG4_S 3ABK_S 1OCZ_S 1OCC_F 3ASO_S 3ABL_S ....
Probab=26.48  E-value=29  Score=21.59  Aligned_cols=16  Identities=19%  Similarity=0.463  Sum_probs=11.9

Q ss_pred             CCccccCccccccCCh
Q psy12018         32 YGKFACDVCGKEYQYY   47 (148)
Q Consensus        32 ~~~~~C~~C~~~f~~~   47 (148)
                      .++.+|..||..|.-.
T Consensus       110 g~~~RCpeCG~~fkL~  125 (136)
T PF01215_consen  110 GKPQRCPECGQVFKLK  125 (136)
T ss_dssp             TSEEEETTTEEEEEEE
T ss_pred             CCccCCCCCCeEEEEE
Confidence            4578899999887543


No 220
>COG4896 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=26.19  E-value=94  Score=16.39  Aligned_cols=7  Identities=43%  Similarity=1.341  Sum_probs=3.5

Q ss_pred             eecCccc
Q psy12018         91 YVCDICG   97 (148)
Q Consensus        91 ~~C~~c~   97 (148)
                      |-|++|.
T Consensus        32 ymC~eC~   38 (68)
T COG4896          32 YMCPECE   38 (68)
T ss_pred             EechhhH
Confidence            4455554


No 221
>PF09963 DUF2197:  Uncharacterized protein conserved in bacteria (DUF2197);  InterPro: IPR019241  This family represents various hypothetical bacterial proteins with no known function. 
Probab=25.99  E-value=38  Score=17.51  Aligned_cols=10  Identities=30%  Similarity=0.976  Sum_probs=6.0

Q ss_pred             ceeCCCChhh
Q psy12018        119 RFQCPQCPYR  128 (148)
Q Consensus       119 ~~~C~~C~~~  128 (148)
                      .|.|..|...
T Consensus        31 tYmC~eC~~R   40 (56)
T PF09963_consen   31 TYMCDECKER   40 (56)
T ss_pred             ceeChhHHHH
Confidence            4667776543


No 222
>TIGR00416 sms DNA repair protein RadA. The gene protuct codes for a probable ATP-dependent protease involved in both DNA repair and degradation of proteins, peptides, glycopeptides. Also known as sms. Residues 11-28 of the SEED alignment contain a putative Zn binding domain. Residues 110-117 of the seed contain a putative ATP binding site both documented in Haemophilus and in Listeria monocytogenes. for E.coli see ( J. BACTERIOL. 178:5045-5048(1996)).
Probab=25.96  E-value=46  Score=25.19  Aligned_cols=24  Identities=17%  Similarity=0.483  Sum_probs=16.6

Q ss_pred             CcccCCCCCCcccccccccccccCCCCCceecCcccc
Q psy12018         62 PRYQCPQCPYRTKQKELGWESLKPNAYGMYVCDICGK   98 (148)
Q Consensus        62 ~~~~C~~c~~~f~~~~~~~~~~~~~~~~~~~C~~c~~   98 (148)
                      ..|.|..||..             ...+-++|+.|+.
T Consensus         6 ~~y~C~~Cg~~-------------~~~~~g~Cp~C~~   29 (454)
T TIGR00416         6 SKFVCQHCGAD-------------SPKWQGKCPACHA   29 (454)
T ss_pred             CeEECCcCCCC-------------CccccEECcCCCC
Confidence            45999999963             1234478999973


No 223
>KOG1842|consensus
Probab=25.83  E-value=36  Score=25.64  Aligned_cols=25  Identities=24%  Similarity=0.321  Sum_probs=15.6

Q ss_pred             eecCccccccccchhHHhhHhhhhC
Q psy12018         91 YVCDICGKVYQHKRTLYRHKKDECG  115 (148)
Q Consensus        91 ~~C~~c~~~f~~~~~l~~H~~~~~~  115 (148)
                      |.|+.|...|.....|..|....+.
T Consensus        16 flCPiC~~dl~~~~~L~~H~d~eH~   40 (505)
T KOG1842|consen   16 FLCPICLLDLPNLSALNDHLDVEHF   40 (505)
T ss_pred             ccCchHhhhhhhHHHHHHHHhhhcc
Confidence            5666666666666666666655444


No 224
>PTZ00043 cytochrome c oxidase subunit; Provisional
Probab=25.80  E-value=36  Score=23.16  Aligned_cols=17  Identities=12%  Similarity=0.340  Sum_probs=12.3

Q ss_pred             CCCCccccCccccccCC
Q psy12018         30 KLYGKFACDVCGKEYQY   46 (148)
Q Consensus        30 ~~~~~~~C~~C~~~f~~   46 (148)
                      ...++.+|..||..|.-
T Consensus       177 rEGkpqRCpECGqVFKL  193 (268)
T PTZ00043        177 REGFLYRCGECDQIFML  193 (268)
T ss_pred             cCCCCccCCCCCcEEEE
Confidence            34567888888888754


No 225
>PRK05978 hypothetical protein; Provisional
Probab=25.80  E-value=43  Score=21.15  Aligned_cols=11  Identities=18%  Similarity=0.570  Sum_probs=6.1

Q ss_pred             cCCCCCCcccc
Q psy12018         65 QCPQCPYRTKQ   75 (148)
Q Consensus        65 ~C~~c~~~f~~   75 (148)
                      .|+.||..|..
T Consensus        54 ~C~~CG~~~~~   64 (148)
T PRK05978         54 HCAACGEDFTH   64 (148)
T ss_pred             CccccCCcccc
Confidence            46666655443


No 226
>PRK14714 DNA polymerase II large subunit; Provisional
Probab=25.72  E-value=58  Score=28.19  Aligned_cols=35  Identities=26%  Similarity=0.469  Sum_probs=16.5

Q ss_pred             ccCCCCCCcccccccccccccCCCCCceecCcccccc
Q psy12018         64 YQCPQCPYRTKQKELGWESLKPNAYGMYVCDICGKVY  100 (148)
Q Consensus        64 ~~C~~c~~~f~~~~~~~~~~~~~~~~~~~C~~c~~~f  100 (148)
                      +.|+.||...... .-.....++ ...|.|+.|+...
T Consensus       668 rkCPkCG~~t~~~-fCP~CGs~t-e~vy~CPsCGaev  702 (1337)
T PRK14714        668 RRCPSCGTETYEN-RCPDCGTHT-EPVYVCPDCGAEV  702 (1337)
T ss_pred             EECCCCCCccccc-cCcccCCcC-CCceeCccCCCcc
Confidence            6677777632111 111111111 2246788888653


No 227
>PF10537 WAC_Acf1_DNA_bd:  ATP-utilising chromatin assembly and remodelling N-terminal;  InterPro: IPR013136 ACF (for ATP-utilising chromatin assembly and remodeling factor) is a chromatin-remodeling complex that catalyzes the ATP-dependent assembly of periodic nucleosome arrays. This reaction utilises the energy of ATP hydrolysis by ISWI, the smaller of the two subunits of ACF. Acf1, the large subunit of ACF, is essential for the full activity of the complex. The WAC (WSTF/Acf1/cbp146) domain is an ~110-residue module present at the N-termini of Acf1-related proteins in a variety of organisms. It is found in association with other domains such as the bromodomain, the PHD-type zinc finger, DDT or WAKS. The DNA-binding region of Acf1 includes the WAC domain, which is necessary for the efficient binding of ACF complex to DNA. It seems probable that the WAC domain will be involved in DNA binding in other related factors [, ].   Some proteins known to contain a WAC domain are the Drosophila melanogaster (Fruit fly) ATP-dependent chromatin assembly factor large subunit Acf1, human WSTF (Williams syndrome transcription factor), mouse cbp146, yeast imitation switch two complex protein 1 (ITC1 or YGL133w), and yeast protein YPL216w. 
Probab=25.52  E-value=21  Score=20.92  Aligned_cols=35  Identities=11%  Similarity=0.246  Sum_probs=14.7

Q ss_pred             cccCccccccCChhHHhcccccccCCCCcccCCCCCC
Q psy12018         35 FACDVCGKEYQYYRNLYRHKKFECGQEPRYQCPQCPY   71 (148)
Q Consensus        35 ~~C~~C~~~f~~~~~l~~h~~~~~~~~~~~~C~~c~~   71 (148)
                      |.|+.-+..|.+.......+....  .+.+.|...|+
T Consensus         4 f~i~~T~EiF~dYe~Y~~R~~~y~--~~vwtC~~TGk   38 (102)
T PF10537_consen    4 FYIPFTGEIFRDYEEYLKRMILYN--QRVWTCEITGK   38 (102)
T ss_pred             EEeCCCCcccCCHHHHHHHHHHHh--CCeeEEecCCC
Confidence            334444445555444443333322  23344544443


No 228
>PF04780 DUF629:  Protein of unknown function (DUF629);  InterPro: IPR006865 This domain represents a region of several plant proteins of unknown function. A C2H2 zinc finger is predicted in this region in some family members, but the spacing between the cysteine residues is not conserved throughout the family.
Probab=25.33  E-value=56  Score=24.93  Aligned_cols=14  Identities=29%  Similarity=0.888  Sum_probs=7.9

Q ss_pred             ccCCCCCCcccccc
Q psy12018         64 YQCPQCPYRTKQKE   77 (148)
Q Consensus        64 ~~C~~c~~~f~~~~   77 (148)
                      ..|+.|.+.|.+..
T Consensus        58 WiCp~CskkF~d~~   71 (466)
T PF04780_consen   58 WICPRCSKKFSDAE   71 (466)
T ss_pred             eeCCcccceeCCHH
Confidence            45666666555543


No 229
>PF04810 zf-Sec23_Sec24:  Sec23/Sec24 zinc finger;  InterPro: IPR006895 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  COPII (coat protein complex II)-coated vesicles carry proteins from the endoplasmic reticulum (ER) to the Golgi complex []. COPII-coated vesicles form on the ER by the stepwise recruitment of three cytosolic components: Sar1-GTP to initiate coat formation, Sec23/24 heterodimer to select SNARE and cargo molecules, and Sec13/31 to induce coat polymerisation and membrane deformation [].  Sec23 p and Sec24p are structurally related, folding into five distinct domains: a beta-barrel, a zinc-finger, an alpha/beta trunk domain (IPR006896 from INTERPRO), an all-helical region (IPR006900 from INTERPRO), and a C-terminal gelsolin-like domain (IPR007123 from INTERPRO). This entry describes an approximately 55-residue Sec23/24 zinc-binding domain, which lies against the beta-barrel at the periphery of the complex. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0006886 intracellular protein transport, 0006888 ER to Golgi vesicle-mediated transport, 0030127 COPII vesicle coat; PDB: 3EFO_B 3EG9_B 3EGD_A 2YRC_A 2NUP_A 2YRD_A 3EGX_A 2NUT_A 3EH1_A 1PD0_A ....
Probab=25.28  E-value=67  Score=15.04  Aligned_cols=8  Identities=38%  Similarity=1.638  Sum_probs=3.2

Q ss_pred             ceecCccc
Q psy12018         90 MYVCDICG   97 (148)
Q Consensus        90 ~~~C~~c~   97 (148)
                      .|.|..|+
T Consensus        24 ~w~C~~C~   31 (40)
T PF04810_consen   24 TWICNFCG   31 (40)
T ss_dssp             EEEETTT-
T ss_pred             EEECcCCC
Confidence            34444444


No 230
>PF15616 TerY-C:  TerY-C metal binding domain
Probab=24.99  E-value=74  Score=19.69  Aligned_cols=8  Identities=38%  Similarity=1.219  Sum_probs=4.7

Q ss_pred             cCCCCCCc
Q psy12018         65 QCPQCPYR   72 (148)
Q Consensus        65 ~C~~c~~~   72 (148)
                      .||.||..
T Consensus        79 gCP~CGn~   86 (131)
T PF15616_consen   79 GCPHCGNQ   86 (131)
T ss_pred             CCCCCcCh
Confidence            46666654


No 231
>smart00249 PHD PHD zinc finger. The plant homeodomain (PHD) finger is a C4HC3 zinc-finger-like motif found in nuclear proteins thought to be involved in epigenetics and chromatin-mediated transcriptional regulation. The PHD finger binds two zinc ions using the so-called 'cross-brace' motif and is thus structurally related to the PRK11823 DNA repair protein RadA; Provisional
Probab=24.65  E-value=52  Score=24.86  Aligned_cols=24  Identities=25%  Similarity=0.620  Sum_probs=16.6

Q ss_pred             CcccCCCCCCcccccccccccccCCCCCceecCcccc
Q psy12018         62 PRYQCPQCPYRTKQKELGWESLKPNAYGMYVCDICGK   98 (148)
Q Consensus        62 ~~~~C~~c~~~f~~~~~~~~~~~~~~~~~~~C~~c~~   98 (148)
                      ..|.|..||..             ...+-++|+.|+.
T Consensus         6 ~~y~C~~Cg~~-------------~~~~~g~Cp~C~~   29 (446)
T PRK11823          6 TAYVCQECGAE-------------SPKWLGRCPECGA   29 (446)
T ss_pred             CeEECCcCCCC-------------CcccCeeCcCCCC
Confidence            46999999963             2234468999974


No 233
>PF10083 DUF2321:  Uncharacterized protein conserved in bacteria (DUF2321);  InterPro: IPR016891 This entry is represented by Bacteriophage 'Lactobacillus prophage Lj928', Orf-Ljo1454. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches. There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function.
Probab=24.33  E-value=59  Score=20.75  Aligned_cols=18  Identities=28%  Similarity=0.534  Sum_probs=12.1

Q ss_pred             CCceecCccccccccchh
Q psy12018         88 YGMYVCDICGKVYQHKRT  105 (148)
Q Consensus        88 ~~~~~C~~c~~~f~~~~~  105 (148)
                      +.|.=|..||+.|+|-..
T Consensus        66 ~~PsYC~~CGkpyPWt~~   83 (158)
T PF10083_consen   66 EAPSYCHNCGKPYPWTEN   83 (158)
T ss_pred             CCChhHHhCCCCCchHHH
Confidence            456667778888777543


No 234
>KOG0717|consensus
Probab=23.65  E-value=47  Score=25.25  Aligned_cols=21  Identities=29%  Similarity=0.437  Sum_probs=18.6

Q ss_pred             eeCCCChhhhhchHHHHHHHH
Q psy12018        120 FQCPQCPYRAKQKANLKTHLI  140 (148)
Q Consensus       120 ~~C~~C~~~f~~~~~l~~H~~  140 (148)
                      +-|.+|.+.|.+--.|..|..
T Consensus       293 lyC~vCnKsFKseKq~kNHEn  313 (508)
T KOG0717|consen  293 LYCVVCNKSFKSEKQLKNHEN  313 (508)
T ss_pred             eEEeeccccccchHHHHhhHH
Confidence            789999999999999988875


No 235
>smart00731 SprT SprT homologues. Predicted to have roles in transcription elongation. Contains a conserved HExxH motif, indicating a metalloprotease function.
Probab=23.64  E-value=74  Score=19.77  Aligned_cols=32  Identities=25%  Similarity=0.692  Sum_probs=17.1

Q ss_pred             ceecCccccccccchhHHhhHhhhhCCCCceeCCCChhhh
Q psy12018         90 MYVCDICGKVYQHKRTLYRHKKDECGQEPRFQCPQCPYRA  129 (148)
Q Consensus        90 ~~~C~~c~~~f~~~~~l~~H~~~~~~~~~~~~C~~C~~~f  129 (148)
                      .|.|..|+..+..      +.+...  -..|.|..|+..+
T Consensus       112 ~y~C~~C~~~~~~------~rr~~~--~~~y~C~~C~g~l  143 (146)
T smart00731      112 PYRCTGCGQRYLR------VRRSNN--VSRYRCGKCGGKL  143 (146)
T ss_pred             EEECCCCCCCCce------EccccC--cceEEcCCCCCEE
Confidence            5777777765532      222111  1347787777554


No 236
>TIGR00515 accD acetyl-CoA carboxylase, carboxyl transferase, beta subunit. The enzyme acetyl-CoA carboxylase contains a biotin carboxyl carrier protein or domain, a biotin carboxylase, and a carboxyl transferase. This model represents the beta chain of the carboxyl transferase for cases in which the architecture of the protein is as in E. coli, in which the carboxyltransferase portion consists of two non-identical subnits, alpha and beta.
Probab=23.59  E-value=39  Score=23.90  Aligned_cols=33  Identities=21%  Similarity=0.417  Sum_probs=20.3

Q ss_pred             ccccCccccccCChhHHhcccccccCCCCcccCCCCCCccccc
Q psy12018         34 KFACDVCGKEYQYYRNLYRHKKFECGQEPRYQCPQCPYRTKQK   76 (148)
Q Consensus        34 ~~~C~~C~~~f~~~~~l~~h~~~~~~~~~~~~C~~c~~~f~~~   76 (148)
                      -.+|+.|+.....+. |.         +..+.|+.|+..|.-.
T Consensus        26 ~~~c~~c~~~~~~~~-l~---------~~~~vc~~c~~h~rl~   58 (285)
T TIGR00515        26 WTKCPKCGQVLYTKE-LE---------RNLEVCPKCDHHMRMD   58 (285)
T ss_pred             eeECCCCcchhhHHH-HH---------hhCCCCCCCCCcCcCC
Confidence            356888888755432 22         2236788888776643


No 237
>PF14787 zf-CCHC_5:  GAG-polyprotein viral zinc-finger; PDB: 1CL4_A 1DSV_A.
Probab=23.56  E-value=39  Score=15.67  Aligned_cols=14  Identities=29%  Similarity=0.786  Sum_probs=6.9

Q ss_pred             ecCccccccccchh
Q psy12018         92 VCDICGKVYQHKRT  105 (148)
Q Consensus        92 ~C~~c~~~f~~~~~  105 (148)
                      .|+.|++.|.+.+.
T Consensus         4 ~CprC~kg~Hwa~~   17 (36)
T PF14787_consen    4 LCPRCGKGFHWASE   17 (36)
T ss_dssp             C-TTTSSSCS-TTT
T ss_pred             cCcccCCCcchhhh
Confidence            36666666655443


No 238
>PLN02748 tRNA dimethylallyltransferase
Probab=23.54  E-value=54  Score=25.01  Aligned_cols=24  Identities=13%  Similarity=0.289  Sum_probs=19.7

Q ss_pred             CceeCCCChh-hhhchHHHHHHHHh
Q psy12018        118 PRFQCPQCPY-RAKQKANLKTHLII  141 (148)
Q Consensus       118 ~~~~C~~C~~-~f~~~~~l~~H~~~  141 (148)
                      +.|.|..|++ .+.....|..|++.
T Consensus       417 ~~~~Ce~C~~~~~~G~~eW~~Hlks  441 (468)
T PLN02748        417 TQYVCEACGNKVLRGAHEWEQHKQG  441 (468)
T ss_pred             ccccccCCCCcccCCHHHHHHHhcc
Confidence            4578999997 79888899888853


No 239
>PF04606 Ogr_Delta:  Ogr/Delta-like zinc finger;  InterPro: IPR007684 This entry is represented by Bacteriophage P2, Ogr. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches. This is a viral family of phage zinc-binding transcriptional activators, which also contains cryptic members in some bacterial genomes []. The P4 phage delta protein contains two such domains attached covalently, while the P2 phage Ogr proteins possess one domain but function as dimers. All the members of this family have the following consensus sequence: C-X(2)-C-X(3)-A-(X)2-R-X(15)-C-X(4)-C-X(3)-F [].; GO: 0006355 regulation of transcription, DNA-dependent
Probab=23.54  E-value=19  Score=17.64  Aligned_cols=7  Identities=43%  Similarity=1.473  Sum_probs=3.7

Q ss_pred             CCCCCCc
Q psy12018         66 CPQCPYR   72 (148)
Q Consensus        66 C~~c~~~   72 (148)
                      ||.||..
T Consensus         2 CP~Cg~~    8 (47)
T PF04606_consen    2 CPHCGSK    8 (47)
T ss_pred             cCCCCCe
Confidence            5555543


No 240
>PRK00762 hypA hydrogenase nickel incorporation protein; Provisional
Probab=23.34  E-value=47  Score=20.16  Aligned_cols=13  Identities=31%  Similarity=0.552  Sum_probs=6.9

Q ss_pred             CccccCccccccCC
Q psy12018         33 GKFACDVCGKEYQY   46 (148)
Q Consensus        33 ~~~~C~~C~~~f~~   46 (148)
                      ....| .|+..|..
T Consensus        69 ~~~~C-~Cg~~~~~   81 (124)
T PRK00762         69 VEIEC-ECGYEGVV   81 (124)
T ss_pred             eeEEe-eCcCcccc
Confidence            34556 66655443


No 241
>COG4306 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=22.84  E-value=55  Score=20.01  Aligned_cols=16  Identities=19%  Similarity=0.438  Sum_probs=10.9

Q ss_pred             CCceecCccccccccc
Q psy12018         88 YGMYVCDICGKVYQHK  103 (148)
Q Consensus        88 ~~~~~C~~c~~~f~~~  103 (148)
                      +-|--|..||+.|.|-
T Consensus        66 e~psfchncgs~fpwt   81 (160)
T COG4306          66 EPPSFCHNCGSRFPWT   81 (160)
T ss_pred             CCcchhhcCCCCCCcH
Confidence            3445577888888774


No 242
>PF10263 SprT-like:  SprT-like family;  InterPro: IPR006640 This is a family of uncharacterised bacterial proteins which includes Escherichia coli SprT (P39902 from SWISSPROT). SprT is described as a regulator of bolA gene in stationary phase []. The majority of members contain the metallopeptidase zinc binding signature which has a HExxH motif, however there is no evidence for them being metallopeptidases. 
Probab=22.67  E-value=37  Score=21.15  Aligned_cols=32  Identities=25%  Similarity=0.783  Sum_probs=18.3

Q ss_pred             ceecCccccccccchhHHhhHhhhhCCCCceeCCCChhhhh
Q psy12018         90 MYVCDICGKVYQHKRTLYRHKKDECGQEPRFQCPQCPYRAK  130 (148)
Q Consensus        90 ~~~C~~c~~~f~~~~~l~~H~~~~~~~~~~~~C~~C~~~f~  130 (148)
                      .|.|..|+..+...      .+.  . ...|.|..|+..|.
T Consensus       123 ~~~C~~C~~~~~r~------~~~--~-~~~~~C~~C~~~l~  154 (157)
T PF10263_consen  123 VYRCPSCGREYKRH------RRS--K-RKRYRCGRCGGPLV  154 (157)
T ss_pred             EEEcCCCCCEeeee------ccc--c-hhhEECCCCCCEEE
Confidence            46788888665332      222  1 23477888875543


No 243
>PLN03238 probable histone acetyltransferase MYST; Provisional
Probab=22.51  E-value=81  Score=22.40  Aligned_cols=24  Identities=25%  Similarity=0.459  Sum_probs=16.1

Q ss_pred             CCceeCCCChhhhhchHHHHHHHH
Q psy12018        117 EPRFQCPQCPYRAKQKANLKTHLI  140 (148)
Q Consensus       117 ~~~~~C~~C~~~f~~~~~l~~H~~  140 (148)
                      ..-|.|..|-+-|.+...|.+|+.
T Consensus        46 ~~lyiCe~Clky~~~~~~l~~H~~   69 (290)
T PLN03238         46 TKLYICEYCLKYMRKKKSLLRHLA   69 (290)
T ss_pred             CeEEEcCCCcchhCCHHHHHHHHH
Confidence            345677777777777777777765


No 244
>PF02748 PyrI_C:  Aspartate carbamoyltransferase regulatory chain, metal binding domain;  InterPro: IPR020542 Aspartate carbamoyltransferase (aspartate transcarbamylase, ATCase) 2.1.3.2 from EC is an allosteric enzyme that plays a central role in the regulation of the pyrimidine pathway in bacteria. The holoenzyme is a dodecamer composed of six catalytic chains, each with an active site, and six regulatory chains lacking catalytic activity []. The catalytic subunits exist as a dimer of catalytic trimers, (c3)2, while the regulatory subunits exist as a trimer of regulatory dimers, (r2)3, therefore the complete holoenzyme can be represented as (c3)2(r2)3. The association of the catalytic subunits c3 with the regulatory subunits r2 is responsible for the establishment of positive co-operativity between catalytic sites for the binding of aspartate and it dictates the pattern of allosteric response toward nucleotide effectors. ATCase from Escherichia coli is the most extensively studied allosteric enzyme []. The crystal structure of the T-state, the T-state with CTP bound, the R-state with N-phosphonacetyl-L-aspartate (PALA) bound, and the R-state with phosphonoacetamide plus malonate bound have been used in interpreting kinetic and mutational studies. A high-resolution structure of E. coli ATCase in the presence of PALA (a bisubstrate analog) allows a detailed description of the binding at the active site of the enzyme and allows a detailed model of the tetrahedral intermediate to be constructed. The entire regulatory chain has been traced showing that the N-terminal regions of the regulatory chains R1 and R6 are located in close proximity to each other and to the regulatory site. This portion of the molecule may be involved in the observed asymmetry between the regulatory binding sites as well as in the heterotropic response of the enzyme []. The C-terminal domain of the regulatory chains have a rubredoxin-like zinc-bound fold.  ATCase from Enterobacter agglomerans (Erwinia herbicola) (Pantoea agglomerans) differs from the other investigated enterobacterial ATCases by its absence of homotropic co-operativity toward the substrate aspartate and its lack of response to ATP which is an allosteric effector (activator) of this family of enzymes. Nevertheless, the E. herbicola ATCase has the same quaternary structure, two trimers of catalytic chains with three dimers of regulatory chains, (c3)2(r2)3, as other enterobacterial ATCases and shows extensive primary structure conservation [].  This entry represents the C-terminal domain.; PDB: 2YWW_B 1SKU_D 1Q95_L 8ATC_B 3AT1_D 1RAI_D 4E2F_D 1NBE_B 6AT1_B 2FZC_D ....
Probab=22.37  E-value=52  Score=16.63  Aligned_cols=17  Identities=12%  Similarity=0.338  Sum_probs=10.5

Q ss_pred             CCCCceecCcccccccc
Q psy12018         86 NAYGMYVCDICGKVYQH  102 (148)
Q Consensus        86 ~~~~~~~C~~c~~~f~~  102 (148)
                      .....|+|.+|++.+..
T Consensus        31 ~~~~~~rC~YCe~~~~~   47 (52)
T PF02748_consen   31 KEPIKLRCHYCERIITE   47 (52)
T ss_dssp             TTTCEEEETTT--EEEH
T ss_pred             CCCCEEEeeCCCCEecc
Confidence            34556889999887754


No 245
>PF00412 LIM:  LIM domain;  InterPro: IPR001781 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents LIM-type zinc finger (Znf) domains. LIM domains coordinate one or more zinc atoms, and are named after the three proteins (LIN-11, Isl1 and MEC-3) in which they were first found. They consist of two zinc-binding motifs that resemble GATA-like Znf's, however the residues holding the zinc atom(s) are variable, involving Cys, His, Asp or Glu residues. LIM domains are involved in proteins with differing functions, including gene expression, and cytoskeleton organisation and development [, ]. Protein containing LIM Znf domains include:    Caenorhabditis elegans mec-3; a protein required for the differentiation of the set of six touch receptor neurons in this nematode. C. elegans. lin-11; a protein required for the asymmetric division of vulval blast cells. Vertebrate insulin gene enhancer binding protein isl-1. Isl-1 binds to one of the two cis-acting protein-binding domains of the insulin gene. Vertebrate homeobox proteins lim-1, lim-2 (lim-5) and lim3. Vertebrate lmx-1, which acts as a transcriptional activator by binding to the FLAT element; a beta-cell-specific transcriptional enhancer found in the insulin gene. Mammalian LH-2, a transcriptional regulatory protein involved in the control of cell differentiation in developing lymphoid and neural cell types.  Drosophila melanogaster (Fruit fly) protein apterous, required for the normal development of the wing and halter imaginal discs. Vertebrate protein kinases LIMK-1 and LIMK-2. Mammalian rhombotins. Rhombotin 1 (RBTN1 or TTG-1) and rhombotin-2 (RBTN2 or TTG-2) are proteins of about 160 amino acids whose genes are disrupted by chromosomal translocations in T-cell leukemia. Mammalian and avian cysteine-rich protein (CRP), a 192 amino-acid protein of unknown function. Seems to interact with zyxin. Mammalian cysteine-rich intestinal protein (CRIP), a small protein which seems to have a role in zinc absorption and may function as an intracellular zinc transport protein. Vertebrate paxillin, a cytoskeletal focal adhesion protein.  Mus musculus (Mouse) testin which should not be confused with rat testin which is a thiol protease homologue (see IPR000169 from INTERPRO).  Helianthus annuus (Common sunflower) pollen specific protein SF3. Chicken zyxin. Zyxin is a low-abundance adhesion plaque protein which has been shown to interact with CRP. Yeast protein LRG1 which is involved in sporulation [].  Saccharomyces cerevisiae (Baker's yeast) rho-type GTPase activating protein RGA1/DBM1. C. elegans homeobox protein ceh-14. C. elegans homeobox protein unc-97. S. cerevisiae hypothetical protein YKR090w. C. elegans hypothetical proteins C28H8.6.   These proteins generally contain two tandem copies of the LIM domain in their N-terminal section. Zyxin and paxillin are exceptions in that they contain respectively three and four LIM domains at their C-terminal extremity. In apterous, isl-1, LH-2, lin-11, lim-1 to lim-3, lmx-1 and ceh-14 and mec-3 there is a homeobox domain some 50 to 95 amino acids after the LIM domains. LIM domains contain seven conserved cysteine residues and a histidine. The arrangement followed by these conserved residues is:  C-x(2)-C-x(16,23)-H-x(2)-[CH]-x(2)-C-x(2)-C-x(16,21)-C-x(2,3)-[CHD]  LIM domains bind two zinc ions []. LIM does not bind DNA, rather it seems to act as an interface for protein-protein interaction. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 2CO8_A 2EGQ_A 2CUR_A 3IXE_B 1CTL_A 1B8T_A 1X62_A 2DFY_C 1IML_A 2CUQ_A ....
Probab=22.25  E-value=59  Score=16.12  Aligned_cols=12  Identities=17%  Similarity=0.672  Sum_probs=5.6

Q ss_pred             cccCCCCCCccc
Q psy12018         63 RYQCPQCPYRTK   74 (148)
Q Consensus        63 ~~~C~~c~~~f~   74 (148)
                      -|.|..|++.+.
T Consensus        26 Cf~C~~C~~~l~   37 (58)
T PF00412_consen   26 CFKCSKCGKPLN   37 (58)
T ss_dssp             TSBETTTTCBTT
T ss_pred             ccccCCCCCccC
Confidence            344555554443


No 246
>PRK00420 hypothetical protein; Validated
Probab=22.01  E-value=61  Score=19.42  Aligned_cols=9  Identities=56%  Similarity=1.040  Sum_probs=4.7

Q ss_pred             eecCccccc
Q psy12018         91 YVCDICGKV   99 (148)
Q Consensus        91 ~~C~~c~~~   99 (148)
                      ..|+.|+..
T Consensus        41 ~~Cp~Cg~~   49 (112)
T PRK00420         41 VVCPVHGKV   49 (112)
T ss_pred             eECCCCCCe
Confidence            445555543


No 247
>COG1327 Predicted transcriptional regulator, consists of a Zn-ribbon and ATP-cone domains [Transcription]
Probab=21.96  E-value=40  Score=21.36  Aligned_cols=13  Identities=23%  Similarity=0.444  Sum_probs=8.1

Q ss_pred             ccCCCCCCccccc
Q psy12018         64 YQCPQCPYRTKQK   76 (148)
Q Consensus        64 ~~C~~c~~~f~~~   76 (148)
                      =.|+.|+..|.+-
T Consensus        29 ReC~~C~~RFTTf   41 (156)
T COG1327          29 RECLECGERFTTF   41 (156)
T ss_pred             hcccccccccchh
Confidence            3466677666664


No 248
>KOG3507|consensus
Probab=21.81  E-value=74  Score=16.62  Aligned_cols=12  Identities=33%  Similarity=0.897  Sum_probs=7.7

Q ss_pred             ceeCCCChhhhh
Q psy12018        119 RFQCPQCPYRAK  130 (148)
Q Consensus       119 ~~~C~~C~~~f~  130 (148)
                      +++|.+||....
T Consensus        37 ~irCReCG~RIl   48 (62)
T KOG3507|consen   37 VIRCRECGYRIL   48 (62)
T ss_pred             cEehhhcchHHH
Confidence            567777776543


No 249
>PRK14892 putative transcription elongation factor Elf1; Provisional
Probab=21.77  E-value=91  Score=18.23  Aligned_cols=9  Identities=44%  Similarity=1.136  Sum_probs=4.3

Q ss_pred             CccccCccc
Q psy12018         33 GKFACDVCG   41 (148)
Q Consensus        33 ~~~~C~~C~   41 (148)
                      ..|.|+.|+
T Consensus        20 t~f~CP~Cg   28 (99)
T PRK14892         20 KIFECPRCG   28 (99)
T ss_pred             cEeECCCCC
Confidence            344455554


No 250
>KOG2272|consensus
Probab=21.64  E-value=1.1e+02  Score=21.30  Aligned_cols=13  Identities=23%  Similarity=0.565  Sum_probs=8.0

Q ss_pred             ceeCCCChhhhhc
Q psy12018        119 RFQCPQCPYRAKQ  131 (148)
Q Consensus       119 ~~~C~~C~~~f~~  131 (148)
                      .|.|..|.+-|--
T Consensus       221 HFvCa~CekPFlG  233 (332)
T KOG2272|consen  221 HFVCAKCEKPFLG  233 (332)
T ss_pred             heeehhcCCcccc
Confidence            4667666666643


No 251
>PF03145 Sina:  Seven in absentia protein family;  InterPro: IPR018121 The seven in absentia (sina) gene was first identified in Drosophila. The Drosophila Sina protein is essential for the determination of the R7 pathway in photoreceptor cell development: the loss of functional Sina results in the transformation of the R7 precursor cell to a non-neuronal cell type. The Sina protein contains an N-terminal RING finger domain C3HC4-type. Through this domain, Sina binds E2 ubiquitin-conjugating enzymes (UbcD1) Sina also interacts with Tramtrack (TTK88) via PHYL. Tramtrack is a transcriptional repressor that blocks photoreceptor determination, while PHYL down-regulates the activity of TTK88. In turn, the activity of PHYL requires the activation of the Sevenless receptor tyrosine kinase, a process essential for R7 determination. It is thought that Sina targets TTK88 for degradation, therefore promoting the R7 pathway. Murine and human homologues of Sina have also been identified. The human homologue Siah-1 [] also binds E2 enzymes (UbcH5) and through a series of physical interactions, targets beta-catenin for ubiquitin degradation. Siah-1 expression is enhanced by p53, itself promoted by DNA damage. Thus this pathway links DNA damage to beta-catenin degradation [, ]. Sina proteins, therefore, physically interact with a variety of proteins. The N-terminal RING finger domain that binds ubiquitin conjugating enzymes is a C3HC4-type, and does not form part of the alignment for this family. The remainder C-terminal part is involved in interactions with other proteins, and is included in this alignment. In addition to the Drosophila protein and mammalian homologues, whose similarity was noted previously, this family also includes putative homologues from Caenorhabditis elegans, Arabidopsis thaliana.; GO: 0006511 ubiquitin-dependent protein catabolic process, 0007275 multicellular organismal development, 0005634 nucleus; PDB: 2A25_A 1K2F_B 2AN6_C.
Probab=21.59  E-value=94  Score=20.40  Aligned_cols=12  Identities=42%  Similarity=0.362  Sum_probs=5.7

Q ss_pred             HHHHHHHhhcCC
Q psy12018        134 NLKTHLIIKHDS  145 (148)
Q Consensus       134 ~l~~H~~~~h~~  145 (148)
                      .|..|....|..
T Consensus        62 ~l~~Hl~~~H~~   73 (198)
T PF03145_consen   62 ELLDHLRDKHSW   73 (198)
T ss_dssp             CHHHHHHHHTTT
T ss_pred             HHHHHHHHHCCC
Confidence            444555544443


No 252
>PF14446 Prok-RING_1:  Prokaryotic RING finger family 1
Probab=21.26  E-value=33  Score=17.60  Aligned_cols=10  Identities=40%  Similarity=1.019  Sum_probs=4.4

Q ss_pred             cCCCCCCccc
Q psy12018         65 QCPQCPYRTK   74 (148)
Q Consensus        65 ~C~~c~~~f~   74 (148)
                      .|+.|++.|.
T Consensus         7 ~C~~Cg~~~~   16 (54)
T PF14446_consen    7 KCPVCGKKFK   16 (54)
T ss_pred             cChhhCCccc
Confidence            3444444443


No 253
>PRK04351 hypothetical protein; Provisional
Probab=21.12  E-value=51  Score=20.81  Aligned_cols=32  Identities=31%  Similarity=0.818  Sum_probs=18.8

Q ss_pred             ceecCccccccccchhHHhhHhhhhCCCCceeCCCChhhhh
Q psy12018         90 MYVCDICGKVYQHKRTLYRHKKDECGQEPRFQCPQCPYRAK  130 (148)
Q Consensus        90 ~~~C~~c~~~f~~~~~l~~H~~~~~~~~~~~~C~~C~~~f~  130 (148)
                      .|.|..|+..+...       +.+.  ...|.|..|+..+.
T Consensus       112 ~Y~C~~Cg~~~~r~-------Rr~n--~~~yrCg~C~g~L~  143 (149)
T PRK04351        112 LYECQSCGQQYLRK-------RRIN--TKRYRCGKCRGKLK  143 (149)
T ss_pred             EEECCCCCCEeeee-------eecC--CCcEEeCCCCcEee
Confidence            37888888655432       1121  34588888876554


No 254
>COG4640 Predicted membrane protein [Function unknown]
Probab=20.68  E-value=78  Score=23.61  Aligned_cols=13  Identities=31%  Similarity=0.695  Sum_probs=7.2

Q ss_pred             ccCCCCCCccccc
Q psy12018         64 YQCPQCPYRTKQK   76 (148)
Q Consensus        64 ~~C~~c~~~f~~~   76 (148)
                      ..|++||..|...
T Consensus        16 ~qC~qCG~~~t~~   28 (465)
T COG4640          16 VQCTQCGHKFTSR   28 (465)
T ss_pred             ccccccCCcCCch
Confidence            3466666655554


No 255
>CHL00174 accD acetyl-CoA carboxylase beta subunit; Reviewed
Probab=20.20  E-value=49  Score=23.56  Aligned_cols=32  Identities=25%  Similarity=0.361  Sum_probs=19.8

Q ss_pred             cccCccccccCChhHHhcccccccCCCCcccCCCCCCccccc
Q psy12018         35 FACDVCGKEYQYYRNLYRHKKFECGQEPRYQCPQCPYRTKQK   76 (148)
Q Consensus        35 ~~C~~C~~~f~~~~~l~~h~~~~~~~~~~~~C~~c~~~f~~~   76 (148)
                      .+|+.|+.....+. |.         +..+.|+.|+..|.-.
T Consensus        39 ~kc~~C~~~~~~~~-l~---------~~~~vcp~c~~h~rlt   70 (296)
T CHL00174         39 VQCENCYGLNYKKF-LK---------SKMNICEQCGYHLKMS   70 (296)
T ss_pred             eECCCccchhhHHH-HH---------HcCCCCCCCCCCcCCC
Confidence            46888887654432 21         2346788888766643


No 256
>PF07295 DUF1451:  Protein of unknown function (DUF1451);  InterPro: IPR009912 This family consists of several hypothetical bacterial proteins of around 160 residues in length. Members of this family contain four highly conserved cysteine resides toward the C-terminal region of the protein. The function of this family is unknown.
Probab=20.10  E-value=24  Score=22.18  Aligned_cols=12  Identities=42%  Similarity=0.957  Sum_probs=7.3

Q ss_pred             CCceecCccccc
Q psy12018         88 YGMYVCDICGKV   99 (148)
Q Consensus        88 ~~~~~C~~c~~~   99 (148)
                      .+.|.|..||..
T Consensus       110 ~G~l~C~~Cg~~  121 (146)
T PF07295_consen  110 PGTLVCENCGHE  121 (146)
T ss_pred             CceEecccCCCE
Confidence            345677777644


No 257
>KOG4727|consensus
Probab=20.02  E-value=67  Score=20.85  Aligned_cols=24  Identities=29%  Similarity=0.472  Sum_probs=19.9

Q ss_pred             CCCccccCccccccCChhHHhccc
Q psy12018         31 LYGKFACDVCGKEYQYYRNLYRHK   54 (148)
Q Consensus        31 ~~~~~~C~~C~~~f~~~~~l~~h~   54 (148)
                      ....|-|++|.-+|....++..|+
T Consensus        72 q~~GyyCdVCdcvvKDSinflDHi   95 (193)
T KOG4727|consen   72 QKGGYYCDVCDCVVKDSINFLDHI   95 (193)
T ss_pred             ccCceeeeecceeehhhHHHHHHh
Confidence            345689999999999888888886


Done!