Query         psy12019
Match_columns 87
No_of_seqs    122 out of 1610
Neff          11.7
Searched_HMMs 46136
Date          Fri Aug 16 16:34:09 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy12019.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/12019hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG2462|consensus               99.9 2.9E-23 6.4E-28  111.2   3.6   83    2-85    144-238 (279)
  2 KOG2462|consensus               99.9   5E-23 1.1E-27  110.3   2.5   78    3-83    176-264 (279)
  3 KOG1074|consensus               99.7 8.8E-19 1.9E-23  105.1   2.1   53   32-85    604-656 (958)
  4 KOG3623|consensus               99.7 2.3E-17   5E-22   98.4   1.5   70   13-83    891-971 (1007)
  5 KOG1074|consensus               99.7   5E-17 1.1E-21   97.8   2.3   53   34-87    880-932 (958)
  6 KOG3623|consensus               99.5 1.7E-15 3.6E-20   90.7   1.5   70   13-83    237-330 (1007)
  7 KOG3576|consensus               99.5 9.7E-16 2.1E-20   79.9   0.4   75   12-87    113-198 (267)
  8 PHA00733 hypothetical protein   99.5 2.1E-14 4.6E-19   71.1   2.4   73   12-87     36-124 (128)
  9 PHA02768 hypothetical protein;  99.4 8.8E-14 1.9E-18   58.7   2.0   44   33-79      5-48  (55)
 10 KOG3608|consensus               99.4   3E-13 6.5E-18   75.7   1.9   83    2-85    193-315 (467)
 11 KOG3576|consensus               99.2 5.8E-12 1.2E-16   66.0   0.2   82    4-86    133-236 (267)
 12 PF13465 zf-H2C2_2:  Zinc-finge  99.1   4E-11 8.6E-16   43.8   1.9   26   48-74      1-26  (26)
 13 PF13465 zf-H2C2_2:  Zinc-finge  99.1 7.7E-12 1.7E-16   45.8  -1.3   25    3-27      1-25  (26)
 14 KOG3608|consensus               98.9   5E-10 1.1E-14   63.1   2.0   85    2-86    277-376 (467)
 15 PHA00732 hypothetical protein   98.9 2.2E-09 4.8E-14   49.1   2.6   45   33-84      1-46  (79)
 16 PHA00616 hypothetical protein   98.8 2.9E-09 6.2E-14   43.1   0.9   26   62-87      1-26  (44)
 17 PHA00616 hypothetical protein   98.7   5E-09 1.1E-13   42.4   1.5   34   33-67      1-34  (44)
 18 KOG3993|consensus               98.7 1.7E-09 3.6E-14   62.2  -0.2   71   16-86    267-380 (500)
 19 PHA02768 hypothetical protein;  98.6 3.1E-08 6.7E-13   42.0   1.5   24   63-86      6-29  (55)
 20 PLN03086 PRLI-interacting fact  98.5 5.8E-08 1.3E-12   58.3   2.6   37   33-72    478-514 (567)
 21 PF00096 zf-C2H2:  Zinc finger,  98.5 3.3E-08 7.2E-13   34.9   0.9   22   63-84      1-22  (23)
 22 PF05605 zf-Di19:  Drought indu  98.5 2.9E-07 6.3E-12   39.2   3.8   52   33-87      2-54  (54)
 23 PHA00733 hypothetical protein   98.5   1E-07 2.2E-12   47.5   2.6   54    4-58     62-124 (128)
 24 PF13894 zf-C2H2_4:  C2H2-type   98.5   7E-08 1.5E-12   34.2   1.3   24   63-86      1-24  (24)
 25 PF13912 zf-C2H2_6:  C2H2-type   98.4 1.5E-07 3.2E-12   34.5   1.2   24   63-86      2-25  (27)
 26 PF00096 zf-C2H2:  Zinc finger,  98.4 3.5E-07 7.5E-12   32.2   1.9   23   34-56      1-23  (23)
 27 PLN03086 PRLI-interacting fact  98.3 9.1E-07   2E-11   53.4   4.3   77    4-86    468-564 (567)
 28 PF13912 zf-C2H2_6:  C2H2-type   98.1 1.9E-06 4.1E-11   31.4   1.6   25   33-57      1-25  (27)
 29 smart00355 ZnF_C2H2 zinc finge  98.1 2.8E-06 6.1E-11   30.3   1.7   23   63-85      1-23  (26)
 30 PF09237 GAGA:  GAGA factor;  I  98.0 2.8E-06 6.2E-11   35.3   1.0   26   62-87     24-49  (54)
 31 PF13894 zf-C2H2_4:  C2H2-type   97.9 1.4E-05   3E-10   27.9   2.0   23   34-56      1-23  (24)
 32 COG5189 SFP1 Putative transcri  97.9 2.9E-06 6.4E-11   47.8   0.2   26   60-86    397-422 (423)
 33 PRK04860 hypothetical protein;  97.7 3.2E-05 6.9E-10   40.0   2.5   39   32-75    118-156 (160)
 34 PF12756 zf-C2H2_2:  C2H2 type   97.7   3E-05 6.5E-10   36.7   1.7   22   63-84     51-72  (100)
 35 smart00355 ZnF_C2H2 zinc finge  97.7 4.8E-05   1E-09   26.9   1.9   24   34-57      1-24  (26)
 36 PF13909 zf-H2C2_5:  C2H2-type   97.6 2.4E-05 5.1E-10   27.7   0.9   24   63-87      1-24  (24)
 37 PF12874 zf-met:  Zinc-finger o  97.5 0.00011 2.4E-09   26.1   1.6   22   34-55      1-22  (25)
 38 PF12874 zf-met:  Zinc-finger o  97.4   7E-05 1.5E-09   26.6   0.8   22   63-84      1-22  (25)
 39 PHA00732 hypothetical protein   97.4   9E-05 1.9E-09   34.0   1.3   38   16-56      1-47  (79)
 40 PF05605 zf-Di19:  Drought indu  97.2 0.00034 7.4E-09   29.7   2.0   40   16-57      2-53  (54)
 41 PF12171 zf-C2H2_jaz:  Zinc-fin  97.2 0.00023 4.9E-09   25.8   1.2   21   63-83      2-22  (27)
 42 PF12171 zf-C2H2_jaz:  Zinc-fin  97.1 0.00027 5.9E-09   25.6   1.0   22   34-55      2-23  (27)
 43 KOG3993|consensus               97.1 8.7E-05 1.9E-09   43.5  -0.7   52   33-85    267-318 (500)
 44 PF09237 GAGA:  GAGA factor;  I  97.0  0.0015 3.2E-08   27.4   2.6   31   31-61     22-52  (54)
 45 PF13913 zf-C2HC_2:  zinc-finge  96.9   0.001 2.3E-08   23.7   1.6   20   63-83      3-22  (25)
 46 PF12756 zf-C2H2_2:  C2H2 type   96.8  0.0014 3.1E-08   30.9   2.2   25   33-57     50-74  (100)
 47 COG2888 Predicted Zn-ribbon RN  96.4  0.0047   1E-07   26.6   2.3   49   16-70      9-58  (61)
 48 PF09538 FYDLN_acid:  Protein o  96.4  0.0023 4.9E-08   31.2   1.5   30   17-46     10-39  (108)
 49 smart00451 ZnF_U1 U1-like zinc  96.1  0.0043 9.4E-08   23.6   1.3   21   63-83      4-24  (35)
 50 PRK14890 putative Zn-ribbon RN  96.0   0.014   3E-07   25.2   2.8   50   15-70      6-56  (59)
 51 cd00350 rubredoxin_like Rubred  95.8   0.009   2E-07   22.7   1.7    8   63-70     18-25  (33)
 52 smart00659 RPOLCX RNA polymera  95.4    0.01 2.2E-07   24.2   1.1   24   17-40      3-26  (44)
 53 PF03604 DNA_RNApol_7kD:  DNA d  95.3   0.011 2.5E-07   22.4   1.1    8   63-70     18-25  (32)
 54 PRK04860 hypothetical protein;  95.3  0.0029 6.3E-08   32.9  -0.7   30   16-46    119-156 (160)
 55 TIGR02300 FYDLN_acid conserved  95.3   0.012 2.6E-07   29.4   1.4   32   17-48     10-41  (129)
 56 PRK00398 rpoP DNA-directed RNA  95.1   0.014 3.1E-07   23.8   1.1   27   16-42      3-30  (46)
 57 KOG2893|consensus               95.0  0.0073 1.6E-07   33.4   0.1   41   36-81     13-53  (341)
 58 COG4049 Uncharacterized protei  94.9  0.0098 2.1E-07   25.3   0.4   29   30-58     14-42  (65)
 59 PF09986 DUF2225:  Uncharacteri  94.7   0.022 4.7E-07   31.1   1.6   16   14-29      3-18  (214)
 60 cd00729 rubredoxin_SM Rubredox  94.7   0.027 5.9E-07   21.6   1.4    9   34-42      3-11  (34)
 61 COG5048 FOG: Zn-finger [Genera  94.3   0.013 2.7E-07   34.3   0.0   53   33-86    289-347 (467)
 62 PF15135 UPF0515:  Uncharacteri  93.8   0.023 5.1E-07   31.6   0.5   57   13-75    109-168 (278)
 63 TIGR02098 MJ0042_CXXC MJ0042 f  93.5   0.057 1.2E-06   21.0   1.3   33   34-72      3-35  (38)
 64 PF13719 zinc_ribbon_5:  zinc-r  93.4   0.073 1.6E-06   20.7   1.5   32   35-72      4-35  (37)
 65 COG1592 Rubrerythrin [Energy p  93.2   0.046   1E-06   28.7   1.0   23   33-69    134-156 (166)
 66 TIGR00373 conserved hypothetic  93.1   0.082 1.8E-06   27.6   1.8   33   31-73    107-139 (158)
 67 PF13717 zinc_ribbon_4:  zinc-r  93.1   0.086 1.9E-06   20.5   1.4   32   35-72      4-35  (36)
 68 KOG1146|consensus               93.0   0.078 1.7E-06   36.1   2.0   51   32-83    464-539 (1406)
 69 COG4530 Uncharacterized protei  92.9   0.062 1.4E-06   26.2   1.1   28   18-45     11-38  (129)
 70 COG1997 RPL43A Ribosomal prote  92.8   0.081 1.8E-06   24.8   1.4   28   16-43     35-63  (89)
 71 PRK06266 transcription initiat  92.6   0.088 1.9E-06   28.0   1.5   32   32-73    116-147 (178)
 72 COG1571 Predicted DNA-binding   92.6   0.081 1.8E-06   31.8   1.5   33   16-48    350-382 (421)
 73 PF07754 DUF1610:  Domain of un  92.6    0.11 2.3E-06   18.4   1.2    7   63-69     17-23  (24)
 74 PF14353 CpXC:  CpXC protein     92.4   0.056 1.2E-06   27.0   0.6   11   18-28      3-13  (128)
 75 PF09723 Zn-ribbon_8:  Zinc rib  92.4   0.059 1.3E-06   21.6   0.6   13   34-46      6-18  (42)
 76 PF08274 PhnA_Zn_Ribbon:  PhnA   92.4   0.083 1.8E-06   19.7   0.9   24   18-41      4-27  (30)
 77 TIGR00686 phnA alkylphosphonat  92.4   0.095 2.1E-06   25.5   1.3   31   17-47      3-33  (109)
 78 KOG2186|consensus               92.3    0.11 2.3E-06   29.2   1.6   38   34-74      4-41  (276)
 79 smart00734 ZnF_Rad18 Rad18-lik  92.3    0.15 3.2E-06   18.3   1.5   19   64-83      3-21  (26)
 80 PTZ00255 60S ribosomal protein  92.2   0.081 1.7E-06   25.0   1.0   29   16-44     36-65  (90)
 81 PF12013 DUF3505:  Protein of u  92.1    0.12 2.6E-06   25.1   1.5   25   63-87     81-109 (109)
 82 PRK00464 nrdR transcriptional   92.0   0.024 5.3E-07   29.4  -0.9   12   34-45     29-40  (154)
 83 PRK10220 hypothetical protein;  92.0    0.13 2.9E-06   25.1   1.6   31   17-47      4-34  (111)
 84 smart00834 CxxC_CXXC_SSSS Puta  91.9    0.08 1.7E-06   20.8   0.7   13   34-46      6-18  (41)
 85 TIGR00280 L37a ribosomal prote  91.8   0.084 1.8E-06   25.0   0.8   29   16-44     35-64  (91)
 86 TIGR02605 CxxC_CxxC_SSSS putat  91.8   0.073 1.6E-06   22.2   0.5   12   34-45      6-17  (52)
 87 PF05443 ROS_MUCR:  ROS/MUCR tr  91.8   0.095 2.1E-06   26.6   1.0   26   58-87     69-94  (132)
 88 COG1996 RPC10 DNA-directed RNA  91.1     0.1 2.2E-06   21.8   0.6   25   16-40      6-31  (49)
 89 smart00531 TFIIE Transcription  90.3    0.24 5.2E-06   25.5   1.7   38   31-73     97-134 (147)
 90 PRK03976 rpl37ae 50S ribosomal  90.3    0.14   3E-06   24.2   0.7   29   16-44     36-65  (90)
 91 PF04959 ARS2:  Arsenite-resist  90.2     0.1 2.3E-06   28.6   0.3   24   63-86     78-101 (214)
 92 PF02892 zf-BED:  BED zinc fing  90.1    0.28 6.1E-06   19.7   1.5   22   63-84     17-42  (45)
 93 COG4957 Predicted transcriptio  89.4    0.23   5E-06   25.3   1.1   22   63-87     77-98  (148)
 94 smart00614 ZnF_BED BED zinc fi  89.4    0.31 6.8E-06   20.2   1.4   21   63-83     19-44  (50)
 95 PF01780 Ribosomal_L37ae:  Ribo  89.2    0.16 3.4E-06   24.0   0.5   28   16-43     35-63  (90)
 96 PF09845 DUF2072:  Zn-ribbon co  89.0    0.16 3.5E-06   25.7   0.4   25   16-40      1-26  (131)
 97 PRK09678 DNA-binding transcrip  88.7    0.18 3.9E-06   22.9   0.4   12   63-74     28-41  (72)
 98 COG3357 Predicted transcriptio  87.9    0.32 6.9E-06   23.0   1.0   12   33-44     58-69  (97)
 99 COG5189 SFP1 Putative transcri  87.1    0.18 3.8E-06   29.4  -0.1   42   13-54    346-419 (423)
100 TIGR00622 ssl1 transcription f  86.9    0.89 1.9E-05   22.5   2.2   47   36-85     58-104 (112)
101 PF11781 RRN7:  RNA polymerase   86.7     0.5 1.1E-05   18.3   1.1   26   16-41      8-33  (36)
102 PF01363 FYVE:  FYVE zinc finge  86.1    0.56 1.2E-05   20.7   1.3   30   16-46      9-38  (69)
103 COG5152 Uncharacterized conser  85.8    0.31 6.8E-06   26.5   0.4   46   15-72    195-240 (259)
104 KOG1146|consensus               85.8    0.33 7.1E-06   33.4   0.6   69   17-86   1261-1352(1406)
105 COG1198 PriA Primosomal protei  85.5     0.9 1.9E-05   29.7   2.3   14   57-71    471-484 (730)
106 PRK00432 30S ribosomal protein  85.4    0.77 1.7E-05   19.2   1.4   10   63-72     38-47  (50)
107 PRK00420 hypothetical protein;  85.3    0.69 1.5E-05   22.9   1.4   28   17-44     24-51  (112)
108 PF06524 NOA36:  NOA36 protein;  84.5    0.93   2E-05   25.9   1.9   24   18-41    127-150 (314)
109 PF10571 UPF0547:  Uncharacteri  83.9    0.67 1.4E-05   16.6   0.8   10   64-73     16-25  (26)
110 KOG3507|consensus               83.8    0.62 1.3E-05   20.2   0.8   25   17-41     21-45  (62)
111 KOG3408|consensus               83.7     0.8 1.7E-05   22.9   1.3   26   30-55     54-79  (129)
112 cd00730 rubredoxin Rubredoxin;  83.3    0.83 1.8E-05   19.2   1.1    7   63-69     35-41  (50)
113 PF11789 zf-Nse:  Zinc-finger o  82.9     1.3 2.8E-05   19.0   1.7   47   13-68      8-54  (57)
114 PRK03824 hypA hydrogenase nick  82.7    0.59 1.3E-05   23.8   0.6   15   32-46     69-83  (135)
115 PF08790 zf-LYAR:  LYAR-type C2  82.4    0.46   1E-05   17.4   0.1    9   35-43      2-10  (28)
116 KOG2593|consensus               82.2     0.7 1.5E-05   28.1   0.9   28   14-41    126-161 (436)
117 PF00301 Rubredoxin:  Rubredoxi  81.8    0.67 1.5E-05   19.2   0.5    7   63-69     35-41  (47)
118 PRK03681 hypA hydrogenase nick  81.8    0.67 1.5E-05   22.9   0.6   10   34-43     71-80  (114)
119 PF13453 zf-TFIIB:  Transcripti  81.8     2.2 4.8E-05   16.8   2.1   16   34-49     20-35  (41)
120 PF06524 NOA36:  NOA36 protein;  81.7    0.66 1.4E-05   26.4   0.6   23   60-83    208-230 (314)
121 PRK00564 hypA hydrogenase nick  81.2    0.74 1.6E-05   22.9   0.7   10   34-43     72-81  (117)
122 PF07282 OrfB_Zn_ribbon:  Putat  81.1     2.4 5.3E-05   18.6   2.3    9   63-71     47-55  (69)
123 COG4888 Uncharacterized Zn rib  81.0    0.84 1.8E-05   22.1   0.8   30   14-43     20-56  (104)
124 PF14446 Prok-RING_1:  Prokaryo  81.0     1.1 2.4E-05   19.1   1.1   26   17-43      6-31  (54)
125 PHA00626 hypothetical protein   80.5    0.88 1.9E-05   19.6   0.7   13   63-75     24-36  (59)
126 COG4391 Uncharacterized protei  80.2     1.4 3.1E-05   19.3   1.3   15    7-21     15-29  (62)
127 COG1773 Rubredoxin [Energy pro  80.1     1.1 2.4E-05   19.2   0.9   14   16-29      3-16  (55)
128 PF08271 TF_Zn_Ribbon:  TFIIB z  79.3     1.1 2.5E-05   17.9   0.8   26   17-42      1-28  (43)
129 TIGR00416 sms DNA repair prote  79.2     1.1 2.3E-05   27.6   1.0   24   16-42      7-30  (454)
130 PRK14873 primosome assembly pr  79.1     2.2 4.8E-05   27.7   2.3    9   63-71    423-431 (665)
131 COG5048 FOG: Zn-finger [Genera  79.0       2 4.2E-05   25.4   2.0   54   32-86     32-87  (467)
132 KOG2893|consensus               78.6     1.1 2.3E-05   25.3   0.8   26   60-87     10-35  (341)
133 TIGR01206 lysW lysine biosynth  78.4     1.6 3.5E-05   18.6   1.2    9   63-71     23-31  (54)
134 smart00661 RPOL9 RNA polymeras  77.9     1.9 4.1E-05   17.7   1.4    9   63-71     21-29  (52)
135 KOG0978|consensus               77.7     0.7 1.5E-05   29.9  -0.0   52   17-79    644-695 (698)
136 PRK11823 DNA repair protein Ra  77.6     1.3 2.8E-05   27.2   1.0   25   15-42      6-30  (446)
137 PF05290 Baculo_IE-1:  Baculovi  77.1       2 4.3E-05   22.0   1.4   60   12-77     76-136 (140)
138 COG2824 PhnA Uncharacterized Z  77.1     1.7 3.6E-05   21.3   1.1   29   18-46      5-33  (112)
139 cd01121 Sms Sms (bacterial rad  76.3     1.7 3.7E-05   26.1   1.2   23   17-42      1-23  (372)
140 PF05191 ADK_lid:  Adenylate ki  75.9     2.5 5.5E-05   16.4   1.3   10   35-44      3-12  (36)
141 COG4306 Uncharacterized protei  75.9       1 2.2E-05   22.7   0.2   10   36-45     71-80  (160)
142 KOG4167|consensus               75.4    0.42 9.2E-06   31.0  -1.4   24   62-85    792-815 (907)
143 COG2331 Uncharacterized protei  75.2     1.7 3.7E-05   19.9   0.8   10   34-43     13-22  (82)
144 PF01155 HypA:  Hydrogenase exp  74.9    0.54 1.2E-05   23.2  -0.9   12   34-45     71-82  (113)
145 KOG4167|consensus               74.3    0.78 1.7E-05   29.9  -0.4   27   32-58    791-817 (907)
146 COG3364 Zn-ribbon containing p  74.0    0.97 2.1E-05   21.9  -0.1   25   16-40      2-27  (112)
147 smart00440 ZnF_C2C2 C2C2 Zinc   73.7     0.3 6.5E-06   19.4  -1.6   10   63-72     29-38  (40)
148 PF13451 zf-trcl:  Probable zin  73.4     2.5 5.4E-05   17.7   1.1   16   32-47      3-18  (49)
149 PF04810 zf-Sec23_Sec24:  Sec23  72.9       3 6.6E-05   16.4   1.2   10   32-41     23-32  (40)
150 PF07649 C1_3:  C1-like domain;  72.8     2.3 5.1E-05   15.4   0.9    8   33-40     15-22  (30)
151 PF14803 Nudix_N_2:  Nudix N-te  72.1     2.3   5E-05   16.3   0.8    7   34-40     23-29  (34)
152 PRK12496 hypothetical protein;  72.0     2.5 5.4E-05   22.3   1.1   11   33-43    127-137 (164)
153 PF08792 A2L_zn_ribbon:  A2L zi  71.9     3.5 7.6E-05   15.6   1.3    8   64-71     23-30  (33)
154 PRK12380 hydrogenase nickel in  71.5     1.9 4.1E-05   21.3   0.6   10   34-43     71-80  (113)
155 PF12760 Zn_Tnp_IS1595:  Transp  71.1     3.6 7.8E-05   16.7   1.3    8   63-70     38-45  (46)
156 PF00130 C1_1:  Phorbol esters/  71.0     3.8 8.2E-05   16.9   1.4   29   14-42      9-37  (53)
157 KOG2071|consensus               70.7       3 6.6E-05   26.6   1.4   25   60-85    417-441 (579)
158 PF13878 zf-C2H2_3:  zinc-finge  69.5     5.6 0.00012   15.8   1.7   11   35-45     15-25  (41)
159 KOG0782|consensus               69.1     0.8 1.7E-05   29.2  -1.2   44    3-46    240-289 (1004)
160 PF09963 DUF2197:  Uncharacteri  68.6     1.9   4E-05   18.6   0.2    8   63-70     32-39  (56)
161 KOG2636|consensus               68.5     4.2 9.2E-05   25.2   1.6   28   54-82    394-422 (497)
162 KOG4173|consensus               68.5     2.2 4.7E-05   23.6   0.4   51   35-86    108-170 (253)
163 cd00065 FYVE FYVE domain; Zinc  68.3     3.7   8E-05   17.2   1.1   28   18-46      4-31  (57)
164 PF01927 Mut7-C:  Mut7-C RNAse   66.9     4.3 9.3E-05   20.9   1.3   19   63-81    125-143 (147)
165 TIGR00100 hypA hydrogenase nic  66.6     2.8 6.1E-05   20.7   0.6   12   34-45     71-82  (115)
166 PF07975 C1_4:  TFIIH C1-like d  66.5       2 4.4E-05   18.1   0.1   16   33-48     21-36  (51)
167 KOG0320|consensus               66.4       2 4.4E-05   23.1   0.1   49   14-72    129-177 (187)
168 KOG2785|consensus               66.3     6.2 0.00014   23.9   2.0   21   63-83     69-89  (390)
169 PHA02942 putative transposase;  66.3     8.9 0.00019   23.3   2.7    8   63-70    343-350 (383)
170 PF13445 zf-RING_UBOX:  RING-ty  65.5       9 0.00019   15.4   1.9   28   19-48      1-28  (43)
171 cd00029 C1 Protein kinase C co  65.3     5.2 0.00011   16.0   1.3   26   16-41     11-36  (50)
172 PF05129 Elf1:  Transcription e  65.3     3.2   7E-05   19.2   0.6   31   15-45     21-58  (81)
173 KOG0317|consensus               65.0     6.2 0.00013   23.0   1.8   48   15-74    238-285 (293)
174 smart00154 ZnF_AN1 AN1-like Zi  64.1     3.7 7.9E-05   16.2   0.6   11   63-73     13-23  (39)
175 PF14311 DUF4379:  Domain of un  64.0     8.4 0.00018   16.2   1.8   14   33-46     28-41  (55)
176 KOG2907|consensus               63.9       3 6.5E-05   20.7   0.4   40   34-75     75-115 (116)
177 PF08646 Rep_fac-A_C:  Replicat  63.4     4.5 9.8E-05   20.7   1.0   26   18-43     20-47  (146)
178 PF00628 PHD:  PHD-finger;  Int  63.3     6.9 0.00015   15.9   1.4   12   32-43     13-24  (51)
179 PF03107 C1_2:  C1 domain;  Int  62.8     5.4 0.00012   14.5   1.0    6   34-39     16-21  (30)
180 KOG2231|consensus               61.7     9.8 0.00021   25.0   2.4   51   35-87    184-237 (669)
181 KOG0402|consensus               61.7     4.1 8.9E-05   19.1   0.6   26   17-42     37-63  (92)
182 PF14634 zf-RING_5:  zinc-RING   61.3      11 0.00023   14.9   2.3   43   19-70      2-44  (44)
183 cd04476 RPA1_DBD_C RPA1_DBD_C:  60.8     6.1 0.00013   20.7   1.3   25   18-42     36-60  (166)
184 TIGR00570 cdk7 CDK-activating   60.0      20 0.00044   21.3   3.3   52   17-75      4-56  (309)
185 PRK00762 hypA hydrogenase nick  59.7     4.4 9.6E-05   20.4   0.6   13   33-46     70-82  (124)
186 PF10013 DUF2256:  Uncharacteri  59.5     6.4 0.00014   15.9   0.9   16   35-50     10-25  (42)
187 KOG2482|consensus               59.3     5.3 0.00012   23.9   0.9   22   63-84    196-217 (423)
188 COG1675 TFA1 Transcription ini  59.2     9.7 0.00021   20.6   1.8   32   31-72    111-142 (176)
189 PF04423 Rad50_zn_hook:  Rad50   59.1     4.1 8.9E-05   17.1   0.4   11   64-74     22-32  (54)
190 KOG0717|consensus               58.8       5 0.00011   25.0   0.8   21   63-83    293-313 (508)
191 TIGR00595 priA primosomal prot  58.5     7.3 0.00016   24.5   1.5    8   63-70    254-261 (505)
192 KOG1729|consensus               58.3    0.94   2E-05   26.2  -2.1   30   16-45    168-197 (288)
193 PF09297 zf-NADH-PPase:  NADH p  57.8     6.5 0.00014   14.5   0.8    8   33-40     21-28  (32)
194 PF10083 DUF2321:  Uncharacteri  57.7     7.2 0.00015   20.6   1.1   12   63-74     69-80  (158)
195 PF01428 zf-AN1:  AN1-like Zinc  57.6     4.5 9.8E-05   16.1   0.4   15   32-46     12-26  (43)
196 PF11672 DUF3268:  Protein of u  57.6     4.9 0.00011   19.6   0.5    9   16-24      2-10  (102)
197 PLN02294 cytochrome c oxidase   57.6     6.2 0.00013   21.2   0.9   20   52-73    133-152 (174)
198 smart00064 FYVE Protein presen  57.4      11 0.00025   16.4   1.7   29   17-46     11-39  (68)
199 PF02176 zf-TRAF:  TRAF-type zi  57.3       9  0.0002   16.1   1.3   40   33-73      9-53  (60)
200 PF11023 DUF2614:  Protein of u  56.8     7.7 0.00017   19.3   1.1   29   15-44     68-96  (114)
201 PRK04023 DNA polymerase II lar  56.6     9.9 0.00021   26.3   1.8   22   16-42    626-647 (1121)
202 PF01286 XPA_N:  XPA protein N-  55.8     5.9 0.00013   15.2   0.5   12   64-75      5-16  (34)
203 CHL00174 accD acetyl-CoA carbo  55.8     4.5 9.7E-05   23.7   0.3   11   34-44     58-68  (296)
204 TIGR00244 transcriptional regu  55.4       6 0.00013   20.7   0.7   14   63-76     29-42  (147)
205 PF10537 WAC_Acf1_DNA_bd:  ATP-  55.4      21 0.00046   17.4   2.5   36   33-70      3-38  (102)
206 TIGR00515 accD acetyl-CoA carb  55.2     4.6 9.9E-05   23.5   0.2   28   18-45     28-57  (285)
207 PLN03208 E3 ubiquitin-protein   54.6      26 0.00057   19.3   3.0   53   15-73     17-79  (193)
208 PF13824 zf-Mss51:  Zinc-finger  54.5      14 0.00031   15.9   1.6    9   33-41     14-22  (55)
209 PHA02998 RNA polymerase subuni  54.3     1.9 4.1E-05   23.2  -1.2   11   63-73    172-182 (195)
210 COG1594 RPB9 DNA-directed RNA   54.0     2.4 5.1E-05   21.0  -0.9   11   63-73    101-111 (113)
211 cd00924 Cyt_c_Oxidase_Vb Cytoc  53.4     8.8 0.00019   18.6   1.0   15   30-44     76-90  (97)
212 PF04780 DUF629:  Protein of un  53.0     9.6 0.00021   23.9   1.3   22   63-84     58-79  (466)
213 TIGR03830 CxxCG_CxxCG_HTH puta  52.6      18 0.00039   17.8   2.1   17   33-49     31-47  (127)
214 TIGR00627 tfb4 transcription f  52.5     8.2 0.00018   22.4   1.0   25   33-72    255-279 (279)
215 PF12773 DZR:  Double zinc ribb  52.2     8.3 0.00018   15.7   0.8   10   63-72     30-39  (50)
216 PF02891 zf-MIZ:  MIZ/SP-RING z  51.9      10 0.00022   15.8   1.0   23   43-70     27-49  (50)
217 PF15616 TerY-C:  TerY-C metal   51.8      12 0.00026   19.2   1.4    9   63-71    106-114 (131)
218 PRK05654 acetyl-CoA carboxylas  51.6     5.4 0.00012   23.3   0.2   28   18-45     29-58  (292)
219 PF07191 zinc-ribbons_6:  zinc-  51.3       8 0.00017   17.5   0.6   24   19-43      4-27  (70)
220 PF07503 zf-HYPF:  HypF finger;  51.1     5.8 0.00012   15.3   0.2   10   63-72     22-31  (35)
221 PRK07591 threonine synthase; V  51.1     8.4 0.00018   23.6   0.9   27   16-44     18-44  (421)
222 KOG1813|consensus               50.9     5.8 0.00012   23.2   0.2   16   14-29    239-254 (313)
223 PF15269 zf-C2H2_7:  Zinc-finge  50.5      11 0.00024   15.4   0.9   21   63-83     21-41  (54)
224 COG1998 RPS31 Ribosomal protei  50.2      13 0.00028   15.6   1.1    9   63-71     38-46  (51)
225 COG3677 Transposase and inacti  50.1      11 0.00023   19.2   1.1   14   59-73     51-64  (129)
226 PF02591 DUF164:  Putative zinc  49.4      19 0.00041   15.2   1.7   32   35-71     24-55  (56)
227 PRK05452 anaerobic nitric oxid  49.4      10 0.00022   23.8   1.1   14   32-45    424-437 (479)
228 PF14787 zf-CCHC_5:  GAG-polypr  48.9      10 0.00022   14.8   0.7   15   63-77      3-17  (36)
229 PF07295 DUF1451:  Protein of u  48.6     5.1 0.00011   20.9  -0.2   31   30-71    109-139 (146)
230 COG5112 UFD2 U1-like Zn-finger  48.2     9.7 0.00021   18.8   0.7   26   30-55     52-77  (126)
231 smart00249 PHD PHD zinc finger  47.7      17 0.00037   13.9   1.4   11   33-43     14-24  (47)
232 PF11931 DUF3449:  Domain of un  47.1     6.3 0.00014   21.6   0.0   26   55-81     95-121 (196)
233 PF04606 Ogr_Delta:  Ogr/Delta-  46.8     4.1 8.9E-05   16.6  -0.6   13   63-75     26-40  (47)
234 COG4338 Uncharacterized protei  46.8     7.6 0.00017   16.2   0.2   16   35-50     14-29  (54)
235 smart00109 C1 Protein kinase C  46.6      18  0.0004   14.1   1.4   24   16-40     11-34  (49)
236 smart00132 LIM Zinc-binding do  46.5     3.8 8.2E-05   15.2  -0.7   10   63-72     28-37  (39)
237 KOG3362|consensus               46.0     6.8 0.00015   20.4   0.0   19   63-81    130-148 (156)
238 COG1327 Predicted transcriptio  45.9     9.7 0.00021   20.1   0.6   13   63-75     29-41  (156)
239 PRK06450 threonine synthase; V  45.7      11 0.00023   22.4   0.8   25   17-43      4-28  (338)
240 COG0675 Transposase and inacti  45.6      25 0.00054   20.4   2.2   24   18-45    311-334 (364)
241 PF07800 DUF1644:  Protein of u  45.1      39 0.00084   18.1   2.6   52   33-86     80-132 (162)
242 KOG1842|consensus               45.0      11 0.00023   23.6   0.7   21   34-54     16-36  (505)
243 PRK04351 hypothetical protein;  45.0      14  0.0003   19.3   1.0   34   32-74    111-144 (149)
244 COG1779 C4-type Zn-finger prot  44.7     9.4  0.0002   21.0   0.4   28   17-44     15-54  (201)
245 COG1645 Uncharacterized Zn-fin  44.3      15 0.00033   18.9   1.1   23   18-41     30-52  (131)
246 PRK06260 threonine synthase; V  44.3      12 0.00027   22.6   0.9   26   17-43      4-29  (397)
247 TIGR03831 YgiT_finger YgiT-typ  44.1      10 0.00022   14.9   0.4   12   33-44     32-43  (46)
248 smart00504 Ubox Modified RING   44.1      28 0.00061   14.6   2.8   45   17-73      2-46  (63)
249 PF08209 Sgf11:  Sgf11 (transcr  43.9      23 0.00049   13.5   2.0   21   33-54      4-24  (33)
250 COG1326 Uncharacterized archae  43.9      27 0.00058   19.3   2.0   10   34-43     31-40  (201)
251 COG4640 Predicted membrane pro  43.9      18  0.0004   22.3   1.5   15   34-48     16-30  (465)
252 COG1066 Sms Predicted ATP-depe  43.4      12 0.00027   23.2   0.8   24   15-41      6-29  (456)
253 PF10276 zf-CHCC:  Zinc-finger   43.2     8.6 0.00019   15.3   0.1   10   63-72     30-39  (40)
254 PTZ00303 phosphatidylinositol   42.6      16 0.00035   24.9   1.2   31   17-47    461-495 (1374)
255 PRK05978 hypothetical protein;  42.1      16 0.00034   19.2   0.9   11   63-73     53-63  (148)
256 PF10263 SprT-like:  SprT-like   41.2      13 0.00028   19.1   0.6   32   33-73    123-154 (157)
257 PRK12366 replication factor A;  41.1      14 0.00031   24.1   0.9   22   19-41    535-556 (637)
258 KOG1280|consensus               41.0      27 0.00058   21.2   1.8   24   63-86     80-103 (381)
259 PF02146 SIR2:  Sir2 family;  I  40.9      47   0.001   17.6   2.7   35   33-72    105-139 (178)
260 TIGR01384 TFS_arch transcripti  40.7      22 0.00048   17.0   1.3   10   63-72     63-72  (104)
261 PRK05580 primosome assembly pr  40.6      21 0.00044   23.6   1.5   24   17-40    391-415 (679)
262 PRK08402 replication factor A;  40.5      17 0.00038   21.9   1.1   23   18-40    214-237 (355)
263 COG5216 Uncharacterized conser  40.5      17 0.00038   15.8   0.8    6   63-68     45-50  (67)
264 COG5188 PRP9 Splicing factor 3  40.4      19 0.00041   21.9   1.2   28   53-81    366-394 (470)
265 PF01096 TFIIS_C:  Transcriptio  40.3     9.5 0.00021   14.9   0.0    9   63-71     29-37  (39)
266 PF06677 Auto_anti-p27:  Sjogre  40.0      23  0.0005   14.2   1.1    6   35-40     19-24  (41)
267 PF04641 Rtf2:  Rtf2 RING-finge  39.8      19 0.00041   20.6   1.2   51   13-73    110-161 (260)
268 PRK14138 NAD-dependent deacety  39.7      42  0.0009   19.1   2.4   33   33-70    119-151 (244)
269 COG0846 SIR2 NAD-dependent pro  39.6      26 0.00057   20.1   1.6   33   33-70    122-154 (250)
270 PRK11827 hypothetical protein;  39.4      28 0.00061   15.3   1.4   30   17-46      9-39  (60)
271 PF12907 zf-met2:  Zinc-binding  39.4     8.2 0.00018   15.4  -0.2    6   64-69      3-8   (40)
272 COG0068 HypF Hydrogenase matur  39.2     3.4 7.5E-05   27.1  -1.9   29   36-71    154-182 (750)
273 PF12230 PRP21_like_P:  Pre-mRN  38.7      10 0.00022   21.1   0.0   22   63-85    169-190 (229)
274 PRK07218 replication factor A;  38.4      17 0.00036   22.6   0.8    9   18-26    299-307 (423)
275 PF01215 COX5B:  Cytochrome c o  38.3      17 0.00037   18.8   0.7   17   30-46    109-125 (136)
276 PF06827 zf-FPG_IleRS:  Zinc fi  37.9      17 0.00036   13.0   0.5    7   19-25      4-10  (30)
277 PF06397 Desulfoferrod_N:  Desu  37.7      17 0.00037   14.1   0.5   11   33-43      6-16  (36)
278 smart00731 SprT SprT homologue  37.6      19  0.0004   18.6   0.8   34   32-73    111-144 (146)
279 PF02318 FYVE_2:  FYVE-type zin  37.0      24 0.00052   17.5   1.1   49   16-70     54-102 (118)
280 PRK14892 putative transcriptio  35.9      26 0.00057   17.0   1.1    8   16-23     21-28  (99)
281 PRK11788 tetratricopeptide rep  35.9      24 0.00053   20.8   1.2   21   17-40    355-375 (389)
282 PF14445 Prok-RING_2:  Prokaryo  35.9     3.7   8E-05   17.3  -1.5   12   17-28      8-19  (57)
283 PRK08222 hydrogenase 4 subunit  35.9      28 0.00062   18.7   1.4   17   63-79    115-131 (181)
284 cd01413 SIR2_Af2 SIR2_Af2: Arc  35.9      42 0.00091   18.7   2.1   32   33-70    113-144 (222)
285 COG1656 Uncharacterized conser  35.7      28  0.0006   18.7   1.3   18   63-80    131-148 (165)
286 TIGR03826 YvyF flagellar opero  35.7      14  0.0003   19.1   0.2   23   17-41      4-26  (137)
287 KOG3214|consensus               35.3      21 0.00046   17.4   0.7   12   34-45     48-59  (109)
288 PF06689 zf-C4_ClpX:  ClpX C4-t  35.0     9.7 0.00021   15.1  -0.4   10   18-27      3-12  (41)
289 COG5236 Uncharacterized conser  35.0      46   0.001   20.4   2.2   51   35-87    222-276 (493)
290 COG3091 SprT Zn-dependent meta  34.4      20 0.00043   19.0   0.6   34   33-72    117-150 (156)
291 PTZ00043 cytochrome c oxidase   34.4      20 0.00043   20.4   0.7   16   14-29    179-194 (268)
292 KOG2923|consensus               34.2      28 0.00061   15.5   1.0    7   63-69     45-51  (67)
293 PF15227 zf-C3HC4_4:  zinc fing  34.1      24 0.00053   13.9   0.8   10   38-47     15-24  (42)
294 COG2956 Predicted N-acetylgluc  34.0      25 0.00053   21.4   1.0    9   16-24    354-362 (389)
295 COG1379 PHP family phosphoeste  33.9      12 0.00025   22.6  -0.3   28   18-45    248-277 (403)
296 PF00412 LIM:  LIM domain;  Int  33.6     4.8 0.00011   16.7  -1.4   10   63-72     27-36  (58)
297 KOG4215|consensus               33.6      17 0.00037   22.2   0.3   37   17-54     20-56  (432)
298 PRK12387 formate hydrogenlyase  33.1      28  0.0006   18.6   1.1   18   62-79    114-131 (180)
299 PRK11088 rrmA 23S rRNA methylt  32.7      37  0.0008   19.4   1.6   21   17-38      3-23  (272)
300 PRK12286 rpmF 50S ribosomal pr  32.7      36 0.00078   14.7   1.2    7   34-40     41-47  (57)
301 PF03966 Trm112p:  Trm112p-like  32.6      17 0.00036   16.1   0.2   11   63-73     54-64  (68)
302 PF03563 Bunya_G2:  Bunyavirus   32.0      46 0.00099   19.5   1.8   17   38-54    255-271 (285)
303 KOG0823|consensus               32.0      43 0.00093   19.1   1.7   46   15-69     46-91  (230)
304 PF11494 Ta0938:  Ta0938;  Inte  31.4      35 0.00076   16.6   1.1   35   12-46     10-50  (105)
305 KOG2164|consensus               31.2      67  0.0014   20.7   2.5   50   16-72    186-235 (513)
306 PRK01343 zinc-binding protein;  31.1      28  0.0006   15.1   0.7   12   62-73      9-20  (57)
307 PLN02748 tRNA dimethylallyltra  31.0      44 0.00095   21.2   1.8   23   60-83    417-440 (468)
308 TIGR03844 cysteate_syn cysteat  30.5      28  0.0006   21.4   0.9   22   17-40      3-24  (398)
309 PF14369 zf-RING_3:  zinc-finge  30.4      29 0.00063   13.2   0.7   10   64-73     23-32  (35)
310 PF09855 DUF2082:  Nucleic-acid  30.1      30 0.00065   15.4   0.7    7   63-69      1-7   (64)
311 PF09889 DUF2116:  Uncharacteri  30.0      32 0.00069   15.0   0.8    6   19-24      6-11  (59)
312 PTZ00448 hypothetical protein;  30.0      42  0.0009   20.6   1.5   21   63-83    315-335 (373)
313 PF09862 DUF2089:  Protein of u  30.0      30 0.00066   17.3   0.8    8   34-41     13-20  (113)
314 KOG1409|consensus               29.8      14  0.0003   22.4  -0.4   41   33-75    282-322 (404)
315 KOG1088|consensus               29.3      26 0.00056   17.7   0.5   18   56-74     93-110 (124)
316 COG1439 Predicted nucleic acid  29.1      26 0.00055   19.1   0.5   13   32-44    138-150 (177)
317 TIGR00319 desulf_FeS4 desulfof  28.9      31 0.00066   12.8   0.6   11   33-43      7-17  (34)
318 cd00974 DSRD Desulforedoxin (D  28.8      31 0.00067   12.8   0.6   11   33-43      4-14  (34)
319 TIGR03829 YokU_near_AblA uncha  28.7      40 0.00087   16.1   1.1   21   34-54     36-56  (89)
320 KOG3352|consensus               28.6      36 0.00077   18.0   1.0   19   53-73    126-144 (153)
321 cd01407 SIR2-fam SIR2 family o  28.0      82  0.0018   17.4   2.4   34   33-71    109-142 (218)
322 PF10080 DUF2318:  Predicted me  27.9      27 0.00059   17.1   0.5   30   18-47     37-66  (102)
323 PF02148 zf-UBP:  Zn-finger in   27.2      33 0.00072   14.8   0.7   16   31-46      9-24  (63)
324 cd01675 RNR_III Class III ribo  27.2      43 0.00093   21.6   1.3    9   63-71    533-541 (555)
325 KOG0801|consensus               27.0      18 0.00038   19.4  -0.3   11   63-73    139-149 (205)
326 COG0777 AccD Acetyl-CoA carbox  26.9      22 0.00049   20.8   0.1   31   17-47     29-61  (294)
327 COG5533 UBP5 Ubiquitin C-termi  26.8      27 0.00059   21.0   0.4   10   17-26    236-245 (415)
328 PLN03238 probable histone acet  26.7      97  0.0021   18.4   2.5   27   31-57     46-72  (290)
329 COG1096 Predicted RNA-binding   26.6      43 0.00094   18.4   1.1   23   18-41    151-173 (188)
330 KOG1818|consensus               26.3      19 0.00042   23.6  -0.2   50   18-68    167-217 (634)
331 PF01844 HNH:  HNH endonuclease  26.2      10 0.00022   14.9  -1.0    9   65-73      1-9   (47)
332 cd02249 ZZ Zinc finger, ZZ typ  26.2      60  0.0013   13.0   1.5    7   18-24      2-8   (46)
333 PF06170 DUF983:  Protein of un  25.3      34 0.00073   16.2   0.5   11   35-45     10-20  (86)
334 PRK08270 anaerobic ribonucleos  25.2      42 0.00091   22.2   1.1    9   63-71    640-648 (656)
335 PF13639 zf-RING_2:  Ring finge  25.2      52  0.0011   12.8   1.0   28   18-47      2-29  (44)
336 PF09082 DUF1922:  Domain of un  25.1      30 0.00064   15.7   0.3   24   17-42      4-28  (68)
337 PF14354 Lar_restr_allev:  Rest  25.1      44 0.00095   14.1   0.8   11   16-26      3-13  (61)
338 TIGR01031 rpmF_bact ribosomal   25.0      55  0.0012   14.0   1.1   19   18-40     28-46  (55)
339 COG5222 Uncharacterized conser  24.9 1.4E+02  0.0031   18.0   2.9   46   15-70    273-318 (427)
340 PRK08329 threonine synthase; V  24.9      49  0.0011   19.8   1.2   24   17-43      2-25  (347)
341 PRK00423 tfb transcription ini  24.9      59  0.0013   19.2   1.5   31   13-43      8-40  (310)
342 PRK05638 threonine synthase; V  24.7      43 0.00094   20.8   1.0   24   17-43      2-25  (442)
343 PF14447 Prok-RING_4:  Prokaryo  24.7      40 0.00087   14.6   0.6   13   34-46     40-52  (55)
344 PF03884 DUF329:  Domain of unk  24.6      32 0.00068   14.9   0.3   12   63-74      3-14  (57)
345 PF10367 Vps39_2:  Vacuolar sor  24.6      45 0.00097   15.7   0.9   12   63-74     79-90  (109)
346 TIGR01385 TFSII transcription   24.5      14 0.00031   21.7  -0.9   10   63-72    287-296 (299)
347 PF14122 YokU:  YokU-like prote  24.3      82  0.0018   15.0   1.6   16   34-49     36-51  (87)
348 PF13597 NRDD:  Anaerobic ribon  24.3      41 0.00089   21.7   0.9    9   33-41    504-512 (546)
349 PRK08359 transcription factor;  24.3      24 0.00052   19.1  -0.1   30   15-44      5-41  (176)
350 PRK09710 lar restriction allev  24.2      49  0.0011   14.8   0.9   25   18-42      8-36  (64)
351 PRK11032 hypothetical protein;  23.9      68  0.0015   17.2   1.5   31   30-71    121-151 (160)
352 cd00162 RING RING-finger (Real  23.7      58  0.0013   12.0   3.0    8   63-70     36-43  (45)
353 TIGR00155 pqiA_fam integral me  23.6      80  0.0017   19.6   1.9   29   14-42     11-42  (403)
354 PF14255 Cys_rich_CPXG:  Cystei  23.5      51  0.0011   14.0   0.8    9   64-72      2-10  (52)
355 PF14375 Cys_rich_CWC:  Cystein  23.3      46   0.001   13.7   0.7    7   66-72      2-8   (50)
356 PF04438 zf-HIT:  HIT zinc fing  23.1      36 0.00077   12.5   0.3    8   63-70     14-21  (30)
357 PRK02935 hypothetical protein;  23.1      50  0.0011   16.4   0.9   27   16-43     70-96  (110)
358 KOG4727|consensus               23.0      65  0.0014   17.6   1.3   24   31-54     73-96  (193)
359 COG1631 RPL42A Ribosomal prote  22.6      26 0.00056   16.8  -0.1   10   63-72     69-78  (94)
360 KOG0562|consensus               22.5      42 0.00091   18.2   0.6   23   63-85    154-176 (184)
361 PRK08197 threonine synthase; V  22.4      48   0.001   20.2   0.9   26   16-43      7-32  (394)
362 smart00391 MBD Methyl-CpG bind  22.3      66  0.0014   14.8   1.2   16   68-83     36-51  (77)
363 cd01410 SIRT7 SIRT7: Eukaryoti  22.3 1.5E+02  0.0033   16.4   2.7   35   33-71     95-129 (206)
364 PF04161 Arv1:  Arv1-like famil  22.2      43 0.00093   18.5   0.6    8   34-41     25-32  (208)
365 cd02337 ZZ_CBP Zinc finger, ZZ  22.1      74  0.0016   12.6   1.4    7   33-39     13-19  (41)
366 COG3024 Uncharacterized protei  22.0      49  0.0011   14.8   0.7   12   63-74      8-19  (65)
367 COG5574 PEX10 RING-finger-cont  21.9      61  0.0013   19.0   1.2   45   14-69    213-258 (271)
368 COG1655 Uncharacterized protei  21.9      18 0.00039   20.6  -0.8    8   63-70     63-70  (267)
369 KOG3268|consensus               21.8 1.6E+02  0.0035   16.3   2.7   13   16-28    148-160 (234)
370 PRK00481 NAD-dependent deacety  21.7      91   0.002   17.6   1.8   29   33-70    122-150 (242)
371 PTZ00409 Sir2 (Silent Informat  21.6 1.4E+02  0.0031   17.4   2.6   15   33-47    137-151 (271)
372 PRK07111 anaerobic ribonucleos  21.6      56  0.0012   22.1   1.1    7   34-40    694-700 (735)
373 cd00122 MBD MeCP2, MBD1, MBD2,  21.5      75  0.0016   13.7   1.2   16   68-83     33-48  (62)
374 COG1579 Zn-ribbon protein, pos  21.4      77  0.0017   18.2   1.5   35   35-74    199-233 (239)
375 COG1885 Uncharacterized protei  20.7      62  0.0013   16.0   0.9   10   63-72     50-59  (115)
376 PF06957 COPI_C:  Coatomer (COP  20.5      50  0.0011   20.7   0.7   25   20-44    365-391 (422)
377 KOG4602|consensus               20.4      47   0.001   19.4   0.6   11   32-42    267-277 (318)
378 smart00647 IBR In Between Ring  20.4      76  0.0016   13.2   1.1   10   63-72     41-50  (64)
379 PF03833 PolC_DP2:  DNA polymer  20.4      34 0.00073   23.5   0.0    9   17-25    656-664 (900)
380 TIGR00382 clpX endopeptidase C  20.1      62  0.0013   20.2   1.0   26   18-43      9-39  (413)

No 1  
>KOG2462|consensus
Probab=99.88  E-value=2.9e-23  Score=111.15  Aligned_cols=83  Identities=24%  Similarity=0.442  Sum_probs=54.1

Q ss_pred             ccceeeccccCC---CCcccccccchhhhcc---------CCcceecCcccccccchhhHHHHhhhhcCCCCCccCCCCC
Q psy12019          2 LNVIVKPRTHRE---PKHNKCLINWSAVQQN---------HAGMFMCDVCGKGYKYKNGIYRHKKFECGQEPKYQCPQCP   69 (87)
Q Consensus         2 ~~l~~h~~~h~~---~~~~~c~~c~~~~~~~---------~~~~~~c~~c~~~~~~~~~~~~h~~~~~~~~~~~~c~~c~   69 (87)
                      ++|..|..+|..   .+.+.|..|++.+.+.         ..-+++|..||+.|...=.|+.|+|+|+||+| |.|..|+
T Consensus       144 snLsrHkQ~H~~~~s~ka~~C~~C~K~YvSmpALkMHirTH~l~c~C~iCGKaFSRPWLLQGHiRTHTGEKP-F~C~hC~  222 (279)
T KOG2462|consen  144 SNLSRHKQTHRSLDSKKAFSCKYCGKVYVSMPALKMHIRTHTLPCECGICGKAFSRPWLLQGHIRTHTGEKP-FSCPHCG  222 (279)
T ss_pred             cccchhhcccccccccccccCCCCCceeeehHHHhhHhhccCCCcccccccccccchHHhhcccccccCCCC-ccCCccc
Confidence            456666666642   3456677777776653         23356677777777666667777777777666 7777777


Q ss_pred             cccccchHHHhhhhhc
Q psy12019         70 YRAKQNAHLTTHMAIK   85 (87)
Q Consensus        70 ~~f~~~~~l~~h~~~~   85 (87)
                      |+|..+++|..|+++|
T Consensus       223 kAFADRSNLRAHmQTH  238 (279)
T KOG2462|consen  223 KAFADRSNLRAHMQTH  238 (279)
T ss_pred             chhcchHHHHHHHHhh
Confidence            7777777777776665


No 2  
>KOG2462|consensus
Probab=99.87  E-value=5e-23  Score=110.28  Aligned_cols=78  Identities=23%  Similarity=0.392  Sum_probs=72.3

Q ss_pred             cceeeccccCCCCcccccccchhhhcc-----------CCcceecCcccccccchhhHHHHhhhhcCCCCCccCCCCCcc
Q psy12019          3 NVIVKPRTHREPKHNKCLINWSAVQQN-----------HAGMFMCDVCGKGYKYKNGIYRHKKFECGQEPKYQCPQCPYR   71 (87)
Q Consensus         3 ~l~~h~~~h~~~~~~~c~~c~~~~~~~-----------~~~~~~c~~c~~~~~~~~~~~~h~~~~~~~~~~~~c~~c~~~   71 (87)
                      .|..|+|+|.  -+.+|.+|++.|+..           |++||.|..|+++|.+.++|..|+++|.+.++ |+|..|+|+
T Consensus       176 ALkMHirTH~--l~c~C~iCGKaFSRPWLLQGHiRTHTGEKPF~C~hC~kAFADRSNLRAHmQTHS~~K~-~qC~~C~Ks  252 (279)
T KOG2462|consen  176 ALKMHIRTHT--LPCECGICGKAFSRPWLLQGHIRTHTGEKPFSCPHCGKAFADRSNLRAHMQTHSDVKK-HQCPRCGKS  252 (279)
T ss_pred             HHhhHhhccC--CCcccccccccccchHHhhcccccccCCCCccCCcccchhcchHHHHHHHHhhcCCcc-ccCcchhhH
Confidence            4778888887  689999999999864           89999999999999999999999999999998 999999999


Q ss_pred             cccchHHHhhhh
Q psy12019         72 AKQNAHLTTHMA   83 (87)
Q Consensus        72 f~~~~~l~~h~~   83 (87)
                      |...+-|++|..
T Consensus       253 Fsl~SyLnKH~E  264 (279)
T KOG2462|consen  253 FALKSYLNKHSE  264 (279)
T ss_pred             HHHHHHHHHhhh
Confidence            999999999964


No 3  
>KOG1074|consensus
Probab=99.73  E-value=8.8e-19  Score=105.10  Aligned_cols=53  Identities=19%  Similarity=0.469  Sum_probs=50.0

Q ss_pred             cceecCcccccccchhhHHHHhhhhcCCCCCccCCCCCcccccchHHHhhhhhc
Q psy12019         32 GMFMCDVCGKGYKYKNGIYRHKKFECGQEPKYQCPQCPYRAKQNAHLTTHMAIK   85 (87)
Q Consensus        32 ~~~~c~~c~~~~~~~~~~~~h~~~~~~~~~~~~c~~c~~~f~~~~~l~~h~~~~   85 (87)
                      .|.+|..|.+..+-.++|+.|.+.|+||+| |+|.+||++|....+|+.|+.+|
T Consensus       604 dPNqCiiC~rVlSC~saLqmHyrtHtGERP-FkCKiCgRAFtTkGNLkaH~~vH  656 (958)
T KOG1074|consen  604 DPNQCIICLRVLSCPSALQMHYRTHTGERP-FKCKICGRAFTTKGNLKAHMSVH  656 (958)
T ss_pred             CccceeeeeecccchhhhhhhhhcccCcCc-cccccccchhccccchhhccccc
Confidence            367899999999999999999999999999 99999999999999999998775


No 4  
>KOG3623|consensus
Probab=99.66  E-value=2.3e-17  Score=98.36  Aligned_cols=70  Identities=27%  Similarity=0.545  Sum_probs=64.5

Q ss_pred             CCCcccccccchhhhcc-----------CCcceecCcccccccchhhHHHHhhhhcCCCCCccCCCCCcccccchHHHhh
Q psy12019         13 EPKHNKCLINWSAVQQN-----------HAGMFMCDVCGKGYKYKNGIYRHKKFECGQEPKYQCPQCPYRAKQNAHLTTH   81 (87)
Q Consensus        13 ~~~~~~c~~c~~~~~~~-----------~~~~~~c~~c~~~~~~~~~~~~h~~~~~~~~~~~~c~~c~~~f~~~~~l~~h   81 (87)
                      .+-.|.|..|+++|...           |.+||+|..|.++|...-.|..|.|.|.|++| |+|..|+|+|+++.+...|
T Consensus       891 e~gmyaCDqCDK~FqKqSSLaRHKYEHsGqRPyqC~iCkKAFKHKHHLtEHkRLHSGEKP-fQCdKClKRFSHSGSYSQH  969 (1007)
T KOG3623|consen  891 EDGMYACDQCDKAFQKQSSLARHKYEHSGQRPYQCIICKKAFKHKHHLTEHKRLHSGEKP-FQCDKCLKRFSHSGSYSQH  969 (1007)
T ss_pred             ccccchHHHHHHHHHhhHHHHHhhhhhcCCCCcccchhhHhhhhhhhhhhhhhhccCCCc-chhhhhhhhcccccchHhh
Confidence            34579999999999753           88899999999999999999999999999999 9999999999999999998


Q ss_pred             hh
Q psy12019         82 MA   83 (87)
Q Consensus        82 ~~   83 (87)
                      +-
T Consensus       970 MN  971 (1007)
T KOG3623|consen  970 MN  971 (1007)
T ss_pred             hc
Confidence            73


No 5  
>KOG1074|consensus
Probab=99.65  E-value=5e-17  Score=97.77  Aligned_cols=53  Identities=25%  Similarity=0.604  Sum_probs=50.4

Q ss_pred             eecCcccccccchhhHHHHhhhhcCCCCCccCCCCCcccccchHHHhhhhhcCC
Q psy12019         34 FMCDVCGKGYKYKNGIYRHKKFECGQEPKYQCPQCPYRAKQNAHLTTHMAIKHY   87 (87)
Q Consensus        34 ~~c~~c~~~~~~~~~~~~h~~~~~~~~~~~~c~~c~~~f~~~~~l~~h~~~~h~   87 (87)
                      ..|..||+.|...++|+.|+++|++++| |.|..|++.|.....|+.|+.+|+.
T Consensus       880 h~C~vCgk~FsSSsALqiH~rTHtg~KP-F~C~fC~~aFttrgnLKvHMgtH~w  932 (958)
T KOG1074|consen  880 HVCNVCGKQFSSSAALEIHMRTHTGPKP-FFCHFCEEAFTTRGNLKVHMGTHMW  932 (958)
T ss_pred             hhhccchhcccchHHHHHhhhcCCCCCC-ccchhhhhhhhhhhhhhhhhccccc
Confidence            5799999999999999999999999999 9999999999999999999998863


No 6  
>KOG3623|consensus
Probab=99.54  E-value=1.7e-15  Score=90.65  Aligned_cols=70  Identities=24%  Similarity=0.648  Sum_probs=61.7

Q ss_pred             CCCcccccccchhhhcc------------------------CCcceecCcccccccchhhHHHHhhhhcCCCCCccCCCC
Q psy12019         13 EPKHNKCLINWSAVQQN------------------------HAGMFMCDVCGKGYKYKNGIYRHKKFECGQEPKYQCPQC   68 (87)
Q Consensus        13 ~~~~~~c~~c~~~~~~~------------------------~~~~~~c~~c~~~~~~~~~~~~h~~~~~~~~~~~~c~~c   68 (87)
                      .+..|.|..|..+|-..                        ..+.|.|.+||++|...-.|..|+|+|.|++| |+|+.|
T Consensus       237 ne~nfsC~lCsytFAyRtQLErhm~~hkpg~dqa~sltqsa~lRKFKCtECgKAFKfKHHLKEHlRIHSGEKP-feCpnC  315 (1007)
T KOG3623|consen  237 NEPNFSCMLCSYTFAYRTQLERHMQLHKPGGDQAISLTQSALLRKFKCTECGKAFKFKHHLKEHLRIHSGEKP-FECPNC  315 (1007)
T ss_pred             CCCCCcchhhhhhhhhHHHHHHHHHhhcCCCcccccccchhhhccccccccchhhhhHHHHHhhheeecCCCC-cCCccc
Confidence            34568999999998652                        23469999999999999999999999999999 999999


Q ss_pred             CcccccchHHHhhhh
Q psy12019         69 PYRAKQNAHLTTHMA   83 (87)
Q Consensus        69 ~~~f~~~~~l~~h~~   83 (87)
                      +|+|+++.+...|+.
T Consensus       316 kKRFSHSGSySSHmS  330 (1007)
T KOG3623|consen  316 KKRFSHSGSYSSHMS  330 (1007)
T ss_pred             ccccccCCccccccc
Confidence            999999999998874


No 7  
>KOG3576|consensus
Probab=99.54  E-value=9.7e-16  Score=79.88  Aligned_cols=75  Identities=23%  Similarity=0.491  Sum_probs=64.7

Q ss_pred             CCCCcccccccchhhhcc-----------CCcceecCcccccccchhhHHHHhhhhcCCCCCccCCCCCcccccchHHHh
Q psy12019         12 REPKHNKCLINWSAVQQN-----------HAGMFMCDVCGKGYKYKNGIYRHKKFECGQEPKYQCPQCPYRAKQNAHLTT   80 (87)
Q Consensus        12 ~~~~~~~c~~c~~~~~~~-----------~~~~~~c~~c~~~~~~~~~~~~h~~~~~~~~~~~~c~~c~~~f~~~~~l~~   80 (87)
                      .+...|.|.+|++.|...           ..+.+-|..||+.|...-.|..|.++|+|.+| |.|+.|+|+|.+.-+|..
T Consensus       113 sd~d~ftCrvCgK~F~lQRmlnrh~kch~~vkr~lct~cgkgfndtfdlkrh~rthtgvrp-ykc~~c~kaftqrcsles  191 (267)
T KOG3576|consen  113 SDQDSFTCRVCGKKFGLQRMLNRHLKCHSDVKRHLCTFCGKGFNDTFDLKRHTRTHTGVRP-YKCSLCEKAFTQRCSLES  191 (267)
T ss_pred             CCCCeeeeehhhhhhhHHHHHHHHhhhccHHHHHHHhhccCcccchhhhhhhhccccCccc-cchhhhhHHHHhhccHHH
Confidence            344568999999999753           33457799999999999999999999999998 999999999999999999


Q ss_pred             hhhhcCC
Q psy12019         81 HMAIKHY   87 (87)
Q Consensus        81 h~~~~h~   87 (87)
                      |.+.-|+
T Consensus       192 hl~kvhg  198 (267)
T KOG3576|consen  192 HLKKVHG  198 (267)
T ss_pred             HHHHHcC
Confidence            9876554


No 8  
>PHA00733 hypothetical protein
Probab=99.48  E-value=2.1e-14  Score=71.11  Aligned_cols=73  Identities=15%  Similarity=0.320  Sum_probs=61.8

Q ss_pred             CCCCcccccccchhhhcc----------------CCcceecCcccccccchhhHHHHhhhhcCCCCCccCCCCCcccccc
Q psy12019         12 REPKHNKCLINWSAVQQN----------------HAGMFMCDVCGKGYKYKNGIYRHKKFECGQEPKYQCPQCPYRAKQN   75 (87)
Q Consensus        12 ~~~~~~~c~~c~~~~~~~----------------~~~~~~c~~c~~~~~~~~~~~~h~~~~~~~~~~~~c~~c~~~f~~~   75 (87)
                      ...+++.|.+|...+...                +.++|.|+.||+.|.....|..|++.+  +.+ +.|.+|++.|...
T Consensus        36 ~~~~~~~~~~~~~~~~~~~~l~~~~~l~~~~~~~~~kPy~C~~Cgk~Fss~s~L~~H~r~h--~~~-~~C~~CgK~F~~~  112 (128)
T PHA00733         36 PEQKRLIRAVVKTLIYNPQLLDESSYLYKLLTSKAVSPYVCPLCLMPFSSSVSLKQHIRYT--EHS-KVCPVCGKEFRNT  112 (128)
T ss_pred             hhhhhHHHHHHhhhccChhhhcchHHHHhhcccCCCCCccCCCCCCcCCCHHHHHHHHhcC--CcC-ccCCCCCCccCCH
Confidence            345678898888777543                456899999999999999999999976  355 9999999999999


Q ss_pred             hHHHhhhhhcCC
Q psy12019         76 AHLTTHMAIKHY   87 (87)
Q Consensus        76 ~~l~~h~~~~h~   87 (87)
                      ..|..|+...|.
T Consensus       113 ~sL~~H~~~~h~  124 (128)
T PHA00733        113 DSTLDHVCKKHN  124 (128)
T ss_pred             HHHHHHHHHhcC
Confidence            999999988774


No 9  
>PHA02768 hypothetical protein; Provisional
Probab=99.43  E-value=8.8e-14  Score=58.73  Aligned_cols=44  Identities=14%  Similarity=0.360  Sum_probs=39.6

Q ss_pred             ceecCcccccccchhhHHHHhhhhcCCCCCccCCCCCcccccchHHH
Q psy12019         33 MFMCDVCGKGYKYKNGIYRHKKFECGQEPKYQCPQCPYRAKQNAHLT   79 (87)
Q Consensus        33 ~~~c~~c~~~~~~~~~~~~h~~~~~~~~~~~~c~~c~~~f~~~~~l~   79 (87)
                      .|+|+.||+.|...++|..|++.|+  ++ +.|..|++.|.+.+.|.
T Consensus         5 ~y~C~~CGK~Fs~~~~L~~H~r~H~--k~-~kc~~C~k~f~~~s~l~   48 (55)
T PHA02768          5 GYECPICGEIYIKRKSMITHLRKHN--TN-LKLSNCKRISLRTGEYI   48 (55)
T ss_pred             ccCcchhCCeeccHHHHHHHHHhcC--Cc-ccCCcccceecccceeE
Confidence            4799999999999999999999998  56 99999999999877653


No 10 
>KOG3608|consensus
Probab=99.36  E-value=3e-13  Score=75.68  Aligned_cols=83  Identities=18%  Similarity=0.454  Sum_probs=64.9

Q ss_pred             ccceeeccccCCCCcccccccchhhhcc---------------------------------------CCcceecCccccc
Q psy12019          2 LNVIVKPRTHREPKHNKCLINWSAVQQN---------------------------------------HAGMFMCDVCGKG   42 (87)
Q Consensus         2 ~~l~~h~~~h~~~~~~~c~~c~~~~~~~---------------------------------------~~~~~~c~~c~~~   42 (87)
                      .+|+.|.+.|+++|...|+.|+..|...                                       ....|.|+.|+..
T Consensus       193 ~~LreH~r~Hs~eKvvACp~Cg~~F~~~tkl~DH~rRqt~l~~n~fqC~~C~KrFaTeklL~~Hv~rHvn~ykCplCdmt  272 (467)
T KOG3608|consen  193 YRLREHIRTHSNEKVVACPHCGELFRTKTKLFDHLRRQTELNTNSFQCAQCFKRFATEKLLKSHVVRHVNCYKCPLCDMT  272 (467)
T ss_pred             HHHHHHHHhcCCCeEEecchHHHHhccccHHHHHHHhhhhhcCCchHHHHHHHHHhHHHHHHHHHHHhhhcccccccccC
Confidence            5788999999999999999999999763                                       1224677777777


Q ss_pred             ccchhhHHHHhhhh-cCCCCCccCCCCCcccccchHHHhhhhhc
Q psy12019         43 YKYKNGIYRHKKFE-CGQEPKYQCPQCPYRAKQNAHLTTHMAIK   85 (87)
Q Consensus        43 ~~~~~~~~~h~~~~-~~~~~~~~c~~c~~~f~~~~~l~~h~~~~   85 (87)
                      ....+.|..|++.- ..++| |+|..|.+.+...+.|.+|...|
T Consensus       273 c~~~ssL~~H~r~rHs~dkp-fKCd~Cd~~c~~esdL~kH~~~H  315 (467)
T KOG3608|consen  273 CSSASSLTTHIRYRHSKDKP-FKCDECDTRCVRESDLAKHVQVH  315 (467)
T ss_pred             CCChHHHHHHHHhhhccCCC-ccccchhhhhccHHHHHHHHHhc
Confidence            77778888887753 34455 88888888888888888887754


No 11 
>KOG3576|consensus
Probab=99.15  E-value=5.8e-12  Score=66.05  Aligned_cols=82  Identities=18%  Similarity=0.425  Sum_probs=63.5

Q ss_pred             ceeeccccCCCCcccccccchhhhcc-----------CCcceecCcccccccchhhHHHHhhhhcC-----------CCC
Q psy12019          4 VIVKPRTHREPKHNKCLINWSAVQQN-----------HAGMFMCDVCGKGYKYKNGIYRHKKFECG-----------QEP   61 (87)
Q Consensus         4 l~~h~~~h~~~~~~~c~~c~~~~~~~-----------~~~~~~c~~c~~~~~~~~~~~~h~~~~~~-----------~~~   61 (87)
                      |..|++-|...+-+.|..|++.|...           +.+||.|..|+++|.....|..|.+.-.|           .+.
T Consensus       133 lnrh~kch~~vkr~lct~cgkgfndtfdlkrh~rthtgvrpykc~~c~kaftqrcsleshl~kvhgv~~~yaykerr~kl  212 (267)
T KOG3576|consen  133 LNRHLKCHSDVKRHLCTFCGKGFNDTFDLKRHTRTHTGVRPYKCSLCEKAFTQRCSLESHLKKVHGVQHQYAYKERRAKL  212 (267)
T ss_pred             HHHHhhhccHHHHHHHhhccCcccchhhhhhhhccccCccccchhhhhHHHHhhccHHHHHHHHcCchHHHHHHHhhhhe
Confidence            45677778888888888888888764           66788899999999888888888774333           244


Q ss_pred             CccCCCCCcccccchHHHhhhhhcC
Q psy12019         62 KYQCPQCPYRAKQNAHLTTHMAIKH   86 (87)
Q Consensus        62 ~~~c~~c~~~f~~~~~l~~h~~~~h   86 (87)
                       |.|..||.+-.....+..|+..+|
T Consensus       213 -~vcedcg~t~~~~e~~~~h~~~~h  236 (267)
T KOG3576|consen  213 -YVCEDCGYTSERPEVYYLHLKLHH  236 (267)
T ss_pred             -eeecccCCCCCChhHHHHHHHhcC
Confidence             888899988877777777877765


No 12 
>PF13465 zf-H2C2_2:  Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A ....
Probab=99.13  E-value=4e-11  Score=43.83  Aligned_cols=26  Identities=31%  Similarity=0.782  Sum_probs=23.5

Q ss_pred             hHHHHhhhhcCCCCCccCCCCCccccc
Q psy12019         48 GIYRHKKFECGQEPKYQCPQCPYRAKQ   74 (87)
Q Consensus        48 ~~~~h~~~~~~~~~~~~c~~c~~~f~~   74 (87)
                      +|..|++.|++++| |.|+.|++.|.+
T Consensus         1 ~l~~H~~~H~~~k~-~~C~~C~k~F~~   26 (26)
T PF13465_consen    1 NLRRHMRTHTGEKP-YKCPYCGKSFSN   26 (26)
T ss_dssp             HHHHHHHHHSSSSS-EEESSSSEEESS
T ss_pred             CHHHHhhhcCCCCC-CCCCCCcCeeCc
Confidence            47899999999998 999999999963


No 13 
>PF13465 zf-H2C2_2:  Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A ....
Probab=99.06  E-value=7.7e-12  Score=45.76  Aligned_cols=25  Identities=28%  Similarity=0.258  Sum_probs=22.5

Q ss_pred             cceeeccccCCCCcccccccchhhh
Q psy12019          3 NVIVKPRTHREPKHNKCLINWSAVQ   27 (87)
Q Consensus         3 ~l~~h~~~h~~~~~~~c~~c~~~~~   27 (87)
                      +|..|+++|++++||.|+.|++.|.
T Consensus         1 ~l~~H~~~H~~~k~~~C~~C~k~F~   25 (26)
T PF13465_consen    1 NLRRHMRTHTGEKPYKCPYCGKSFS   25 (26)
T ss_dssp             HHHHHHHHHSSSSSEEESSSSEEES
T ss_pred             CHHHHhhhcCCCCCCCCCCCcCeeC
Confidence            4788999999999999999998875


No 14 
>KOG3608|consensus
Probab=98.93  E-value=5e-10  Score=63.14  Aligned_cols=85  Identities=20%  Similarity=0.296  Sum_probs=65.0

Q ss_pred             ccceeecc-ccCCCCcccccccchhhhcc----------CCcceecCc--ccccccchhhHHHHhhhhc-CCC-CCccCC
Q psy12019          2 LNVIVKPR-THREPKHNKCLINWSAVQQN----------HAGMFMCDV--CGKGYKYKNGIYRHKKFEC-GQE-PKYQCP   66 (87)
Q Consensus         2 ~~l~~h~~-~h~~~~~~~c~~c~~~~~~~----------~~~~~~c~~--c~~~~~~~~~~~~h~~~~~-~~~-~~~~c~   66 (87)
                      +.|..|++ .|+..+||+|..|+..+..+          .+..|.|..  |..++++...+..|.+-+. |.. ++|.|-
T Consensus       277 ssL~~H~r~rHs~dkpfKCd~Cd~~c~~esdL~kH~~~HS~~~y~C~h~~C~~s~r~~~q~~~H~~evhEg~np~~Y~CH  356 (467)
T KOG3608|consen  277 SSLTTHIRYRHSKDKPFKCDECDTRCVRESDLAKHVQVHSKTVYQCEHPDCHYSVRTYTQMRRHFLEVHEGNNPILYACH  356 (467)
T ss_pred             HHHHHHHHhhhccCCCccccchhhhhccHHHHHHHHHhccccceecCCCCCcHHHHHHHHHHHHHHHhccCCCCCceeee
Confidence            45677776 47788899999999888664          344678877  8888888888888887444 433 348999


Q ss_pred             CCCcccccchHHHhhhhhcC
Q psy12019         67 QCPYRAKQNAHLTTHMAIKH   86 (87)
Q Consensus        67 ~c~~~f~~~~~l~~h~~~~h   86 (87)
                      .|.+.|..-.+|..|+.-.|
T Consensus       357 ~Cdr~ft~G~~L~~HL~kkH  376 (467)
T KOG3608|consen  357 CCDRFFTSGKSLSAHLMKKH  376 (467)
T ss_pred             cchhhhccchhHHHHHHHhh
Confidence            99999999999999987555


No 15 
>PHA00732 hypothetical protein
Probab=98.87  E-value=2.2e-09  Score=49.09  Aligned_cols=45  Identities=24%  Similarity=0.496  Sum_probs=37.1

Q ss_pred             ceecCcccccccchhhHHHHhhh-hcCCCCCccCCCCCcccccchHHHhhhhh
Q psy12019         33 MFMCDVCGKGYKYKNGIYRHKKF-ECGQEPKYQCPQCPYRAKQNAHLTTHMAI   84 (87)
Q Consensus        33 ~~~c~~c~~~~~~~~~~~~h~~~-~~~~~~~~~c~~c~~~f~~~~~l~~h~~~   84 (87)
                      ||.|+.||+.|.....|..|++. |.   + +.|++|++.|.   .+..|.+.
T Consensus         1 py~C~~Cgk~F~s~s~Lk~H~r~~H~---~-~~C~~CgKsF~---~l~~H~~~   46 (79)
T PHA00732          1 MFKCPICGFTTVTLFALKQHARRNHT---L-TKCPVCNKSYR---RLNQHFYS   46 (79)
T ss_pred             CccCCCCCCccCCHHHHHHHhhcccC---C-CccCCCCCEeC---Chhhhhcc
Confidence            57899999999999999999984 54   3 78999999997   46677643


No 16 
>PHA00616 hypothetical protein
Probab=98.76  E-value=2.9e-09  Score=43.12  Aligned_cols=26  Identities=23%  Similarity=0.451  Sum_probs=20.2

Q ss_pred             CccCCCCCcccccchHHHhhhhhcCC
Q psy12019         62 KYQCPQCPYRAKQNAHLTTHMAIKHY   87 (87)
Q Consensus        62 ~~~c~~c~~~f~~~~~l~~h~~~~h~   87 (87)
                      ||+|+.||+.|.+.++|..|++.+|+
T Consensus         1 pYqC~~CG~~F~~~s~l~~H~r~~hg   26 (44)
T PHA00616          1 MYQCLRCGGIFRKKKEVIEHLLSVHK   26 (44)
T ss_pred             CCccchhhHHHhhHHHHHHHHHHhcC
Confidence            37788888888888888888877764


No 17 
>PHA00616 hypothetical protein
Probab=98.75  E-value=5e-09  Score=42.43  Aligned_cols=34  Identities=21%  Similarity=0.316  Sum_probs=30.8

Q ss_pred             ceecCcccccccchhhHHHHhhhhcCCCCCccCCC
Q psy12019         33 MFMCDVCGKGYKYKNGIYRHKKFECGQEPKYQCPQ   67 (87)
Q Consensus        33 ~~~c~~c~~~~~~~~~~~~h~~~~~~~~~~~~c~~   67 (87)
                      ||+|..||+.|...+.+..|++.++++++ +.|..
T Consensus         1 pYqC~~CG~~F~~~s~l~~H~r~~hg~~~-~~~~~   34 (44)
T PHA00616          1 MYQCLRCGGIFRKKKEVIEHLLSVHKQNK-LTLEY   34 (44)
T ss_pred             CCccchhhHHHhhHHHHHHHHHHhcCCCc-cceeE
Confidence            58999999999999999999999999988 87653


No 18 
>KOG3993|consensus
Probab=98.73  E-value=1.7e-09  Score=62.17  Aligned_cols=71  Identities=14%  Similarity=0.338  Sum_probs=57.4

Q ss_pred             cccccccchhhhcc-----------CCcceecCcccccccchhhHHHHhhhhcCC--------C----------------
Q psy12019         16 HNKCLINWSAVQQN-----------HAGMFMCDVCGKGYKYKNGIYRHKKFECGQ--------E----------------   60 (87)
Q Consensus        16 ~~~c~~c~~~~~~~-----------~~~~~~c~~c~~~~~~~~~~~~h~~~~~~~--------~----------------   60 (87)
                      .|.|+.|...|.+.           -..-|.|++|+|.|+-..+|..|+|+|.-.        .                
T Consensus       267 dyiCqLCK~kYeD~F~LAQHrC~RIV~vEYrCPEC~KVFsCPANLASHRRWHKPR~eaa~a~~~P~k~~~~~rae~~ea~  346 (500)
T KOG3993|consen  267 DYICQLCKEKYEDAFALAQHRCPRIVHVEYRCPECDKVFSCPANLASHRRWHKPRPEAAKAGSPPPKQAVETRAEVQEAE  346 (500)
T ss_pred             HHHHHHHHHhhhhHHHHhhccCCeeEEeeecCCcccccccCchhhhhhhcccCCchhhhhcCCCChhhhhhhhhhhhhcc
Confidence            47888888887664           223589999999999999999999997521        1                


Q ss_pred             --------CCccCCCCCcccccchHHHhhhhhcC
Q psy12019         61 --------PKYQCPQCPYRAKQNAHLTTHMAIKH   86 (87)
Q Consensus        61 --------~~~~c~~c~~~f~~~~~l~~h~~~~h   86 (87)
                              ..|.|..|+|.|+...-|..|+-.||
T Consensus       347 rsg~dss~gi~~C~~C~KkFrRqAYLrKHqlthq  380 (500)
T KOG3993|consen  347 RSGDDSSSGIFSCHTCGKKFRRQAYLRKHQLTHQ  380 (500)
T ss_pred             ccCCcccCceeecHHhhhhhHHHHHHHHhHHhhh
Confidence                    13789999999999999999987775


No 19 
>PHA02768 hypothetical protein; Provisional
Probab=98.58  E-value=3.1e-08  Score=42.01  Aligned_cols=24  Identities=25%  Similarity=0.570  Sum_probs=23.0

Q ss_pred             ccCCCCCcccccchHHHhhhhhcC
Q psy12019         63 YQCPQCPYRAKQNAHLTTHMAIKH   86 (87)
Q Consensus        63 ~~c~~c~~~f~~~~~l~~h~~~~h   86 (87)
                      |+|++||+.|...+.|..|+++|.
T Consensus         6 y~C~~CGK~Fs~~~~L~~H~r~H~   29 (55)
T PHA02768          6 YECPICGEIYIKRKSMITHLRKHN   29 (55)
T ss_pred             cCcchhCCeeccHHHHHHHHHhcC
Confidence            899999999999999999999975


No 20 
>PLN03086 PRLI-interacting factor K; Provisional
Probab=98.54  E-value=5.8e-08  Score=58.29  Aligned_cols=37  Identities=22%  Similarity=0.444  Sum_probs=18.6

Q ss_pred             ceecCcccccccchhhHHHHhhhhcCCCCCccCCCCCccc
Q psy12019         33 MFMCDVCGKGYKYKNGIYRHKKFECGQEPKYQCPQCPYRA   72 (87)
Q Consensus        33 ~~~c~~c~~~~~~~~~~~~h~~~~~~~~~~~~c~~c~~~f   72 (87)
                      ++.|+ ||+.+ ....|..|+..+...++ +.|..|++.|
T Consensus       478 pv~Cp-Cg~~~-~R~~L~~H~~thCp~Kp-i~C~fC~~~v  514 (567)
T PLN03086        478 PLQCP-CGVVL-EKEQMVQHQASTCPLRL-ITCRFCGDMV  514 (567)
T ss_pred             CccCC-CCCCc-chhHHHhhhhccCCCCc-eeCCCCCCcc
Confidence            44555 55433 33455555555555444 5555555555


No 21 
>PF00096 zf-C2H2:  Zinc finger, C2H2 type;  InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger: #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C], where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter []. This entry represents the classical C2H2 zinc finger domain.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0005622 intracellular; PDB: 2D9H_A 2EPC_A 1SP1_A 1VA3_A 2WBT_B 2ELR_A 2YTP_A 2YTT_A 1VA1_A 2ELO_A ....
Probab=98.53  E-value=3.3e-08  Score=34.88  Aligned_cols=22  Identities=32%  Similarity=0.703  Sum_probs=14.0

Q ss_pred             ccCCCCCcccccchHHHhhhhh
Q psy12019         63 YQCPQCPYRAKQNAHLTTHMAI   84 (87)
Q Consensus        63 ~~c~~c~~~f~~~~~l~~h~~~   84 (87)
                      |.|+.|++.|.....|..|++.
T Consensus         1 y~C~~C~~~f~~~~~l~~H~~~   22 (23)
T PF00096_consen    1 YKCPICGKSFSSKSNLKRHMRR   22 (23)
T ss_dssp             EEETTTTEEESSHHHHHHHHHH
T ss_pred             CCCCCCCCccCCHHHHHHHHhH
Confidence            4566666666666666666655


No 22 
>PF05605 zf-Di19:  Drought induced 19 protein (Di19), zinc-binding;  InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins. Di19 has been found to be strongly expressed in both the roots and leaves of Arabidopsis thaliana during progressive drought [], whilst RING finger proteins are thought to play a role in spermatogenesis. The precise function is unknown.
Probab=98.52  E-value=2.9e-07  Score=39.25  Aligned_cols=52  Identities=27%  Similarity=0.572  Sum_probs=39.2

Q ss_pred             ceecCcccccccchhhHHHHhh-hhcCCCCCccCCCCCcccccchHHHhhhhhcCC
Q psy12019         33 MFMCDVCGKGYKYKNGIYRHKK-FECGQEPKYQCPQCPYRAKQNAHLTTHMAIKHY   87 (87)
Q Consensus        33 ~~~c~~c~~~~~~~~~~~~h~~-~~~~~~~~~~c~~c~~~f~~~~~l~~h~~~~h~   87 (87)
                      .|.|+.|++. .....|..|.. .|..+...+.|++|...+.  .+|..|+.+.|.
T Consensus         2 ~f~CP~C~~~-~~~~~L~~H~~~~H~~~~~~v~CPiC~~~~~--~~l~~Hl~~~H~   54 (54)
T PF05605_consen    2 SFTCPYCGKG-FSESSLVEHCEDEHRSESKNVVCPICSSRVT--DNLIRHLNSQHR   54 (54)
T ss_pred             CcCCCCCCCc-cCHHHHHHHHHhHCcCCCCCccCCCchhhhh--hHHHHHHHHhcC
Confidence            4789999995 45667888866 4555443499999998655  488999998874


No 23 
>PHA00733 hypothetical protein
Probab=98.51  E-value=1e-07  Score=47.47  Aligned_cols=54  Identities=13%  Similarity=0.233  Sum_probs=42.0

Q ss_pred             ceeeccccCCCCcccccccchhhhcc---------CCcceecCcccccccchhhHHHHhhhhcC
Q psy12019          4 VIVKPRTHREPKHNKCLINWSAVQQN---------HAGMFMCDVCGKGYKYKNGIYRHKKFECG   58 (87)
Q Consensus         4 l~~h~~~h~~~~~~~c~~c~~~~~~~---------~~~~~~c~~c~~~~~~~~~~~~h~~~~~~   58 (87)
                      |..++..+ +++||.|..|++.|...         ...++.|+.|++.|.....|..|+....+
T Consensus        62 l~~~~~~~-~~kPy~C~~Cgk~Fss~s~L~~H~r~h~~~~~C~~CgK~F~~~~sL~~H~~~~h~  124 (128)
T PHA00733         62 LYKLLTSK-AVSPYVCPLCLMPFSSSVSLKQHIRYTEHSKVCPVCGKEFRNTDSTLDHVCKKHN  124 (128)
T ss_pred             HHhhcccC-CCCCccCCCCCCcCCCHHHHHHHHhcCCcCccCCCCCCccCCHHHHHHHHHHhcC
Confidence            34444443 47899999999999764         14578999999999999999999876543


No 24 
>PF13894 zf-C2H2_4:  C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A ....
Probab=98.49  E-value=7e-08  Score=34.15  Aligned_cols=24  Identities=33%  Similarity=0.764  Sum_probs=17.2

Q ss_pred             ccCCCCCcccccchHHHhhhhhcC
Q psy12019         63 YQCPQCPYRAKQNAHLTTHMAIKH   86 (87)
Q Consensus        63 ~~c~~c~~~f~~~~~l~~h~~~~h   86 (87)
                      |.|+.|++.|.+...|..|+..+|
T Consensus         1 ~~C~~C~~~~~~~~~l~~H~~~~H   24 (24)
T PF13894_consen    1 FQCPICGKSFRSKSELRQHMRTHH   24 (24)
T ss_dssp             EE-SSTS-EESSHHHHHHHHHHHS
T ss_pred             CCCcCCCCcCCcHHHHHHHHHhhC
Confidence            467788888888888888887766


No 25 
>PF13912 zf-C2H2_6:  C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B.
Probab=98.40  E-value=1.5e-07  Score=34.48  Aligned_cols=24  Identities=17%  Similarity=0.382  Sum_probs=16.3

Q ss_pred             ccCCCCCcccccchHHHhhhhhcC
Q psy12019         63 YQCPQCPYRAKQNAHLTTHMAIKH   86 (87)
Q Consensus        63 ~~c~~c~~~f~~~~~l~~h~~~~h   86 (87)
                      |.|..|++.|.....|..|++.|+
T Consensus         2 ~~C~~C~~~F~~~~~l~~H~~~h~   25 (27)
T PF13912_consen    2 FECDECGKTFSSLSALREHKRSHC   25 (27)
T ss_dssp             EEETTTTEEESSHHHHHHHHCTTT
T ss_pred             CCCCccCCccCChhHHHHHhHHhc
Confidence            666777777777777777766654


No 26 
>PF00096 zf-C2H2:  Zinc finger, C2H2 type;  InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger: #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C], where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter []. This entry represents the classical C2H2 zinc finger domain.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0005622 intracellular; PDB: 2D9H_A 2EPC_A 1SP1_A 1VA3_A 2WBT_B 2ELR_A 2YTP_A 2YTT_A 1VA1_A 2ELO_A ....
Probab=98.38  E-value=3.5e-07  Score=32.17  Aligned_cols=23  Identities=30%  Similarity=0.826  Sum_probs=21.0

Q ss_pred             eecCcccccccchhhHHHHhhhh
Q psy12019         34 FMCDVCGKGYKYKNGIYRHKKFE   56 (87)
Q Consensus        34 ~~c~~c~~~~~~~~~~~~h~~~~   56 (87)
                      |.|+.|++.|.....|..|++.|
T Consensus         1 y~C~~C~~~f~~~~~l~~H~~~H   23 (23)
T PF00096_consen    1 YKCPICGKSFSSKSNLKRHMRRH   23 (23)
T ss_dssp             EEETTTTEEESSHHHHHHHHHHH
T ss_pred             CCCCCCCCccCCHHHHHHHHhHC
Confidence            68999999999999999999864


No 27 
>PLN03086 PRLI-interacting factor K; Provisional
Probab=98.35  E-value=9.1e-07  Score=53.38  Aligned_cols=77  Identities=14%  Similarity=0.318  Sum_probs=45.3

Q ss_pred             ceeeccccCCCCcccccccchhhhcc----------CCcceecCcccccccc----------hhhHHHHhhhhcCCCCCc
Q psy12019          4 VIVKPRTHREPKHNKCLINWSAVQQN----------HAGMFMCDVCGKGYKY----------KNGIYRHKKFECGQEPKY   63 (87)
Q Consensus         4 l~~h~~~h~~~~~~~c~~c~~~~~~~----------~~~~~~c~~c~~~~~~----------~~~~~~h~~~~~~~~~~~   63 (87)
                      |..|..++.  +++.|+ |+..+...          ..+++.|..|+..+..          .+.|..|.... |.++ +
T Consensus       468 LekH~~~~H--kpv~Cp-Cg~~~~R~~L~~H~~thCp~Kpi~C~fC~~~v~~g~~~~d~~d~~s~Lt~HE~~C-G~rt-~  542 (567)
T PLN03086        468 MEKHMKVFH--EPLQCP-CGVVLEKEQMVQHQASTCPLRLITCRFCGDMVQAGGSAMDVRDRLRGMSEHESIC-GSRT-A  542 (567)
T ss_pred             HHHHHHhcC--CCccCC-CCCCcchhHHHhhhhccCCCCceeCCCCCCccccCccccchhhhhhhHHHHHHhc-CCcc-e
Confidence            445555542  567776 76544321          3456777777776642          23566776664 5566 7


Q ss_pred             cCCCCCcccccchHHHhhhhhcC
Q psy12019         64 QCPQCPYRAKQNAHLTTHMAIKH   86 (87)
Q Consensus        64 ~c~~c~~~f~~~~~l~~h~~~~h   86 (87)
                      .|..||+.+... .+..|+..-|
T Consensus       543 ~C~~Cgk~Vrlr-dm~~H~~~~h  564 (567)
T PLN03086        543 PCDSCGRSVMLK-EMDIHQIAVH  564 (567)
T ss_pred             EccccCCeeeeh-hHHHHHHHhh
Confidence            777777776644 4566655443


No 28 
>PF13912 zf-C2H2_6:  C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B.
Probab=98.13  E-value=1.9e-06  Score=31.42  Aligned_cols=25  Identities=36%  Similarity=0.828  Sum_probs=22.7

Q ss_pred             ceecCcccccccchhhHHHHhhhhc
Q psy12019         33 MFMCDVCGKGYKYKNGIYRHKKFEC   57 (87)
Q Consensus        33 ~~~c~~c~~~~~~~~~~~~h~~~~~   57 (87)
                      +|.|+.|++.|.....|..|++.|.
T Consensus         1 ~~~C~~C~~~F~~~~~l~~H~~~h~   25 (27)
T PF13912_consen    1 PFECDECGKTFSSLSALREHKRSHC   25 (27)
T ss_dssp             SEEETTTTEEESSHHHHHHHHCTTT
T ss_pred             CCCCCccCCccCChhHHHHHhHHhc
Confidence            5889999999999999999998764


No 29 
>smart00355 ZnF_C2H2 zinc finger.
Probab=98.08  E-value=2.8e-06  Score=30.29  Aligned_cols=23  Identities=35%  Similarity=0.751  Sum_probs=18.1

Q ss_pred             ccCCCCCcccccchHHHhhhhhc
Q psy12019         63 YQCPQCPYRAKQNAHLTTHMAIK   85 (87)
Q Consensus        63 ~~c~~c~~~f~~~~~l~~h~~~~   85 (87)
                      |.|..|++.|.....|..|++.|
T Consensus         1 ~~C~~C~~~f~~~~~l~~H~~~H   23 (26)
T smart00355        1 YRCPECGKVFKSKSALKEHMRTH   23 (26)
T ss_pred             CCCCCCcchhCCHHHHHHHHHHh
Confidence            46788888888888888888754


No 30 
>PF09237 GAGA:  GAGA factor;  InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  Members of this entry bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 1YUI_A 1YUJ_A.
Probab=98.00  E-value=2.8e-06  Score=35.29  Aligned_cols=26  Identities=31%  Similarity=0.723  Sum_probs=18.4

Q ss_pred             CccCCCCCcccccchHHHhhhhhcCC
Q psy12019         62 KYQCPQCPYRAKQNAHLTTHMAIKHY   87 (87)
Q Consensus        62 ~~~c~~c~~~f~~~~~l~~h~~~~h~   87 (87)
                      |-.|++|+..+++..+|.+|+.+.|+
T Consensus        24 PatCP~C~a~~~~srnLrRHle~~H~   49 (54)
T PF09237_consen   24 PATCPICGAVIRQSRNLRRHLEIRHF   49 (54)
T ss_dssp             -EE-TTT--EESSHHHHHHHHHHHTT
T ss_pred             CCCCCcchhhccchhhHHHHHHHHhc
Confidence            38888888888888888888888775


No 31 
>PF13894 zf-C2H2_4:  C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A ....
Probab=97.89  E-value=1.4e-05  Score=27.93  Aligned_cols=23  Identities=30%  Similarity=0.852  Sum_probs=19.0

Q ss_pred             eecCcccccccchhhHHHHhhhh
Q psy12019         34 FMCDVCGKGYKYKNGIYRHKKFE   56 (87)
Q Consensus        34 ~~c~~c~~~~~~~~~~~~h~~~~   56 (87)
                      |.|+.|++.|.....+..|+..+
T Consensus         1 ~~C~~C~~~~~~~~~l~~H~~~~   23 (24)
T PF13894_consen    1 FQCPICGKSFRSKSELRQHMRTH   23 (24)
T ss_dssp             EE-SSTS-EESSHHHHHHHHHHH
T ss_pred             CCCcCCCCcCCcHHHHHHHHHhh
Confidence            67999999999999999999865


No 32 
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning]
Probab=97.88  E-value=2.9e-06  Score=47.83  Aligned_cols=26  Identities=35%  Similarity=0.616  Sum_probs=21.9

Q ss_pred             CCCccCCCCCcccccchHHHhhhhhcC
Q psy12019         60 EPKYQCPQCPYRAKQNAHLTTHMAIKH   86 (87)
Q Consensus        60 ~~~~~c~~c~~~f~~~~~l~~h~~~~h   86 (87)
                      +| |.|++|+|++.....|+-|..-.|
T Consensus       397 KP-YrCevC~KRYKNlNGLKYHr~Hsh  422 (423)
T COG5189         397 KP-YRCEVCDKRYKNLNGLKYHRKHSH  422 (423)
T ss_pred             Cc-eeccccchhhccCccceecccccC
Confidence            55 999999999999999988876543


No 33 
>PRK04860 hypothetical protein; Provisional
Probab=97.73  E-value=3.2e-05  Score=40.04  Aligned_cols=39  Identities=21%  Similarity=0.483  Sum_probs=33.2

Q ss_pred             cceecCcccccccchhhHHHHhhhhcCCCCCccCCCCCcccccc
Q psy12019         32 GMFMCDVCGKGYKYKNGIYRHKKFECGQEPKYQCPQCPYRAKQN   75 (87)
Q Consensus        32 ~~~~c~~c~~~~~~~~~~~~h~~~~~~~~~~~~c~~c~~~f~~~   75 (87)
                      -+|.|. |+.   ....+..|.++++++++ |.|..|+..|...
T Consensus       118 ~~Y~C~-C~~---~~~~~rrH~ri~~g~~~-YrC~~C~~~l~~~  156 (160)
T PRK04860        118 FPYRCK-CQE---HQLTVRRHNRVVRGEAV-YRCRRCGETLVFK  156 (160)
T ss_pred             EEEEcC-CCC---eeCHHHHHHHHhcCCcc-EECCCCCceeEEe
Confidence            368997 987   66778899999999998 9999999988654


No 34 
>PF12756 zf-C2H2_2:  C2H2 type zinc-finger (2 copies); PDB: 2DMI_A.
Probab=97.67  E-value=3e-05  Score=36.68  Aligned_cols=22  Identities=27%  Similarity=0.670  Sum_probs=16.4

Q ss_pred             ccCCCCCcccccchHHHhhhhh
Q psy12019         63 YQCPQCPYRAKQNAHLTTHMAI   84 (87)
Q Consensus        63 ~~c~~c~~~f~~~~~l~~h~~~   84 (87)
                      +.|..|++.|.....|..|++.
T Consensus        51 ~~C~~C~~~f~s~~~l~~Hm~~   72 (100)
T PF12756_consen   51 FRCPYCNKTFRSREALQEHMRS   72 (100)
T ss_dssp             EEBSSSS-EESSHHHHHHHHHH
T ss_pred             CCCCccCCCCcCHHHHHHHHcC
Confidence            7788888888888888888764


No 35 
>smart00355 ZnF_C2H2 zinc finger.
Probab=97.67  E-value=4.8e-05  Score=26.89  Aligned_cols=24  Identities=29%  Similarity=0.663  Sum_probs=21.1

Q ss_pred             eecCcccccccchhhHHHHhhhhc
Q psy12019         34 FMCDVCGKGYKYKNGIYRHKKFEC   57 (87)
Q Consensus        34 ~~c~~c~~~~~~~~~~~~h~~~~~   57 (87)
                      +.|..|++.|.....+..|++.|.
T Consensus         1 ~~C~~C~~~f~~~~~l~~H~~~H~   24 (26)
T smart00355        1 YRCPECGKVFKSKSALKEHMRTHX   24 (26)
T ss_pred             CCCCCCcchhCCHHHHHHHHHHhc
Confidence            478999999999999999998664


No 36 
>PF13909 zf-H2C2_5:  C2H2-type zinc-finger domain; PDB: 1X5W_A.
Probab=97.64  E-value=2.4e-05  Score=27.66  Aligned_cols=24  Identities=33%  Similarity=0.920  Sum_probs=16.3

Q ss_pred             ccCCCCCcccccchHHHhhhhhcCC
Q psy12019         63 YQCPQCPYRAKQNAHLTTHMAIKHY   87 (87)
Q Consensus        63 ~~c~~c~~~f~~~~~l~~h~~~~h~   87 (87)
                      |.|+.|+.... ...|..|++.+|+
T Consensus         1 y~C~~C~y~t~-~~~l~~H~~~~H~   24 (24)
T PF13909_consen    1 YKCPHCSYSTS-KSNLKRHLKRHHP   24 (24)
T ss_dssp             EE-SSSS-EES-HHHHHHHHHHHHS
T ss_pred             CCCCCCCCcCC-HHHHHHHHHhhCc
Confidence            46778887776 7788888877763


No 37 
>PF12874 zf-met:  Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A.
Probab=97.46  E-value=0.00011  Score=26.09  Aligned_cols=22  Identities=32%  Similarity=0.857  Sum_probs=11.8

Q ss_pred             eecCcccccccchhhHHHHhhh
Q psy12019         34 FMCDVCGKGYKYKNGIYRHKKF   55 (87)
Q Consensus        34 ~~c~~c~~~~~~~~~~~~h~~~   55 (87)
                      |.|+.|++.|.....+.+|++.
T Consensus         1 ~~C~~C~~~f~s~~~~~~H~~s   22 (25)
T PF12874_consen    1 FYCDICNKSFSSENSLRQHLRS   22 (25)
T ss_dssp             EEETTTTEEESSHHHHHHHHTT
T ss_pred             CCCCCCCCCcCCHHHHHHHHCc
Confidence            3455555555555555555543


No 38 
>PF12874 zf-met:  Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A.
Probab=97.41  E-value=7e-05  Score=26.59  Aligned_cols=22  Identities=18%  Similarity=0.443  Sum_probs=19.9

Q ss_pred             ccCCCCCcccccchHHHhhhhh
Q psy12019         63 YQCPQCPYRAKQNAHLTTHMAI   84 (87)
Q Consensus        63 ~~c~~c~~~f~~~~~l~~h~~~   84 (87)
                      |.|..|++.|.....+..|++.
T Consensus         1 ~~C~~C~~~f~s~~~~~~H~~s   22 (25)
T PF12874_consen    1 FYCDICNKSFSSENSLRQHLRS   22 (25)
T ss_dssp             EEETTTTEEESSHHHHHHHHTT
T ss_pred             CCCCCCCCCcCCHHHHHHHHCc
Confidence            5689999999999999999875


No 39 
>PHA00732 hypothetical protein
Probab=97.40  E-value=9e-05  Score=34.03  Aligned_cols=38  Identities=24%  Similarity=0.349  Sum_probs=28.2

Q ss_pred             cccccccchhhhcc---------CCcceecCcccccccchhhHHHHhhhh
Q psy12019         16 HNKCLINWSAVQQN---------HAGMFMCDVCGKGYKYKNGIYRHKKFE   56 (87)
Q Consensus        16 ~~~c~~c~~~~~~~---------~~~~~~c~~c~~~~~~~~~~~~h~~~~   56 (87)
                      ||.|..|++.|...         ...++.|+.||+.|.   .+..|....
T Consensus         1 py~C~~Cgk~F~s~s~Lk~H~r~~H~~~~C~~CgKsF~---~l~~H~~~~   47 (79)
T PHA00732          1 MFKCPICGFTTVTLFALKQHARRNHTLTKCPVCNKSYR---RLNQHFYSQ   47 (79)
T ss_pred             CccCCCCCCccCCHHHHHHHhhcccCCCccCCCCCEeC---Chhhhhccc
Confidence            68899999999764         123578999999997   466676543


No 40 
>PF05605 zf-Di19:  Drought induced 19 protein (Di19), zinc-binding;  InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins. Di19 has been found to be strongly expressed in both the roots and leaves of Arabidopsis thaliana during progressive drought [], whilst RING finger proteins are thought to play a role in spermatogenesis. The precise function is unknown.
Probab=97.22  E-value=0.00034  Score=29.73  Aligned_cols=40  Identities=13%  Similarity=0.322  Sum_probs=28.4

Q ss_pred             cccccccchhhhcc------------CCcceecCcccccccchhhHHHHhhhhc
Q psy12019         16 HNKCLINWSAVQQN------------HAGMFMCDVCGKGYKYKNGIYRHKKFEC   57 (87)
Q Consensus        16 ~~~c~~c~~~~~~~------------~~~~~~c~~c~~~~~~~~~~~~h~~~~~   57 (87)
                      .|.|+.|++.|...            ..+.+.|+.|...+.  .++..|+..+.
T Consensus         2 ~f~CP~C~~~~~~~~L~~H~~~~H~~~~~~v~CPiC~~~~~--~~l~~Hl~~~H   53 (54)
T PF05605_consen    2 SFTCPYCGKGFSESSLVEHCEDEHRSESKNVVCPICSSRVT--DNLIRHLNSQH   53 (54)
T ss_pred             CcCCCCCCCccCHHHHHHHHHhHCcCCCCCccCCCchhhhh--hHHHHHHHHhc
Confidence            58899999966532            334688999997644  47888877643


No 41 
>PF12171 zf-C2H2_jaz:  Zinc-finger double-stranded RNA-binding;  InterPro: IPR022755  This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length. The mammalian members of this group occur multiple times along the protein, joined by flexible linkers, and are referred to as JAZ - dsRNA-binding ZF protein - zinc-fingers. The JAZ proteins are expressed in all tissues tested and localise in the nucleus, particularly the nucleolus []. JAZ preferentially binds to double-stranded (ds) RNA or RNA/DNA hybrids rather than DNA. In addition to binding double-stranded RNA, these zinc-fingers are required for nucleolar localisation.   This entry represents the multiple-adjacent-C2H2 zinc finger, JAZ. ; PDB: 4DGW_A 1ZR9_A.
Probab=97.20  E-value=0.00023  Score=25.84  Aligned_cols=21  Identities=24%  Similarity=0.551  Sum_probs=14.1

Q ss_pred             ccCCCCCcccccchHHHhhhh
Q psy12019         63 YQCPQCPYRAKQNAHLTTHMA   83 (87)
Q Consensus        63 ~~c~~c~~~f~~~~~l~~h~~   83 (87)
                      |-|..|++.|.....+..|++
T Consensus         2 ~~C~~C~k~f~~~~~~~~H~~   22 (27)
T PF12171_consen    2 FYCDACDKYFSSENQLKQHMK   22 (27)
T ss_dssp             CBBTTTTBBBSSHHHHHCCTT
T ss_pred             CCcccCCCCcCCHHHHHHHHc
Confidence            556677777777777766664


No 42 
>PF12171 zf-C2H2_jaz:  Zinc-finger double-stranded RNA-binding;  InterPro: IPR022755  This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length. The mammalian members of this group occur multiple times along the protein, joined by flexible linkers, and are referred to as JAZ - dsRNA-binding ZF protein - zinc-fingers. The JAZ proteins are expressed in all tissues tested and localise in the nucleus, particularly the nucleolus []. JAZ preferentially binds to double-stranded (ds) RNA or RNA/DNA hybrids rather than DNA. In addition to binding double-stranded RNA, these zinc-fingers are required for nucleolar localisation.   This entry represents the multiple-adjacent-C2H2 zinc finger, JAZ. ; PDB: 4DGW_A 1ZR9_A.
Probab=97.09  E-value=0.00027  Score=25.62  Aligned_cols=22  Identities=36%  Similarity=0.733  Sum_probs=19.8

Q ss_pred             eecCcccccccchhhHHHHhhh
Q psy12019         34 FMCDVCGKGYKYKNGIYRHKKF   55 (87)
Q Consensus        34 ~~c~~c~~~~~~~~~~~~h~~~   55 (87)
                      |.|..|++.|.....+..|++.
T Consensus         2 ~~C~~C~k~f~~~~~~~~H~~s   23 (27)
T PF12171_consen    2 FYCDACDKYFSSENQLKQHMKS   23 (27)
T ss_dssp             CBBTTTTBBBSSHHHHHCCTTS
T ss_pred             CCcccCCCCcCCHHHHHHHHcc
Confidence            6799999999999999999875


No 43 
>KOG3993|consensus
Probab=97.08  E-value=8.7e-05  Score=43.55  Aligned_cols=52  Identities=21%  Similarity=0.482  Sum_probs=45.2

Q ss_pred             ceecCcccccccchhhHHHHhhhhcCCCCCccCCCCCcccccchHHHhhhhhc
Q psy12019         33 MFMCDVCGKGYKYKNGIYRHKKFECGQEPKYQCPQCPYRAKQNAHLTTHMAIK   85 (87)
Q Consensus        33 ~~~c~~c~~~~~~~~~~~~h~~~~~~~~~~~~c~~c~~~f~~~~~l~~h~~~~   85 (87)
                      .|.|..|...|...-.|.+|.-.-+...- |.|++|+|.|+=..+|-.|.|-|
T Consensus       267 dyiCqLCK~kYeD~F~LAQHrC~RIV~vE-YrCPEC~KVFsCPANLASHRRWH  318 (500)
T KOG3993|consen  267 DYICQLCKEKYEDAFALAQHRCPRIVHVE-YRCPECDKVFSCPANLASHRRWH  318 (500)
T ss_pred             HHHHHHHHHhhhhHHHHhhccCCeeEEee-ecCCcccccccCchhhhhhhccc
Confidence            58899999999999999999876666555 99999999999999999998754


No 44 
>PF09237 GAGA:  GAGA factor;  InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  Members of this entry bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 1YUI_A 1YUJ_A.
Probab=96.97  E-value=0.0015  Score=27.36  Aligned_cols=31  Identities=19%  Similarity=0.421  Sum_probs=21.9

Q ss_pred             CcceecCcccccccchhhHHHHhhhhcCCCC
Q psy12019         31 AGMFMCDVCGKGYKYKNGIYRHKKFECGQEP   61 (87)
Q Consensus        31 ~~~~~c~~c~~~~~~~~~~~~h~~~~~~~~~   61 (87)
                      ..|-.|+.|+..++...+|..|+....+.+|
T Consensus        22 ~~PatCP~C~a~~~~srnLrRHle~~H~~k~   52 (54)
T PF09237_consen   22 EQPATCPICGAVIRQSRNLRRHLEIRHFKKP   52 (54)
T ss_dssp             S--EE-TTT--EESSHHHHHHHHHHHTTTS-
T ss_pred             CCCCCCCcchhhccchhhHHHHHHHHhcccC
Confidence            3577899999999999999999988777554


No 45 
>PF13913 zf-C2HC_2:  zinc-finger of a C2HC-type
Probab=96.87  E-value=0.001  Score=23.74  Aligned_cols=20  Identities=25%  Similarity=0.536  Sum_probs=11.8

Q ss_pred             ccCCCCCcccccchHHHhhhh
Q psy12019         63 YQCPQCPYRAKQNAHLTTHMA   83 (87)
Q Consensus        63 ~~c~~c~~~f~~~~~l~~h~~   83 (87)
                      ..|+.||+.| ....|..|+.
T Consensus         3 ~~C~~CgR~F-~~~~l~~H~~   22 (25)
T PF13913_consen    3 VPCPICGRKF-NPDRLEKHEK   22 (25)
T ss_pred             CcCCCCCCEE-CHHHHHHHHH
Confidence            3566677777 3445566654


No 46 
>PF12756 zf-C2H2_2:  C2H2 type zinc-finger (2 copies); PDB: 2DMI_A.
Probab=96.77  E-value=0.0014  Score=30.88  Aligned_cols=25  Identities=20%  Similarity=0.580  Sum_probs=21.7

Q ss_pred             ceecCcccccccchhhHHHHhhhhc
Q psy12019         33 MFMCDVCGKGYKYKNGIYRHKKFEC   57 (87)
Q Consensus        33 ~~~c~~c~~~~~~~~~~~~h~~~~~   57 (87)
                      .+.|..|++.|.....|..|++.+.
T Consensus        50 ~~~C~~C~~~f~s~~~l~~Hm~~~~   74 (100)
T PF12756_consen   50 SFRCPYCNKTFRSREALQEHMRSKH   74 (100)
T ss_dssp             SEEBSSSS-EESSHHHHHHHHHHTT
T ss_pred             CCCCCccCCCCcCHHHHHHHHcCcc
Confidence            5899999999999999999999753


No 47 
>COG2888 Predicted Zn-ribbon RNA-binding protein with a function in translation [Translation, ribosomal structure and biogenesis]
Probab=96.42  E-value=0.0047  Score=26.64  Aligned_cols=49  Identities=27%  Similarity=0.548  Sum_probs=31.5

Q ss_pred             cccccccchhh-hccCCcceecCcccccccchhhHHHHhhhhcCCCCCccCCCCCc
Q psy12019         16 HNKCLINWSAV-QQNHAGMFMCDVCGKGYKYKNGIYRHKKFECGQEPKYQCPQCPY   70 (87)
Q Consensus        16 ~~~c~~c~~~~-~~~~~~~~~c~~c~~~~~~~~~~~~h~~~~~~~~~~~~c~~c~~   70 (87)
                      +-.|..|+... ..++...|.|+.||+..-....     +--....+ |.|+.||-
T Consensus         9 ~~~CtSCg~~i~p~e~~v~F~CPnCGe~~I~Rc~-----~CRk~g~~-Y~Cp~CGF   58 (61)
T COG2888           9 PPVCTSCGREIAPGETAVKFPCPNCGEVEIYRCA-----KCRKLGNP-YRCPKCGF   58 (61)
T ss_pred             CceeccCCCEeccCCceeEeeCCCCCceeeehhh-----hHHHcCCc-eECCCcCc
Confidence            45677787776 3334557899999966544432     22223366 99999984


No 48 
>PF09538 FYDLN_acid:  Protein of unknown function (FYDLN_acid);  InterPro: IPR012644 Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues. The function of members of this family is unknown.
Probab=96.41  E-value=0.0023  Score=31.18  Aligned_cols=30  Identities=13%  Similarity=0.326  Sum_probs=23.7

Q ss_pred             ccccccchhhhccCCcceecCcccccccch
Q psy12019         17 NKCLINWSAVQQNHAGMFMCDVCGKGYKYK   46 (87)
Q Consensus        17 ~~c~~c~~~~~~~~~~~~~c~~c~~~~~~~   46 (87)
                      -.|+.|+..|-..+..|..|+.||..|...
T Consensus        10 R~Cp~CG~kFYDLnk~PivCP~CG~~~~~~   39 (108)
T PF09538_consen   10 RTCPSCGAKFYDLNKDPIVCPKCGTEFPPE   39 (108)
T ss_pred             ccCCCCcchhccCCCCCccCCCCCCccCcc
Confidence            368888888888877888888888877665


No 49 
>smart00451 ZnF_U1 U1-like zinc finger. Family of C2H2-type zinc fingers, present in matrin, U1 small nuclear ribonucleoprotein C and other RNA-binding proteins.
Probab=96.08  E-value=0.0043  Score=23.62  Aligned_cols=21  Identities=14%  Similarity=0.498  Sum_probs=13.8

Q ss_pred             ccCCCCCcccccchHHHhhhh
Q psy12019         63 YQCPQCPYRAKQNAHLTTHMA   83 (87)
Q Consensus        63 ~~c~~c~~~f~~~~~l~~h~~   83 (87)
                      |.|..|++.|.....+..|+.
T Consensus         4 ~~C~~C~~~~~~~~~~~~H~~   24 (35)
T smart00451        4 FYCKLCNVTFTDEISVEAHLK   24 (35)
T ss_pred             eEccccCCccCCHHHHHHHHC
Confidence            567777777776666666653


No 50 
>PRK14890 putative Zn-ribbon RNA-binding protein; Provisional
Probab=96.02  E-value=0.014  Score=25.22  Aligned_cols=50  Identities=28%  Similarity=0.633  Sum_probs=31.5

Q ss_pred             CcccccccchhhhccC-CcceecCcccccccchhhHHHHhhhhcCCCCCccCCCCCc
Q psy12019         15 KHNKCLINWSAVQQNH-AGMFMCDVCGKGYKYKNGIYRHKKFECGQEPKYQCPQCPY   70 (87)
Q Consensus        15 ~~~~c~~c~~~~~~~~-~~~~~c~~c~~~~~~~~~~~~h~~~~~~~~~~~~c~~c~~   70 (87)
                      .+..|..|+......+ ...|.|+.||+.....-.     +--....+ |.|+.||.
T Consensus         6 ~~~~CtSCg~~i~~~~~~~~F~CPnCG~~~I~RC~-----~CRk~~~~-Y~CP~CGF   56 (59)
T PRK14890          6 EPPKCTSCGIEIAPREKAVKFLCPNCGEVIIYRCE-----KCRKQSNP-YTCPKCGF   56 (59)
T ss_pred             cCccccCCCCcccCCCccCEeeCCCCCCeeEeech-----hHHhcCCc-eECCCCCC
Confidence            3557888887766443 457899999986333321     11122255 99999984


No 51 
>cd00350 rubredoxin_like Rubredoxin_like; nonheme iron binding domain containing a [Fe(SCys)4] center. The family includes rubredoxins, a small electron transfer protein, and a slightly smaller modular rubredoxin domain present in rubrerythrin and nigerythrin and detected either N- or C-terminal to such proteins as flavin reductase, NAD(P)H-nitrite reductase, and ferredoxin-thioredoxin reductase. In rubredoxin, the iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), but iron can also be replaced by cobalt, nickel or zinc and believed to be involved in electron transfer.  Rubrerythrins and nigerythrins are small homodimeric proteins, generally consisting of 2 domains: a rubredoxin domain C-terminal to a non-sulfur, oxo-bridged diiron site in the N-terminal rubrerythrin domain.  Rubrerythrins and nigerythrins have putative peroxide activity.
Probab=95.84  E-value=0.009  Score=22.72  Aligned_cols=8  Identities=38%  Similarity=1.161  Sum_probs=5.2

Q ss_pred             ccCCCCCc
Q psy12019         63 YQCPQCPY   70 (87)
Q Consensus        63 ~~c~~c~~   70 (87)
                      +.|++||.
T Consensus        18 ~~CP~Cg~   25 (33)
T cd00350          18 WVCPVCGA   25 (33)
T ss_pred             CcCcCCCC
Confidence            66777653


No 52 
>smart00659 RPOLCX RNA polymerase subunit CX. present in RNA polymerase I, II and III
Probab=95.35  E-value=0.01  Score=24.17  Aligned_cols=24  Identities=17%  Similarity=0.282  Sum_probs=10.7

Q ss_pred             ccccccchhhhccCCcceecCccc
Q psy12019         17 NKCLINWSAVQQNHAGMFMCDVCG   40 (87)
Q Consensus        17 ~~c~~c~~~~~~~~~~~~~c~~c~   40 (87)
                      |.|..|+..+......+..|+.||
T Consensus         3 Y~C~~Cg~~~~~~~~~~irC~~CG   26 (44)
T smart00659        3 YICGECGRENEIKSKDVVRCRECG   26 (44)
T ss_pred             EECCCCCCEeecCCCCceECCCCC
Confidence            444444444443333344444444


No 53 
>PF03604 DNA_RNApol_7kD:  DNA directed RNA polymerase, 7 kDa subunit;  InterPro: IPR006591 DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Each class of RNA polymerase is assembled from 9 to 15 different polypeptides. Rbp10 (RNA polymerase CX) is a domain found in RNA polymerase subunit 10; present in RNA polymerase I, II and III.; GO: 0003677 DNA binding, 0003899 DNA-directed RNA polymerase activity, 0006351 transcription, DNA-dependent; PDB: 2PMZ_Z 3HKZ_X 2NVX_L 3S1Q_L 2JA6_L 3S17_L 3HOW_L 3HOV_L 3PO2_L 3HOZ_L ....
Probab=95.34  E-value=0.011  Score=22.37  Aligned_cols=8  Identities=38%  Similarity=1.219  Sum_probs=3.5

Q ss_pred             ccCCCCCc
Q psy12019         63 YQCPQCPY   70 (87)
Q Consensus        63 ~~c~~c~~   70 (87)
                      ..|+.||.
T Consensus        18 irC~~CG~   25 (32)
T PF03604_consen   18 IRCPECGH   25 (32)
T ss_dssp             SSBSSSS-
T ss_pred             EECCcCCC
Confidence            45555543


No 54 
>PRK04860 hypothetical protein; Provisional
Probab=95.32  E-value=0.0029  Score=32.93  Aligned_cols=30  Identities=17%  Similarity=0.416  Sum_probs=18.9

Q ss_pred             cccccccchhhhcc--------CCcceecCcccccccch
Q psy12019         16 HNKCLINWSAVQQN--------HAGMFMCDVCGKGYKYK   46 (87)
Q Consensus        16 ~~~c~~c~~~~~~~--------~~~~~~c~~c~~~~~~~   46 (87)
                      +|.|. |+....+.        +.++|.|..|+..|...
T Consensus       119 ~Y~C~-C~~~~~~~rrH~ri~~g~~~YrC~~C~~~l~~~  156 (160)
T PRK04860        119 PYRCK-CQEHQLTVRRHNRVVRGEAVYRCRRCGETLVFK  156 (160)
T ss_pred             EEEcC-CCCeeCHHHHHHHHhcCCccEECCCCCceeEEe
Confidence            67786 76633221        45678888888776543


No 55 
>TIGR02300 FYDLN_acid conserved hypothetical protein TIGR02300. Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues. The function of members of this family is unknown.
Probab=95.29  E-value=0.012  Score=29.38  Aligned_cols=32  Identities=9%  Similarity=0.047  Sum_probs=24.8

Q ss_pred             ccccccchhhhccCCcceecCcccccccchhh
Q psy12019         17 NKCLINWSAVQQNHAGMFMCDVCGKGYKYKNG   48 (87)
Q Consensus        17 ~~c~~c~~~~~~~~~~~~~c~~c~~~~~~~~~   48 (87)
                      ..|+.|+..|-..+..|..|+.||..|.....
T Consensus        10 r~Cp~cg~kFYDLnk~p~vcP~cg~~~~~~~~   41 (129)
T TIGR02300        10 RICPNTGSKFYDLNRRPAVSPYTGEQFPPEEA   41 (129)
T ss_pred             ccCCCcCccccccCCCCccCCCcCCccCcchh
Confidence            46888888888887788888888887765533


No 56 
>PRK00398 rpoP DNA-directed RNA polymerase subunit P; Provisional
Probab=95.07  E-value=0.014  Score=23.84  Aligned_cols=27  Identities=26%  Similarity=0.423  Sum_probs=14.2

Q ss_pred             cccccccchhhhccCCc-ceecCccccc
Q psy12019         16 HNKCLINWSAVQQNHAG-MFMCDVCGKG   42 (87)
Q Consensus        16 ~~~c~~c~~~~~~~~~~-~~~c~~c~~~   42 (87)
                      .|.|+.|+..+...... ...|+.||..
T Consensus         3 ~y~C~~CG~~~~~~~~~~~~~Cp~CG~~   30 (46)
T PRK00398          3 EYKCARCGREVELDEYGTGVRCPYCGYR   30 (46)
T ss_pred             EEECCCCCCEEEECCCCCceECCCCCCe
Confidence            45666666655443221 4566666643


No 57 
>KOG2893|consensus
Probab=94.96  E-value=0.0073  Score=33.41  Aligned_cols=41  Identities=20%  Similarity=0.516  Sum_probs=30.8

Q ss_pred             cCcccccccchhhHHHHhhhhcCCCCCccCCCCCcccccchHHHhh
Q psy12019         36 CDVCGKGYKYKNGIYRHKKFECGQEPKYQCPQCPYRAKQNAHLTTH   81 (87)
Q Consensus        36 c~~c~~~~~~~~~~~~h~~~~~~~~~~~~c~~c~~~f~~~~~l~~h   81 (87)
                      |=.|++.|.....|.+|++.    +. |+|-+|.|.+-+-..|..|
T Consensus        13 cwycnrefddekiliqhqka----kh-fkchichkkl~sgpglsih   53 (341)
T KOG2893|consen   13 CWYCNREFDDEKILIQHQKA----KH-FKCHICHKKLFSGPGLSIH   53 (341)
T ss_pred             eeecccccchhhhhhhhhhh----cc-ceeeeehhhhccCCCceee
Confidence            33688899999999999875    66 8999998765555555555


No 58 
>COG4049 Uncharacterized protein containing archaeal-type C2H2 Zn-finger [General function prediction only]
Probab=94.91  E-value=0.0098  Score=25.34  Aligned_cols=29  Identities=21%  Similarity=0.482  Sum_probs=17.9

Q ss_pred             CCcceecCcccccccchhhHHHHhhhhcC
Q psy12019         30 HAGMFMCDVCGKGYKYKNGIYRHKKFECG   58 (87)
Q Consensus        30 ~~~~~~c~~c~~~~~~~~~~~~h~~~~~~   58 (87)
                      ++.-+.|+.||..|........|.....+
T Consensus        14 GE~~lrCPRC~~~FR~~K~Y~RHVNKaH~   42 (65)
T COG4049          14 GEEFLRCPRCGMVFRRRKDYIRHVNKAHG   42 (65)
T ss_pred             CceeeeCCchhHHHHHhHHHHHHhhHHhh
Confidence            34456677777777776666666654444


No 59 
>PF09986 DUF2225:  Uncharacterized protein conserved in bacteria (DUF2225);  InterPro: IPR018708 This conserved bacterial family has no known function.
Probab=94.72  E-value=0.022  Score=31.12  Aligned_cols=16  Identities=13%  Similarity=0.198  Sum_probs=12.3

Q ss_pred             CCcccccccchhhhcc
Q psy12019         14 PKHNKCLINWSAVQQN   29 (87)
Q Consensus        14 ~~~~~c~~c~~~~~~~   29 (87)
                      ++...|++|+..|...
T Consensus         3 ~k~~~CPvC~~~F~~~   18 (214)
T PF09986_consen    3 DKKITCPVCGKEFKTK   18 (214)
T ss_pred             CCceECCCCCCeeeee
Confidence            3567899999998754


No 60 
>cd00729 rubredoxin_SM Rubredoxin, Small Modular nonheme iron binding domain containing a [Fe(SCys)4] center, present in rubrerythrin and nigerythrin and detected either N- or C-terminal to such proteins as flavin reductase, NAD(P)H-nitrite reductase, and ferredoxin-thioredoxin reductase. In rubredoxin, the iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), and  believed to be involved in electron transfer. Rubrerythrins and nigerythrins are small homodimeric proteins, generally consisting of 2 domains: a rubredoxin domain C-terminal to a non-sulfur, oxo-bridged diiron site in the N-terminal rubrerythrin domain. Rubrerythrins and nigerythrins have putative peroxide activity.
Probab=94.67  E-value=0.027  Score=21.59  Aligned_cols=9  Identities=44%  Similarity=1.143  Sum_probs=5.5

Q ss_pred             eecCccccc
Q psy12019         34 FMCDVCGKG   42 (87)
Q Consensus        34 ~~c~~c~~~   42 (87)
                      |.|..||..
T Consensus         3 ~~C~~CG~i   11 (34)
T cd00729           3 WVCPVCGYI   11 (34)
T ss_pred             EECCCCCCE
Confidence            566666654


No 61 
>COG5048 FOG: Zn-finger [General function prediction only]
Probab=94.25  E-value=0.013  Score=34.34  Aligned_cols=53  Identities=21%  Similarity=0.508  Sum_probs=46.4

Q ss_pred             ceecCcccccccchhhHHHHhh--hhcCC--CCCccCC--CCCcccccchHHHhhhhhcC
Q psy12019         33 MFMCDVCGKGYKYKNGIYRHKK--FECGQ--EPKYQCP--QCPYRAKQNAHLTTHMAIKH   86 (87)
Q Consensus        33 ~~~c~~c~~~~~~~~~~~~h~~--~~~~~--~~~~~c~--~c~~~f~~~~~l~~h~~~~h   86 (87)
                      ++.|..|...|.....+..|.+  .|.++  ++ +.|+  .|++.|.....+..|..++.
T Consensus       289 ~~~~~~~~~~~s~~~~l~~~~~~~~h~~~~~~~-~~~p~~~~~~~~~~~~~~~~~~~~~~  347 (467)
T COG5048         289 PIKSKQCNISFSRSSPLTRHLRSVNHSGESLKP-FSCPYSLCGKLFSRNDALKRHILLHT  347 (467)
T ss_pred             CCCCccccCCccccccccccccccccccccCCc-eeeeccCCCccccccccccCCccccc
Confidence            5788889999999999999999  89998  77 9999  79999999998888876653


No 62 
>PF15135 UPF0515:  Uncharacterised protein UPF0515
Probab=93.83  E-value=0.023  Score=31.60  Aligned_cols=57  Identities=16%  Similarity=0.257  Sum_probs=28.6

Q ss_pred             CCCcccccccchhhhcc---CCcceecCcccccccchhhHHHHhhhhcCCCCCccCCCCCcccccc
Q psy12019         13 EPKHNKCLINWSAVQQN---HAGMFMCDVCGKGYKYKNGIYRHKKFECGQEPKYQCPQCPYRAKQN   75 (87)
Q Consensus        13 ~~~~~~c~~c~~~~~~~---~~~~~~c~~c~~~~~~~~~~~~h~~~~~~~~~~~~c~~c~~~f~~~   75 (87)
                      ..+.|.|..|.......   ....-.|..|.+.|..-..     ....|-.. |.|+.|+..|...
T Consensus       109 ~drqFaC~~Cd~~WwRrvp~rKeVSRCr~C~~rYDPVP~-----dkmwG~ae-f~C~~C~h~F~G~  168 (278)
T PF15135_consen  109 VDRQFACSSCDHMWWRRVPQRKEVSRCRKCRKRYDPVPC-----DKMWGIAE-FHCPKCRHNFRGF  168 (278)
T ss_pred             cceeeeccccchHHHhccCcccccccccccccccCCCcc-----ccccceee-eecccccccchhh
Confidence            34678888887665432   2223346666555433221     01123233 6666666666544


No 63 
>TIGR02098 MJ0042_CXXC MJ0042 family finger-like domain. This domain contains a CXXCX(19)CXXC motif suggestive of both zinc fingers and thioredoxin, usually found at the N-terminus of prokaryotic proteins. One partially characterized gene, agmX, is among a large set in Myxococcus whose interruption affects adventurous gliding motility.
Probab=93.52  E-value=0.057  Score=20.99  Aligned_cols=33  Identities=12%  Similarity=0.373  Sum_probs=16.6

Q ss_pred             eecCcccccccchhhHHHHhhhhcCCCCCccCCCCCccc
Q psy12019         34 FMCDVCGKGYKYKNGIYRHKKFECGQEPKYQCPQCPYRA   72 (87)
Q Consensus        34 ~~c~~c~~~~~~~~~~~~h~~~~~~~~~~~~c~~c~~~f   72 (87)
                      ..|+.|+..|.-.....     ...... ..|+.|+..|
T Consensus         3 ~~CP~C~~~~~v~~~~~-----~~~~~~-v~C~~C~~~~   35 (38)
T TIGR02098         3 IQCPNCKTSFRVVDSQL-----GANGGK-VRCGKCGHVW   35 (38)
T ss_pred             EECCCCCCEEEeCHHHc-----CCCCCE-EECCCCCCEE
Confidence            35667776655444321     111123 5677777655


No 64 
>PF13719 zinc_ribbon_5:  zinc-ribbon domain
Probab=93.37  E-value=0.073  Score=20.75  Aligned_cols=32  Identities=22%  Similarity=0.636  Sum_probs=16.5

Q ss_pred             ecCcccccccchhhHHHHhhhhcCCCCCccCCCCCccc
Q psy12019         35 MCDVCGKGYKYKNGIYRHKKFECGQEPKYQCPQCPYRA   72 (87)
Q Consensus        35 ~c~~c~~~~~~~~~~~~h~~~~~~~~~~~~c~~c~~~f   72 (87)
                      +|+.|+..|.-...     +.-.+... ..|+.|+..|
T Consensus         4 ~CP~C~~~f~v~~~-----~l~~~~~~-vrC~~C~~~f   35 (37)
T PF13719_consen    4 TCPNCQTRFRVPDD-----KLPAGGRK-VRCPKCGHVF   35 (37)
T ss_pred             ECCCCCceEEcCHH-----HcccCCcE-EECCCCCcEe
Confidence            56666666654443     11122234 5677776655


No 65 
>COG1592 Rubrerythrin [Energy production and conversion]
Probab=93.24  E-value=0.046  Score=28.75  Aligned_cols=23  Identities=39%  Similarity=1.044  Sum_probs=15.6

Q ss_pred             ceecCcccccccchhhHHHHhhhhcCCCCCccCCCCC
Q psy12019         33 MFMCDVCGKGYKYKNGIYRHKKFECGQEPKYQCPQCP   69 (87)
Q Consensus        33 ~~~c~~c~~~~~~~~~~~~h~~~~~~~~~~~~c~~c~   69 (87)
                      .|.|..||..             +.++.| ..|++||
T Consensus       134 ~~vC~vCGy~-------------~~ge~P-~~CPiCg  156 (166)
T COG1592         134 VWVCPVCGYT-------------HEGEAP-EVCPICG  156 (166)
T ss_pred             EEEcCCCCCc-------------ccCCCC-CcCCCCC
Confidence            5788888754             345344 8888887


No 66 
>TIGR00373 conserved hypothetical protein TIGR00373. This family of proteins is, so far, restricted to archaeal genomes. The family appears to be distantly related to the N-terminal region of the eukaryotic transcription initiation factor IIE alpha chain.
Probab=93.14  E-value=0.082  Score=27.58  Aligned_cols=33  Identities=15%  Similarity=0.505  Sum_probs=25.5

Q ss_pred             CcceecCcccccccchhhHHHHhhhhcCCCCCccCCCCCcccc
Q psy12019         31 AGMFMCDVCGKGYKYKNGIYRHKKFECGQEPKYQCPQCPYRAK   73 (87)
Q Consensus        31 ~~~~~c~~c~~~~~~~~~~~~h~~~~~~~~~~~~c~~c~~~f~   73 (87)
                      ..-|.|+.|+..|+...++.         .. |.|+.||..+.
T Consensus       107 ~~~Y~Cp~c~~r~tf~eA~~---------~~-F~Cp~Cg~~L~  139 (158)
T TIGR00373       107 NMFFICPNMCVRFTFNEAME---------LN-FTCPRCGAMLD  139 (158)
T ss_pred             CCeEECCCCCcEeeHHHHHH---------cC-CcCCCCCCEee
Confidence            34688999998888887764         24 99999997654


No 67 
>PF13717 zinc_ribbon_4:  zinc-ribbon domain
Probab=93.08  E-value=0.086  Score=20.45  Aligned_cols=32  Identities=16%  Similarity=0.373  Sum_probs=16.4

Q ss_pred             ecCcccccccchhhHHHHhhhhcCCCCCccCCCCCccc
Q psy12019         35 MCDVCGKGYKYKNGIYRHKKFECGQEPKYQCPQCPYRA   72 (87)
Q Consensus        35 ~c~~c~~~~~~~~~~~~h~~~~~~~~~~~~c~~c~~~f   72 (87)
                      +|+.|+..|.-.....     -..... ..|+.|+..|
T Consensus         4 ~Cp~C~~~y~i~d~~i-----p~~g~~-v~C~~C~~~f   35 (36)
T PF13717_consen    4 TCPNCQAKYEIDDEKI-----PPKGRK-VRCSKCGHVF   35 (36)
T ss_pred             ECCCCCCEEeCCHHHC-----CCCCcE-EECCCCCCEe
Confidence            5666666665544321     112233 5677776655


No 68 
>KOG1146|consensus
Probab=93.04  E-value=0.078  Score=36.06  Aligned_cols=51  Identities=25%  Similarity=0.578  Sum_probs=41.9

Q ss_pred             cceecCcccccccchhhHHHHhhhh-----------------c--------CCCCCccCCCCCcccccchHHHhhhh
Q psy12019         32 GMFMCDVCGKGYKYKNGIYRHKKFE-----------------C--------GQEPKYQCPQCPYRAKQNAHLTTHMA   83 (87)
Q Consensus        32 ~~~~c~~c~~~~~~~~~~~~h~~~~-----------------~--------~~~~~~~c~~c~~~f~~~~~l~~h~~   83 (87)
                      +.+.|+.|+..+.....|..|+|.-                 .        +.++ |.|..|...+.....|.+|+.
T Consensus       464 kt~~cpkc~~~yk~a~~L~vhmRskhp~~~~~~c~~gq~~~~~arg~~~~~~~~p-~~C~~C~~stttng~Lsihlq  539 (1406)
T KOG1146|consen  464 KTLKCPKCNWHYKLAQTLGVHMRSKHPESQSAYCKAGQNHPRLARGEVYRCPGKP-YPCRACNYSTTTNGNLSIHLQ  539 (1406)
T ss_pred             ccccCCccchhhhhHHHhhhcccccccccchhHhHhccccccccccccccCCCCc-ccceeeeeeeecchHHHHHHH
Confidence            5678999999999999999999870                 0        1134 899999999999999999975


No 69 
>COG4530 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=92.90  E-value=0.062  Score=26.22  Aligned_cols=28  Identities=11%  Similarity=-0.039  Sum_probs=21.4

Q ss_pred             cccccchhhhccCCcceecCcccccccc
Q psy12019         18 KCLINWSAVQQNHAGMFMCDVCGKGYKY   45 (87)
Q Consensus        18 ~c~~c~~~~~~~~~~~~~c~~c~~~~~~   45 (87)
                      .|+.|++.|-..+..|..|+.||++|..
T Consensus        11 idPetg~KFYDLNrdPiVsPytG~s~P~   38 (129)
T COG4530          11 IDPETGKKFYDLNRDPIVSPYTGKSYPR   38 (129)
T ss_pred             cCccccchhhccCCCccccCcccccchH
Confidence            4677888887777778888888888733


No 70 
>COG1997 RPL43A Ribosomal protein L37AE/L43A [Translation, ribosomal structure and biogenesis]
Probab=92.85  E-value=0.081  Score=24.75  Aligned_cols=28  Identities=18%  Similarity=0.529  Sum_probs=11.9

Q ss_pred             cccccccchhhhc-cCCcceecCcccccc
Q psy12019         16 HNKCLINWSAVQQ-NHAGMFMCDVCGKGY   43 (87)
Q Consensus        16 ~~~c~~c~~~~~~-~~~~~~~c~~c~~~~   43 (87)
                      .|.|+.|++.-.. ....-|.|..||..|
T Consensus        35 ~~~Cp~C~~~~VkR~a~GIW~C~kCg~~f   63 (89)
T COG1997          35 KHVCPFCGRTTVKRIATGIWKCRKCGAKF   63 (89)
T ss_pred             CCcCCCCCCcceeeeccCeEEcCCCCCee
Confidence            3455555544211 122334555555444


No 71 
>PRK06266 transcription initiation factor E subunit alpha; Validated
Probab=92.63  E-value=0.088  Score=28.03  Aligned_cols=32  Identities=22%  Similarity=0.666  Sum_probs=24.4

Q ss_pred             cceecCcccccccchhhHHHHhhhhcCCCCCccCCCCCcccc
Q psy12019         32 GMFMCDVCGKGYKYKNGIYRHKKFECGQEPKYQCPQCPYRAK   73 (87)
Q Consensus        32 ~~~~c~~c~~~~~~~~~~~~h~~~~~~~~~~~~c~~c~~~f~   73 (87)
                      .-|.|+.|+..|....++.         .. |.|+.||-.+.
T Consensus       116 ~~Y~Cp~C~~rytf~eA~~---------~~-F~Cp~Cg~~L~  147 (178)
T PRK06266        116 MFFFCPNCHIRFTFDEAME---------YG-FRCPQCGEMLE  147 (178)
T ss_pred             CEEECCCCCcEEeHHHHhh---------cC-CcCCCCCCCCe
Confidence            4688999998887777652         34 99999997654


No 72 
>COG1571 Predicted DNA-binding protein containing a Zn-ribbon domain [General function prediction only]
Probab=92.59  E-value=0.081  Score=31.80  Aligned_cols=33  Identities=15%  Similarity=0.209  Sum_probs=27.0

Q ss_pred             cccccccchhhhccCCcceecCcccccccchhh
Q psy12019         16 HNKCLINWSAVQQNHAGMFMCDVCGKGYKYKNG   48 (87)
Q Consensus        16 ~~~c~~c~~~~~~~~~~~~~c~~c~~~~~~~~~   48 (87)
                      .-.|+.|+..+.+.+.+.|.|..||..++....
T Consensus       350 ~p~Cp~Cg~~m~S~G~~g~rC~kCg~~~~~~~~  382 (421)
T COG1571         350 NPVCPRCGGRMKSAGRNGFRCKKCGTRARETLI  382 (421)
T ss_pred             CCCCCccCCchhhcCCCCcccccccccCCcccc
Confidence            347999999999988778999999988766544


No 73 
>PF07754 DUF1610:  Domain of unknown function (DUF1610);  InterPro: IPR011668 This domain is found in archaeal species. It is likely to bind zinc via its four well-conserved cysteine residues.
Probab=92.57  E-value=0.11  Score=18.38  Aligned_cols=7  Identities=43%  Similarity=1.644  Sum_probs=2.9

Q ss_pred             ccCCCCC
Q psy12019         63 YQCPQCP   69 (87)
Q Consensus        63 ~~c~~c~   69 (87)
                      |.|+.||
T Consensus        17 f~CPnCG   23 (24)
T PF07754_consen   17 FPCPNCG   23 (24)
T ss_pred             EeCCCCC
Confidence            4444443


No 74 
>PF14353 CpXC:  CpXC protein
Probab=92.42  E-value=0.056  Score=27.02  Aligned_cols=11  Identities=9%  Similarity=0.012  Sum_probs=6.3

Q ss_pred             cccccchhhhc
Q psy12019         18 KCLINWSAVQQ   28 (87)
Q Consensus        18 ~c~~c~~~~~~   28 (87)
                      .|+.|+..|..
T Consensus         3 tCP~C~~~~~~   13 (128)
T PF14353_consen    3 TCPHCGHEFEF   13 (128)
T ss_pred             CCCCCCCeeEE
Confidence            46666666543


No 75 
>PF09723 Zn-ribbon_8:  Zinc ribbon domain;  InterPro: IPR013429  This entry represents a region of about 41 amino acids found in a number of small proteins in a wide range of bacteria. The region usually begins with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One protein in this entry has been noted as a putative regulatory protein, designated FmdB []. Most proteins in this entry have a C-terminal region containing highly degenerate sequence.
Probab=92.41  E-value=0.059  Score=21.62  Aligned_cols=13  Identities=23%  Similarity=0.940  Sum_probs=7.4

Q ss_pred             eecCcccccccch
Q psy12019         34 FMCDVCGKGYKYK   46 (87)
Q Consensus        34 ~~c~~c~~~~~~~   46 (87)
                      |.|..||..|...
T Consensus         6 y~C~~Cg~~fe~~   18 (42)
T PF09723_consen    6 YRCEECGHEFEVL   18 (42)
T ss_pred             EEeCCCCCEEEEE
Confidence            5566666655443


No 76 
>PF08274 PhnA_Zn_Ribbon:  PhnA Zinc-Ribbon ;  InterPro: IPR013987 The PhnA protein family includes the uncharacterised Escherichia coli protein PhnA and its homologues. The E. coli phnA gene is part of a large operon associated with alkylphosphonate uptake and carbon-phosphorus bond cleavage []. The protein is not related to the characterised phosphonoacetate hydrolase designated PhnA []. This entry represents the N-terminal domain of PhnA, which is predicted to form a zinc-ribbon.; PDB: 2AKL_A.
Probab=92.37  E-value=0.083  Score=19.71  Aligned_cols=24  Identities=25%  Similarity=0.609  Sum_probs=9.9

Q ss_pred             cccccchhhhccCCcceecCcccc
Q psy12019         18 KCLINWSAVQQNHAGMFMCDVCGK   41 (87)
Q Consensus        18 ~c~~c~~~~~~~~~~~~~c~~c~~   41 (87)
                      +|+.|+..+.......+.|+.|+.
T Consensus         4 ~Cp~C~se~~y~D~~~~vCp~C~~   27 (30)
T PF08274_consen    4 KCPLCGSEYTYEDGELLVCPECGH   27 (30)
T ss_dssp             --TTT-----EE-SSSEEETTTTE
T ss_pred             CCCCCCCcceeccCCEEeCCcccc
Confidence            466666666555555666666654


No 77 
>TIGR00686 phnA alkylphosphonate utilization operon protein PhnA. The protein family includes an uncharacterized member designated phnA in Escherichia coli, part of a large operon associated with alkylphosphonate uptake and carbon-phosphorus bond cleavage. This protein is not related to the characterized phosphonoacetate hydrolase designated PhnA by Kulakova, et al. (2001, 1997).
Probab=92.37  E-value=0.095  Score=25.52  Aligned_cols=31  Identities=13%  Similarity=0.238  Sum_probs=24.8

Q ss_pred             ccccccchhhhccCCcceecCcccccccchh
Q psy12019         17 NKCLINWSAVQQNHAGMFMCDVCGKGYKYKN   47 (87)
Q Consensus        17 ~~c~~c~~~~~~~~~~~~~c~~c~~~~~~~~   47 (87)
                      -.|+.|...+.......|.|++|+..+....
T Consensus         3 p~CP~C~seytY~dg~~~iCpeC~~EW~~~~   33 (109)
T TIGR00686         3 PPCPKCNSEYTYHDGTQLICPSCLYEWNENE   33 (109)
T ss_pred             CcCCcCCCcceEecCCeeECccccccccccc
Confidence            3689999888888777899999998776553


No 78 
>KOG2186|consensus
Probab=92.28  E-value=0.11  Score=29.19  Aligned_cols=38  Identities=24%  Similarity=0.554  Sum_probs=17.5

Q ss_pred             eecCcccccccchhhHHHHhhhhcCCCCCccCCCCCccccc
Q psy12019         34 FMCDVCGKGYKYKNGIYRHKKFECGQEPKYQCPQCPYRAKQ   74 (87)
Q Consensus        34 ~~c~~c~~~~~~~~~~~~h~~~~~~~~~~~~c~~c~~~f~~   74 (87)
                      |.|..||....... +..|+-...+ .. |.|--|++.|..
T Consensus         4 FtCnvCgEsvKKp~-vekH~srCrn-~~-fSCIDC~k~F~~   41 (276)
T KOG2186|consen    4 FTCNVCGESVKKPQ-VEKHMSRCRN-AY-FSCIDCGKTFER   41 (276)
T ss_pred             Eehhhhhhhccccc-hHHHHHhccC-Ce-eEEeeccccccc
Confidence            44555554443332 3334444444 33 555555555544


No 79 
>smart00734 ZnF_Rad18 Rad18-like CCHC zinc finger. Yeast Rad18p functions with Rad5p in error-free post-replicative DNA repair. This zinc finger is likely to bind nucleic-acids.
Probab=92.27  E-value=0.15  Score=18.26  Aligned_cols=19  Identities=26%  Similarity=0.676  Sum_probs=12.9

Q ss_pred             cCCCCCcccccchHHHhhhh
Q psy12019         64 QCPQCPYRAKQNAHLTTHMA   83 (87)
Q Consensus        64 ~c~~c~~~f~~~~~l~~h~~   83 (87)
                      .|++|++.+ ....++.|..
T Consensus         3 ~CPiC~~~v-~~~~in~HLD   21 (26)
T smart00734        3 QCPVCFREV-PENLINSHLD   21 (26)
T ss_pred             cCCCCcCcc-cHHHHHHHHH
Confidence            577887777 4556677764


No 80 
>PTZ00255 60S ribosomal protein L37a; Provisional
Probab=92.22  E-value=0.081  Score=24.99  Aligned_cols=29  Identities=21%  Similarity=0.423  Sum_probs=14.9

Q ss_pred             cccccccchh-hhccCCcceecCccccccc
Q psy12019         16 HNKCLINWSA-VQQNHAGMFMCDVCGKGYK   44 (87)
Q Consensus        16 ~~~c~~c~~~-~~~~~~~~~~c~~c~~~~~   44 (87)
                      .|.|+.|++. +.......|.|..|++.|.
T Consensus        36 ~y~CpfCgk~~vkR~a~GIW~C~~C~~~~A   65 (90)
T PTZ00255         36 KYFCPFCGKHAVKRQAVGIWRCKGCKKTVA   65 (90)
T ss_pred             CccCCCCCCCceeeeeeEEEEcCCCCCEEe
Confidence            5666666543 2222334566666665543


No 81 
>PF12013 DUF3505:  Protein of unknown function (DUF3505);  InterPro: IPR022698  This family of proteins is functionally uncharacterised. This protein is found in eukaryotes. Proteins in this family are typically between 247 to 1018 amino acids in length. This region contains two segments that are likely to be C2H2 zinc binding domains. 
Probab=92.10  E-value=0.12  Score=25.13  Aligned_cols=25  Identities=28%  Similarity=0.756  Sum_probs=23.3

Q ss_pred             ccC----CCCCcccccchHHHhhhhhcCC
Q psy12019         63 YQC----PQCPYRAKQNAHLTTHMAIKHY   87 (87)
Q Consensus        63 ~~c----~~c~~~f~~~~~l~~h~~~~h~   87 (87)
                      |.|    ..|++.......+..|.+..|+
T Consensus        81 ~~C~~~~~~C~y~~~~~~~m~~H~~~~Hg  109 (109)
T PF12013_consen   81 YRCQCDPPHCGYITRSKKTMRKHWRKEHG  109 (109)
T ss_pred             eeeecCCCCCCcEeccHHHHHHHHHHhcC
Confidence            899    9999999999999999999886


No 82 
>PRK00464 nrdR transcriptional regulator NrdR; Validated
Probab=92.05  E-value=0.024  Score=29.40  Aligned_cols=12  Identities=33%  Similarity=0.722  Sum_probs=5.9

Q ss_pred             eecCcccccccc
Q psy12019         34 FMCDVCGKGYKY   45 (87)
Q Consensus        34 ~~c~~c~~~~~~   45 (87)
                      ++|+.||..|..
T Consensus        29 ~~c~~c~~~f~~   40 (154)
T PRK00464         29 RECLACGKRFTT   40 (154)
T ss_pred             eeccccCCcceE
Confidence            445555555443


No 83 
>PRK10220 hypothetical protein; Provisional
Probab=92.02  E-value=0.13  Score=25.07  Aligned_cols=31  Identities=19%  Similarity=0.470  Sum_probs=25.0

Q ss_pred             ccccccchhhhccCCcceecCcccccccchh
Q psy12019         17 NKCLINWSAVQQNHAGMFMCDVCGKGYKYKN   47 (87)
Q Consensus        17 ~~c~~c~~~~~~~~~~~~~c~~c~~~~~~~~   47 (87)
                      -.|+.|...+.......|.|++|+.-+....
T Consensus         4 P~CP~C~seytY~d~~~~vCpeC~hEW~~~~   34 (111)
T PRK10220          4 PHCPKCNSEYTYEDNGMYICPECAHEWNDAE   34 (111)
T ss_pred             CcCCCCCCcceEcCCCeEECCcccCcCCccc
Confidence            3689999988888777899999998776554


No 84 
>smart00834 CxxC_CXXC_SSSS Putative regulatory protein. CxxC_CXXC_SSSS represents a region of about 41 amino acids found in a number of small proteins in a wide range of bacteria. The region usually begins with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One protein in this entry has been noted as a putative regulatory protein, designated FmdB. Most proteins in this entry have a C-terminal region containing highly degenerate sequence.
Probab=91.85  E-value=0.08  Score=20.79  Aligned_cols=13  Identities=23%  Similarity=0.907  Sum_probs=7.5

Q ss_pred             eecCcccccccch
Q psy12019         34 FMCDVCGKGYKYK   46 (87)
Q Consensus        34 ~~c~~c~~~~~~~   46 (87)
                      |.|..||..|...
T Consensus         6 y~C~~Cg~~fe~~   18 (41)
T smart00834        6 YRCEDCGHTFEVL   18 (41)
T ss_pred             EEcCCCCCEEEEE
Confidence            5666666655433


No 85 
>TIGR00280 L37a ribosomal protein L37a. This model finds eukaryotic ribosomal protein L37a and its archaeal orthologs. The nomeclature is tricky because eukaryotes have proteins called both L37 and L37a.
Probab=91.81  E-value=0.084  Score=24.97  Aligned_cols=29  Identities=21%  Similarity=0.595  Sum_probs=15.6

Q ss_pred             cccccccchh-hhccCCcceecCccccccc
Q psy12019         16 HNKCLINWSA-VQQNHAGMFMCDVCGKGYK   44 (87)
Q Consensus        16 ~~~c~~c~~~-~~~~~~~~~~c~~c~~~~~   44 (87)
                      .|.|+.|++. +.......|.|..|++.|.
T Consensus        35 ~y~CpfCgk~~vkR~a~GIW~C~~C~~~~A   64 (91)
T TIGR00280        35 KYVCPFCGKKTVKRGSTGIWTCRKCGAKFA   64 (91)
T ss_pred             CccCCCCCCCceEEEeeEEEEcCCCCCEEe
Confidence            5666666543 2222344566666666553


No 86 
>TIGR02605 CxxC_CxxC_SSSS putative regulatory protein, FmdB family. This model represents a region of about 50 amino acids found in a number of small proteins in a wide range of bacteria. The region begins usually with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One member of this family is has been noted as a putative regulatory protein, designated FmdB (PubMed:8841393). Most members of this family have a C-terminal region containing highly degenerate sequence, such as SSTSESTKSSGSSGSSGSSESKASGSTEKSTSSTTAAAAV in Mycobacterium tuberculosis and VAVGGSAPAPSPAPRAGGGGGGCCGGGCCG in Streptomyces avermitilis. These low complexity regions, which are not included in the model, resemble low-complexity C-terminal regions of some heterocycle-containing bacteriocin precursors.
Probab=91.80  E-value=0.073  Score=22.21  Aligned_cols=12  Identities=25%  Similarity=1.052  Sum_probs=6.8

Q ss_pred             eecCcccccccc
Q psy12019         34 FMCDVCGKGYKY   45 (87)
Q Consensus        34 ~~c~~c~~~~~~   45 (87)
                      |.|..||..|..
T Consensus         6 y~C~~Cg~~fe~   17 (52)
T TIGR02605         6 YRCTACGHRFEV   17 (52)
T ss_pred             EEeCCCCCEeEE
Confidence            456666665543


No 87 
>PF05443 ROS_MUCR:  ROS/MUCR transcriptional regulator protein;  InterPro: IPR008807 This family consists of several ROS/MUCR transcriptional regulator proteins. The ros chromosomal gene is present in octopine and nopaline strains of Agrobacterium tumefaciens as well as in Rhizobium meliloti (Sinorhizobium meliloti). This gene encodes a 15.5 kDa protein that specifically represses the virC and virD operons in the virulence region of the Ti plasmid [] and is necessary for succinoglycan production []. S. meliloti can produce two types of acidic exopolysaccharides, succinoglycan and galactoglucan, that are interchangeable for infection of Medicago sativa (Alfalfa) nodules. MucR from S. meliloti acts as a transcriptional repressor that blocks the expression of the exp genes responsible for galactoglucan production therefore allowing the exclusive production of succinoglycan [].; GO: 0003677 DNA binding, 0008270 zinc ion binding, 0006355 regulation of transcription, DNA-dependent; PDB: 2JSP_A.
Probab=91.80  E-value=0.095  Score=26.57  Aligned_cols=26  Identities=23%  Similarity=0.413  Sum_probs=15.0

Q ss_pred             CCCCCccCCCCCcccccchHHHhhhhhcCC
Q psy12019         58 GQEPKYQCPQCPYRAKQNAHLTTHMAIKHY   87 (87)
Q Consensus        58 ~~~~~~~c~~c~~~f~~~~~l~~h~~~~h~   87 (87)
                      .+.. ..|-+||+.|..   |.+|++.|||
T Consensus        69 ~~d~-i~clecGk~~k~---LkrHL~~~~g   94 (132)
T PF05443_consen   69 TPDY-IICLECGKKFKT---LKRHLRTHHG   94 (132)
T ss_dssp             -SS--EE-TBT--EESB---HHHHHHHTT-
T ss_pred             ccCe-eEEccCCcccch---HHHHHHHccC
Confidence            3344 678889998864   4789888875


No 88 
>COG1996 RPC10 DNA-directed RNA polymerase, subunit RPC10 (contains C4-type Zn-finger) [Transcription]
Probab=91.12  E-value=0.1  Score=21.80  Aligned_cols=25  Identities=24%  Similarity=0.446  Sum_probs=11.9

Q ss_pred             cccccccchhhhcc-CCcceecCccc
Q psy12019         16 HNKCLINWSAVQQN-HAGMFMCDVCG   40 (87)
Q Consensus        16 ~~~c~~c~~~~~~~-~~~~~~c~~c~   40 (87)
                      .|.|..|++.+... ......|+.||
T Consensus         6 ~Y~C~~Cg~~~~~~~~~~~irCp~Cg   31 (49)
T COG1996           6 EYKCARCGREVELDQETRGIRCPYCG   31 (49)
T ss_pred             EEEhhhcCCeeehhhccCceeCCCCC
Confidence            35555555555422 22344555555


No 89 
>smart00531 TFIIE Transcription initiation factor IIE.
Probab=90.32  E-value=0.24  Score=25.49  Aligned_cols=38  Identities=16%  Similarity=0.534  Sum_probs=25.2

Q ss_pred             CcceecCcccccccchhhHHHHhhhhcCCCCCccCCCCCcccc
Q psy12019         31 AGMFMCDVCGKGYKYKNGIYRHKKFECGQEPKYQCPQCPYRAK   73 (87)
Q Consensus        31 ~~~~~c~~c~~~~~~~~~~~~h~~~~~~~~~~~~c~~c~~~f~   73 (87)
                      ..-|.|+.|+..|....++..-   .. +.. |.|+.||....
T Consensus        97 ~~~Y~Cp~C~~~y~~~ea~~~~---d~-~~~-f~Cp~Cg~~l~  134 (147)
T smart00531       97 NAYYKCPNCQSKYTFLEANQLL---DM-DGT-FTCPRCGEELE  134 (147)
T ss_pred             CcEEECcCCCCEeeHHHHHHhc---CC-CCc-EECCCCCCEEE
Confidence            3468899999888765543321   11 344 89999997653


No 90 
>PRK03976 rpl37ae 50S ribosomal protein L37Ae; Reviewed
Probab=90.29  E-value=0.14  Score=24.23  Aligned_cols=29  Identities=21%  Similarity=0.594  Sum_probs=15.7

Q ss_pred             cccccccchh-hhccCCcceecCccccccc
Q psy12019         16 HNKCLINWSA-VQQNHAGMFMCDVCGKGYK   44 (87)
Q Consensus        16 ~~~c~~c~~~-~~~~~~~~~~c~~c~~~~~   44 (87)
                      .|.|+.|++. +.......|.|..|++.|.
T Consensus        36 ~y~CpfCgk~~vkR~a~GIW~C~~C~~~~A   65 (90)
T PRK03976         36 KHVCPVCGRPKVKRVGTGIWECRKCGAKFA   65 (90)
T ss_pred             CccCCCCCCCceEEEEEEEEEcCCCCCEEe
Confidence            5667776543 2222344566766666553


No 91 
>PF04959 ARS2:  Arsenite-resistance protein 2;  InterPro: IPR007042 This entry represents Arsenite-resistance protein 2 (also known as Serrate RNA effector molecule homolog) which is thought to play a role in arsenite resistance [], although does not directly confer arsenite resistance but rather modulates arsenic sensitivity []. Arsenite is a carcinogenic compound which can act as a comutagen by inhibiting DNA repair. It is also involved in cell cycle progression at S phase. ; PDB: 3AX1_A.
Probab=90.17  E-value=0.1  Score=28.60  Aligned_cols=24  Identities=29%  Similarity=0.582  Sum_probs=13.6

Q ss_pred             ccCCCCCcccccchHHHhhhhhcC
Q psy12019         63 YQCPQCPYRAKQNAHLTTHMAIKH   86 (87)
Q Consensus        63 ~~c~~c~~~f~~~~~l~~h~~~~h   86 (87)
                      |.|..|+|.|....-+..|+...|
T Consensus        78 ~~C~lc~KlFkg~eFV~KHI~nKH  101 (214)
T PF04959_consen   78 WRCPLCGKLFKGPEFVRKHIFNKH  101 (214)
T ss_dssp             EEE-SSS-EESSHHHHHHHHHHH-
T ss_pred             ECCCCCCcccCChHHHHHHHhhcC
Confidence            666666666666666666665444


No 92 
>PF02892 zf-BED:  BED zinc finger;  InterPro: IPR003656 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents predicted BED-type zinc finger domains. The BED finger which was named after the Drosophila proteins BEAF and DREF, is found in one or more copies in cellular regulatory factors and transposases from plants, animals and fungi. The BED finger is an about 50 to 60 amino acid residues domain that contains a characteristic motif with two highly conserved aromatic positions, as well as a shared pattern of cysteines and histidines that is predicted to form a zinc finger. As diverse BED fingers are able to bind DNA, it has been suggested that DNA-binding is the general function of this domain []. Some proteins known to contain a BED domain include animal, plant and fungi AC1 and Hobo-like transposases; Caenorhabditis elegans Dpy-20 protein, a predicted cuticular gene transcriptional regulator; Drosophila BEAF (boundary element-associated factor), thought to be involved in chromatin insulation; Drosophila DREF, a transcriptional regulator for S-phase genes; and tobacco 3AF1 and tomato E4/E8-BP1, light- and ethylene-regulated DNA binding proteins that contain two BED fingers. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003677 DNA binding; PDB: 2DJR_A 2CT5_A.
Probab=90.13  E-value=0.28  Score=19.65  Aligned_cols=22  Identities=23%  Similarity=0.425  Sum_probs=11.8

Q ss_pred             ccCCCCCccccc----chHHHhhhhh
Q psy12019         63 YQCPQCPYRAKQ----NAHLTTHMAI   84 (87)
Q Consensus        63 ~~c~~c~~~f~~----~~~l~~h~~~   84 (87)
                      ..|..|++.+..    .+.|.+|++.
T Consensus        17 a~C~~C~~~~~~~~~~ts~l~~HL~~   42 (45)
T PF02892_consen   17 AKCKYCGKVIKYSSGGTSNLKRHLKK   42 (45)
T ss_dssp             EEETTTTEE-----SSTHHHHHHHHH
T ss_pred             EEeCCCCeEEeeCCCcHHHHHHhhhh
Confidence            566777766554    3566666643


No 93 
>COG4957 Predicted transcriptional regulator [Transcription]
Probab=89.39  E-value=0.23  Score=25.26  Aligned_cols=22  Identities=18%  Similarity=0.182  Sum_probs=15.8

Q ss_pred             ccCCCCCcccccchHHHhhhhhcCC
Q psy12019         63 YQCPQCPYRAKQNAHLTTHMAIKHY   87 (87)
Q Consensus        63 ~~c~~c~~~f~~~~~l~~h~~~~h~   87 (87)
                      ..|-++||.|.   +|.+|+.+|++
T Consensus        77 IicLEDGkkfK---SLKRHL~t~~g   98 (148)
T COG4957          77 IICLEDGKKFK---SLKRHLTTHYG   98 (148)
T ss_pred             EEEeccCcchH---HHHHHHhcccC
Confidence            46777788775   57888887764


No 94 
>smart00614 ZnF_BED BED zinc finger. DNA-binding domain in chromatin-boundary-element-binding proteins and transposases
Probab=89.38  E-value=0.31  Score=20.19  Aligned_cols=21  Identities=19%  Similarity=0.547  Sum_probs=13.8

Q ss_pred             ccCCCCCcccccc-----hHHHhhhh
Q psy12019         63 YQCPQCPYRAKQN-----AHLTTHMA   83 (87)
Q Consensus        63 ~~c~~c~~~f~~~-----~~l~~h~~   83 (87)
                      -.|..|++.+...     +.|.+|+.
T Consensus        19 a~C~~C~~~l~~~~~~gTs~L~rHl~   44 (50)
T smart00614       19 AKCKYCGKKLSRSSKGGTSNLRRHLR   44 (50)
T ss_pred             EEecCCCCEeeeCCCCCcHHHHHHHH
Confidence            4667777666443     57777776


No 95 
>PF01780 Ribosomal_L37ae:  Ribosomal L37ae protein family;  InterPro: IPR002674 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms. The codons of the mRNA are exposed on the ribosome to allow tRNA binding. This leads to the incorporation of amino acids into the growing polypeptide chain in accordance with the genetic information. Incoming amino acid monomers enter the ribosomal A site in the form of aminoacyl-tRNAs complexed with elongation factor Tu (EF-Tu) and GTP. The growing polypeptide chain, situated in the P site as peptidyl-tRNA, is then transferred to aminoacyl-tRNA and the new peptidyl-tRNA, extended by one residue, is translocated to the P site with the aid the elongation factor G (EF-G) and GTP as the deacylated tRNA is released from the ribosome through one or more exit sites [, ]. About 2/3 of the mass of the ribosome consists of RNA and 1/3 of protein. The proteins are named in accordance with the subunit of the ribosome which they belong to - the small (S1 to S31) and the large (L1 to L44). Usually they decorate the rRNA cores of the subunits.  Many ribosomal proteins, particularly those of the large subunit, are composed of a globular, surfaced-exposed domain with long finger-like projections that extend into the rRNA core to stabilise its structure. Most of the proteins interact with multiple RNA elements, often from different domains. In the large subunit, about 1/3 of the 23S rRNA nucleotides are at least in van der Waal's contact with protein, and L22 interacts with all six domains of the 23S rRNA. Proteins S4 and S7, which initiate assembly of the 16S rRNA, are located at junctions of five and four RNA helices, respectively. In this way proteins serve to organise and stabilise the rRNA tertiary structure. While the crucial activities of decoding and peptide transfer are RNA based, proteins play an active role in functions that may have evolved to streamline the process of protein synthesis. In addition to their function in the ribosome, many ribosomal proteins have some function 'outside' the ribosome [, ]. This ribosomal protein is found in archaebacteria and eukaryotes []. Ribosomal protein L37 has a single zinc finger-like motif of the C2-C2 type [].; GO: 0003735 structural constituent of ribosome, 0006412 translation, 0005622 intracellular, 0005840 ribosome; PDB: 4A1E_Y 4A17_Y 4A1C_Y 4A1A_Y 3O58_g 3IZS_m 3O5H_g 1S1I_9 3IZR_m 1YSH_D ....
Probab=89.22  E-value=0.16  Score=24.04  Aligned_cols=28  Identities=21%  Similarity=0.571  Sum_probs=12.2

Q ss_pred             cccccccchhhhc-cCCcceecCcccccc
Q psy12019         16 HNKCLINWSAVQQ-NHAGMFMCDVCGKGY   43 (87)
Q Consensus        16 ~~~c~~c~~~~~~-~~~~~~~c~~c~~~~   43 (87)
                      .|.|+.|++.-.. ....-|.|..|++.|
T Consensus        35 ky~Cp~Cgk~~vkR~a~GIW~C~~C~~~~   63 (90)
T PF01780_consen   35 KYTCPFCGKTSVKRVATGIWKCKKCGKKF   63 (90)
T ss_dssp             -BEESSSSSSEEEEEETTEEEETTTTEEE
T ss_pred             CCcCCCCCCceeEEeeeEEeecCCCCCEE
Confidence            4555555544321 122235555555544


No 96 
>PF09845 DUF2072:  Zn-ribbon containing protein (DUF2072);  InterPro: IPR018645  This archaeal Zinc-ribbon containing proteins have no known function. 
Probab=88.95  E-value=0.16  Score=25.66  Aligned_cols=25  Identities=16%  Similarity=0.388  Sum_probs=14.8

Q ss_pred             cccccccchhhhccCCc-ceecCccc
Q psy12019         16 HNKCLINWSAVQQNHAG-MFMCDVCG   40 (87)
Q Consensus        16 ~~~c~~c~~~~~~~~~~-~~~c~~c~   40 (87)
                      |++|..|++.|...... .-=|+.||
T Consensus         1 PH~Ct~Cg~~f~dgs~eil~GCP~CG   26 (131)
T PF09845_consen    1 PHQCTKCGRVFEDGSKEILSGCPECG   26 (131)
T ss_pred             CcccCcCCCCcCCCcHHHHccCcccC
Confidence            56777777777764211 22366666


No 97 
>PRK09678 DNA-binding transcriptional regulator; Provisional
Probab=88.68  E-value=0.18  Score=22.86  Aligned_cols=12  Identities=25%  Similarity=0.490  Sum_probs=6.5

Q ss_pred             ccCC--CCCccccc
Q psy12019         63 YQCP--QCPYRAKQ   74 (87)
Q Consensus        63 ~~c~--~c~~~f~~   74 (87)
                      ++|.  +||.+|..
T Consensus        28 ~qC~N~eCg~tF~t   41 (72)
T PRK09678         28 HQCQNVNCSATFIT   41 (72)
T ss_pred             eecCCCCCCCEEEE
Confidence            5554  56655543


No 98 
>COG3357 Predicted transcriptional regulator containing an HTH domain fused to a Zn-ribbon [Transcription]
Probab=87.94  E-value=0.32  Score=23.03  Aligned_cols=12  Identities=25%  Similarity=0.714  Sum_probs=5.7

Q ss_pred             ceecCccccccc
Q psy12019         33 MFMCDVCGKGYK   44 (87)
Q Consensus        33 ~~~c~~c~~~~~   44 (87)
                      |-.|..||..|.
T Consensus        58 Pa~CkkCGfef~   69 (97)
T COG3357          58 PARCKKCGFEFR   69 (97)
T ss_pred             ChhhcccCcccc
Confidence            334555555443


No 99 
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning]
Probab=87.14  E-value=0.18  Score=29.43  Aligned_cols=42  Identities=31%  Similarity=0.585  Sum_probs=34.1

Q ss_pred             CCCcccccc--cchhhhcc------------------------------CCcceecCcccccccchhhHHHHhh
Q psy12019         13 EPKHNKCLI--NWSAVQQN------------------------------HAGMFMCDVCGKGYKYKNGIYRHKK   54 (87)
Q Consensus        13 ~~~~~~c~~--c~~~~~~~------------------------------~~~~~~c~~c~~~~~~~~~~~~h~~   54 (87)
                      +++||+|++  |.+.+...                              ..+||.|..|++.+.....|.-|+.
T Consensus       346 d~KpykCpV~gC~K~YknqnGLKYH~lhGH~~~~~~~~p~p~~~~~F~~~~KPYrCevC~KRYKNlNGLKYHr~  419 (423)
T COG5189         346 DGKPYKCPVEGCNKKYKNQNGLKYHMLHGHQNQKLHENPSPEKMNIFSAKDKPYRCEVCDKRYKNLNGLKYHRK  419 (423)
T ss_pred             cCceecCCCCCchhhhccccchhhhhhccccCcccCCCCCccccccccccCCceeccccchhhccCccceeccc
Confidence            358999987  88888653                              4579999999999999888877654


No 100
>TIGR00622 ssl1 transcription factor ssl1. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=86.93  E-value=0.89  Score=22.50  Aligned_cols=47  Identities=13%  Similarity=0.147  Sum_probs=27.3

Q ss_pred             cCcccccccchhhHHHHhhhhcCCCCCccCCCCCcccccchHHHhhhhhc
Q psy12019         36 CDVCGKGYKYKNGIYRHKKFECGQEPKYQCPQCPYRAKQNAHLTTHMAIK   85 (87)
Q Consensus        36 c~~c~~~~~~~~~~~~h~~~~~~~~~~~~c~~c~~~f~~~~~l~~h~~~~   85 (87)
                      |-.|...|........  ..-..... |+|+.|...|--.-++-.|..+|
T Consensus        58 C~~C~~~f~~~~~~~~--~~~~~~~~-y~C~~C~~~FC~dCD~fiHe~Lh  104 (112)
T TIGR00622        58 CFGCQGPFPKPPVSPF--DELKDSHR-YVCAVCKNVFCVDCDVFVHESLH  104 (112)
T ss_pred             ccCcCCCCCCcccccc--cccccccc-eeCCCCCCccccccchhhhhhcc
Confidence            6667777655431110  00111234 88888888887777777776655


No 101
>PF11781 RRN7:  RNA polymerase I-specific transcription initiation factor Rrn7;  InterPro: IPR021752  Rrn7 is a transcription binding factor that associates strongly with both Rrn6 and Rrn11 to form a complex which itself binds the TATA-binding protein and is required for transcription by the core domain of the RNA PolI promoter [],[]. 
Probab=86.72  E-value=0.5  Score=18.35  Aligned_cols=26  Identities=27%  Similarity=0.637  Sum_probs=17.2

Q ss_pred             cccccccchhhhccCCcceecCcccc
Q psy12019         16 HNKCLINWSAVQQNHAGMFMCDVCGK   41 (87)
Q Consensus        16 ~~~c~~c~~~~~~~~~~~~~c~~c~~   41 (87)
                      ...|..|+..+-......+.|..||.
T Consensus         8 ~~~C~~C~~~~~~~~dG~~yC~~cG~   33 (36)
T PF11781_consen    8 NEPCPVCGSRWFYSDDGFYYCDRCGH   33 (36)
T ss_pred             CCcCCCCCCeEeEccCCEEEhhhCce
Confidence            35577777775555666677777764


No 102
>PF01363 FYVE:  FYVE zinc finger;  InterPro: IPR000306 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The FYVE zinc finger is named after four proteins that it has been found in: Fab1, YOTB/ZK632.12, Vac1, and EEA1. The FYVE finger has been shown to bind two zinc ions []. The FYVE finger has eight potential zinc coordinating cysteine positions. Many members of this family also include two histidines in a motif R+HHC+XCG, where + represents a charged residue and X any residue. FYVE-type domains are divided into two known classes: FYVE domains that specifically bind to phosphatidylinositol 3-phosphate in lipid bilayers and FYVE-related domains of undetermined function []. Those that bind to phosphatidylinositol 3-phosphate are often found in proteins targeted to lipid membranes that are involved in regulating membrane traffic [, , ]. Most FYVE domains target proteins to endosomes by binding specifically to phosphatidylinositol-3-phosphate at the membrane surface. By contrast, the CARP2 FYVE-like domain is not optimized to bind to phosphoinositides or insert into lipid bilayers. FYVE domains are distinguished from other zinc fingers by three signature sequences: an N-terminal WxxD motif, a basic R(R/K)HHCR patch, and a C-terminal RVC motif. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0046872 metal ion binding; PDB: 1HYI_A 1JOC_B 1HYJ_A 1DVP_A 3ZYQ_A 4AVX_A 1VFY_A 3T7L_A 1X4U_A 1WFK_A ....
Probab=86.08  E-value=0.56  Score=20.67  Aligned_cols=30  Identities=17%  Similarity=0.310  Sum_probs=13.3

Q ss_pred             cccccccchhhhccCCcceecCcccccccch
Q psy12019         16 HNKCLINWSAVQQNHAGMFMCDVCGKGYKYK   46 (87)
Q Consensus        16 ~~~c~~c~~~~~~~~~~~~~c~~c~~~~~~~   46 (87)
                      .-.|..|.+.|.- ..+.+.|..||..|-..
T Consensus         9 ~~~C~~C~~~F~~-~~rrhhCr~CG~~vC~~   38 (69)
T PF01363_consen    9 ASNCMICGKKFSL-FRRRHHCRNCGRVVCSS   38 (69)
T ss_dssp             -SB-TTT--B-BS-SS-EEE-TTT--EEECC
T ss_pred             CCcCcCcCCcCCC-ceeeEccCCCCCEECCc
Confidence            3467788888844 34456788887766544


No 103
>COG5152 Uncharacterized conserved protein, contains RING and CCCH-type Zn-fingers [General function prediction only]
Probab=85.83  E-value=0.31  Score=26.50  Aligned_cols=46  Identities=17%  Similarity=0.247  Sum_probs=29.3

Q ss_pred             CcccccccchhhhccCCcceecCcccccccchhhHHHHhhhhcCCCCCccCCCCCccc
Q psy12019         15 KHNKCLINWSAVQQNHAGMFMCDVCGKGYKYKNGIYRHKKFECGQEPKYQCPQCPYRA   72 (87)
Q Consensus        15 ~~~~c~~c~~~~~~~~~~~~~c~~c~~~~~~~~~~~~h~~~~~~~~~~~~c~~c~~~f   72 (87)
                      .||.|.+|.+.|.+.     .-..||..|....+....+.      . -.|-+||+.-
T Consensus       195 IPF~C~iCKkdy~sp-----vvt~CGH~FC~~Cai~~y~k------g-~~C~~Cgk~t  240 (259)
T COG5152         195 IPFLCGICKKDYESP-----VVTECGHSFCSLCAIRKYQK------G-DECGVCGKAT  240 (259)
T ss_pred             Cceeehhchhhccch-----hhhhcchhHHHHHHHHHhcc------C-Ccceecchhh
Confidence            488999998887664     23357777766665543322      2 4777788643


No 104
>KOG1146|consensus
Probab=85.80  E-value=0.33  Score=33.39  Aligned_cols=69  Identities=14%  Similarity=0.277  Sum_probs=48.3

Q ss_pred             ccccccchhhhcc-------CCcceecCcccccccchhhHHHHhhhhc----------------CCCCCccCCCCCcccc
Q psy12019         17 NKCLINWSAVQQN-------HAGMFMCDVCGKGYKYKNGIYRHKKFEC----------------GQEPKYQCPQCPYRAK   73 (87)
Q Consensus        17 ~~c~~c~~~~~~~-------~~~~~~c~~c~~~~~~~~~~~~h~~~~~----------------~~~~~~~c~~c~~~f~   73 (87)
                      +.|..|...+...       ...+|.|..|...|.....+..|++.-.                -+..+| |..|...|+
T Consensus      1261 ~~c~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~l~~~~~k~~~~~~~~~~~~~~~l~~~d~~~~-c~~c~~~~~ 1339 (1406)
T KOG1146|consen 1261 GECGAVDELLTPSFGISTLDVTHRYLCRQCKMAFDGEAPLTAHQRKFCFAGRGSGGSMPPPLRVPDCTYH-CLACEVLLS 1339 (1406)
T ss_pred             chhhhccccccCccceeecccchhHHHHHHHhhhcchhHHHHHHHHHHhccCccccCCCCcccCcccccc-chHHHhhcc
Confidence            4566666555432       3446788888888888888888875311                112336 999999999


Q ss_pred             cchHHHhhhhhcC
Q psy12019         74 QNAHLTTHMAIKH   86 (87)
Q Consensus        74 ~~~~l~~h~~~~h   86 (87)
                      +...|..|+++-+
T Consensus      1340 ~~~alqihm~~~~ 1352 (1406)
T KOG1146|consen 1340 GREALQIHMRSSA 1352 (1406)
T ss_pred             hhHHHHHHHHHhh
Confidence            9999999998643


No 105
>COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair]
Probab=85.55  E-value=0.9  Score=29.65  Aligned_cols=14  Identities=29%  Similarity=0.695  Sum_probs=9.5

Q ss_pred             cCCCCCccCCCCCcc
Q psy12019         57 CGQEPKYQCPQCPYR   71 (87)
Q Consensus        57 ~~~~~~~~c~~c~~~   71 (87)
                      ....| ..|+.||..
T Consensus       471 ~~~~p-~~Cp~Cgs~  484 (730)
T COG1198         471 QEPIP-QSCPECGSE  484 (730)
T ss_pred             CCCCC-CCCCCCCCC
Confidence            33345 899999854


No 106
>PRK00432 30S ribosomal protein S27ae; Validated
Probab=85.38  E-value=0.77  Score=19.23  Aligned_cols=10  Identities=30%  Similarity=1.138  Sum_probs=5.9

Q ss_pred             ccCCCCCccc
Q psy12019         63 YQCPQCPYRA   72 (87)
Q Consensus        63 ~~c~~c~~~f   72 (87)
                      +.|..||..+
T Consensus        38 ~~C~~Cgyt~   47 (50)
T PRK00432         38 WHCGKCGYTE   47 (50)
T ss_pred             EECCCcCCEE
Confidence            5666666543


No 107
>PRK00420 hypothetical protein; Validated
Probab=85.31  E-value=0.69  Score=22.88  Aligned_cols=28  Identities=25%  Similarity=0.426  Sum_probs=18.6

Q ss_pred             ccccccchhhhccCCcceecCccccccc
Q psy12019         17 NKCLINWSAVQQNHAGMFMCDVCGKGYK   44 (87)
Q Consensus        17 ~~c~~c~~~~~~~~~~~~~c~~c~~~~~   44 (87)
                      -.|+.|+..+.........|+.||....
T Consensus        24 ~~CP~Cg~pLf~lk~g~~~Cp~Cg~~~~   51 (112)
T PRK00420         24 KHCPVCGLPLFELKDGEVVCPVHGKVYI   51 (112)
T ss_pred             CCCCCCCCcceecCCCceECCCCCCeee
Confidence            4677888776654445667888887543


No 108
>PF06524 NOA36:  NOA36 protein;  InterPro: IPR010531 This family consists of several NOA36 proteins which contain 29 highly conserved cysteine residues. The function of this protein is unknown.; GO: 0008270 zinc ion binding, 0005634 nucleus
Probab=84.51  E-value=0.93  Score=25.85  Aligned_cols=24  Identities=21%  Similarity=0.523  Sum_probs=12.6

Q ss_pred             cccccchhhhccCCcceecCcccc
Q psy12019         18 KCLINWSAVQQNHAGMFMCDVCGK   41 (87)
Q Consensus        18 ~c~~c~~~~~~~~~~~~~c~~c~~   41 (87)
                      .|.+|.+.....+.+.|.|..|..
T Consensus       127 ~C~EC~R~vw~hGGrif~CsfC~~  150 (314)
T PF06524_consen  127 VCIECERGVWDHGGRIFKCSFCDN  150 (314)
T ss_pred             EeeeeecccccCCCeEEEeecCCC
Confidence            455565555555555555555543


No 109
>PF10571 UPF0547:  Uncharacterised protein family UPF0547;  InterPro: IPR018886  This domain may well be a type of zinc-finger as it carries two pairs of highly conserved cysteine residues though with no accompanying histidines. Several members are annotated as putative helicases. 
Probab=83.86  E-value=0.67  Score=16.60  Aligned_cols=10  Identities=40%  Similarity=1.132  Sum_probs=5.7

Q ss_pred             cCCCCCcccc
Q psy12019         64 QCPQCPYRAK   73 (87)
Q Consensus        64 ~c~~c~~~f~   73 (87)
                      .|+.||..|.
T Consensus        16 ~Cp~CG~~F~   25 (26)
T PF10571_consen   16 FCPHCGYDFE   25 (26)
T ss_pred             cCCCCCCCCc
Confidence            5566666553


No 110
>KOG3507|consensus
Probab=83.77  E-value=0.62  Score=20.19  Aligned_cols=25  Identities=16%  Similarity=0.250  Sum_probs=10.8

Q ss_pred             ccccccchhhhccCCcceecCcccc
Q psy12019         17 NKCLINWSAVQQNHAGMFMCDVCGK   41 (87)
Q Consensus        17 ~~c~~c~~~~~~~~~~~~~c~~c~~   41 (87)
                      |.|..|+..-.-.....+.|.+||.
T Consensus        21 YiCgdC~~en~lk~~D~irCReCG~   45 (62)
T KOG3507|consen   21 YICGDCGQENTLKRGDVIRCRECGY   45 (62)
T ss_pred             EEeccccccccccCCCcEehhhcch
Confidence            4444444433333333444555543


No 111
>KOG3408|consensus
Probab=83.65  E-value=0.8  Score=22.93  Aligned_cols=26  Identities=23%  Similarity=0.428  Sum_probs=23.0

Q ss_pred             CCcceecCcccccccchhhHHHHhhh
Q psy12019         30 HAGMFMCDVCGKGYKYKNGIYRHKKF   55 (87)
Q Consensus        30 ~~~~~~c~~c~~~~~~~~~~~~h~~~   55 (87)
                      +...|-|..|.+-|....++..|.++
T Consensus        54 G~GqfyCi~CaRyFi~~~~l~~H~kt   79 (129)
T KOG3408|consen   54 GGGQFYCIECARYFIDAKALKTHFKT   79 (129)
T ss_pred             CCceeehhhhhhhhcchHHHHHHHhc
Confidence            56679999999999999999999875


No 112
>cd00730 rubredoxin Rubredoxin; nonheme iron binding domains containing a [Fe(SCys)4] center. Rubredoxins are small nonheme iron proteins. The iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), but iron can also be replaced by cobalt, nickel or zinc. They are believed to be involved in electron transfer.
Probab=83.25  E-value=0.83  Score=19.15  Aligned_cols=7  Identities=43%  Similarity=1.431  Sum_probs=4.7

Q ss_pred             ccCCCCC
Q psy12019         63 YQCPQCP   69 (87)
Q Consensus        63 ~~c~~c~   69 (87)
                      |.|+.|+
T Consensus        35 w~CP~C~   41 (50)
T cd00730          35 WVCPVCG   41 (50)
T ss_pred             CCCCCCC
Confidence            6677765


No 113
>PF11789 zf-Nse:  Zinc-finger of the MIZ type in Nse subunit; PDB: 2YU4_A 3HTK_C.
Probab=82.91  E-value=1.3  Score=19.04  Aligned_cols=47  Identities=15%  Similarity=0.294  Sum_probs=24.3

Q ss_pred             CCCcccccccchhhhccCCcceecCcccccccchhhHHHHhhhhcCCCCCccCCCC
Q psy12019         13 EPKHNKCLINWSAVQQNHAGMFMCDVCGKGYKYKNGIYRHKKFECGQEPKYQCPQC   68 (87)
Q Consensus        13 ~~~~~~c~~c~~~~~~~~~~~~~c~~c~~~~~~~~~~~~h~~~~~~~~~~~~c~~c   68 (87)
                      +...+.|++..+.|..    |.....|+-.|...+.+ .+.   ..... ..|++.
T Consensus         8 ~~~~~~CPiT~~~~~~----PV~s~~C~H~fek~aI~-~~i---~~~~~-~~CPv~   54 (57)
T PF11789_consen    8 GTISLKCPITLQPFED----PVKSKKCGHTFEKEAIL-QYI---QRNGS-KRCPVA   54 (57)
T ss_dssp             SB--SB-TTTSSB-SS----EEEESSS--EEEHHHHH-HHC---TTTS--EE-SCC
T ss_pred             cEeccCCCCcCChhhC----CcCcCCCCCeecHHHHH-HHH---HhcCC-CCCCCC
Confidence            4456788887777554    67777898888766544 333   12233 777763


No 114
>PRK03824 hypA hydrogenase nickel incorporation protein; Provisional
Probab=82.74  E-value=0.59  Score=23.82  Aligned_cols=15  Identities=27%  Similarity=0.826  Sum_probs=9.6

Q ss_pred             cceecCcccccccch
Q psy12019         32 GMFMCDVCGKGYKYK   46 (87)
Q Consensus        32 ~~~~c~~c~~~~~~~   46 (87)
                      ..+.|..||..|...
T Consensus        69 ~~~~C~~CG~~~~~~   83 (135)
T PRK03824         69 AVLKCRNCGNEWSLK   83 (135)
T ss_pred             eEEECCCCCCEEecc
Confidence            356788888666543


No 115
>PF08790 zf-LYAR:  LYAR-type C2HC zinc finger ;  InterPro: IPR014898 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This C2HC zinc finger domain is found in LYAR proteins such as Q08288 from SWISSPROT, which are involved in cell growth regulation.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 1WJV_A.
Probab=82.35  E-value=0.46  Score=17.42  Aligned_cols=9  Identities=33%  Similarity=0.877  Sum_probs=5.4

Q ss_pred             ecCcccccc
Q psy12019         35 MCDVCGKGY   43 (87)
Q Consensus        35 ~c~~c~~~~   43 (87)
                      .|..|++.|
T Consensus         2 sCiDC~~~F   10 (28)
T PF08790_consen    2 SCIDCSKDF   10 (28)
T ss_dssp             EETTTTEEE
T ss_pred             eeecCCCCc
Confidence            455666666


No 116
>KOG2593|consensus
Probab=82.18  E-value=0.7  Score=28.08  Aligned_cols=28  Identities=21%  Similarity=0.374  Sum_probs=16.6

Q ss_pred             CCcccccccchhhhcc--------CCcceecCcccc
Q psy12019         14 PKHNKCLINWSAVQQN--------HAGMFMCDVCGK   41 (87)
Q Consensus        14 ~~~~~c~~c~~~~~~~--------~~~~~~c~~c~~   41 (87)
                      ..-|.|+.|.+.|...        ....|.|..|+-
T Consensus       126 ~~~Y~Cp~C~kkyt~Lea~~L~~~~~~~F~C~~C~g  161 (436)
T KOG2593|consen  126 VAGYVCPNCQKKYTSLEALQLLDNETGEFHCENCGG  161 (436)
T ss_pred             cccccCCccccchhhhHHHHhhcccCceEEEecCCC
Confidence            3456777777776654        234566666664


No 117
>PF00301 Rubredoxin:  Rubredoxin;  InterPro: IPR004039 Rubredoxin is a low molecular weight iron-containing bacterial protein involved in electron transfer [, ], sometimes replacing ferredoxin as an electron carrier []. The 3-D structures of a number of rubredoxins have been solved [, ]. The fold belongs to the alpha+beta class, with 2 alpha-helices and 2-3 beta-strands. Its active site contains an iron ion which is co-ordinated by the sulphurs of four conserved cysteine residues forming an almost regular tetrahedron. The conserved cysteines reside on two loops, which are the most conserved regions of the protein. In addition, a ring of acidic residues in the proximity of the [Fe(Cys)4] centre is also well-conserved []. ; GO: 0009055 electron carrier activity, 0046872 metal ion binding; PDB: 2RDV_C 1RDV_A 1S24_A 1T9O_B 1B2J_A 1SMW_A 2PVE_B 1BFY_A 1T9P_C 1C09_C ....
Probab=81.85  E-value=0.67  Score=19.17  Aligned_cols=7  Identities=43%  Similarity=1.431  Sum_probs=3.3

Q ss_pred             ccCCCCC
Q psy12019         63 YQCPQCP   69 (87)
Q Consensus        63 ~~c~~c~   69 (87)
                      |.|+.|+
T Consensus        35 w~CP~C~   41 (47)
T PF00301_consen   35 WVCPVCG   41 (47)
T ss_dssp             -B-TTTS
T ss_pred             CcCcCCC
Confidence            6666665


No 118
>PRK03681 hypA hydrogenase nickel incorporation protein; Validated
Probab=81.84  E-value=0.67  Score=22.89  Aligned_cols=10  Identities=20%  Similarity=0.644  Sum_probs=5.3

Q ss_pred             eecCcccccc
Q psy12019         34 FMCDVCGKGY   43 (87)
Q Consensus        34 ~~c~~c~~~~   43 (87)
                      ..|..||..|
T Consensus        71 ~~C~~Cg~~~   80 (114)
T PRK03681         71 CWCETCQQYV   80 (114)
T ss_pred             EEcccCCCee
Confidence            4566666433


No 119
>PF13453 zf-TFIIB:  Transcription factor zinc-finger
Probab=81.84  E-value=2.2  Score=16.81  Aligned_cols=16  Identities=19%  Similarity=0.405  Sum_probs=7.8

Q ss_pred             eecCcccccccchhhH
Q psy12019         34 FMCDVCGKGYKYKNGI   49 (87)
Q Consensus        34 ~~c~~c~~~~~~~~~~   49 (87)
                      ..|+.|+-.+.....+
T Consensus        20 d~C~~C~G~W~d~~el   35 (41)
T PF13453_consen   20 DVCPSCGGIWFDAGEL   35 (41)
T ss_pred             EECCCCCeEEccHHHH
Confidence            3455555554444433


No 120
>PF06524 NOA36:  NOA36 protein;  InterPro: IPR010531 This family consists of several NOA36 proteins which contain 29 highly conserved cysteine residues. The function of this protein is unknown.; GO: 0008270 zinc ion binding, 0005634 nucleus
Probab=81.70  E-value=0.66  Score=26.41  Aligned_cols=23  Identities=26%  Similarity=0.788  Sum_probs=15.4

Q ss_pred             CCCccCCCCCcccccchHHHhhhh
Q psy12019         60 EPKYQCPQCPYRAKQNAHLTTHMA   83 (87)
Q Consensus        60 ~~~~~c~~c~~~f~~~~~l~~h~~   83 (87)
                      ++ +.|+.||........|.--.|
T Consensus       208 k~-~PCPKCg~et~eTkdLSmStR  230 (314)
T PF06524_consen  208 KP-IPCPKCGYETQETKDLSMSTR  230 (314)
T ss_pred             CC-CCCCCCCCcccccccceeeee
Confidence            55 889999987766655544333


No 121
>PRK00564 hypA hydrogenase nickel incorporation protein; Provisional
Probab=81.25  E-value=0.74  Score=22.86  Aligned_cols=10  Identities=20%  Similarity=0.780  Sum_probs=5.3

Q ss_pred             eecCcccccc
Q psy12019         34 FMCDVCGKGY   43 (87)
Q Consensus        34 ~~c~~c~~~~   43 (87)
                      +.|..||..|
T Consensus        72 ~~C~~Cg~~~   81 (117)
T PRK00564         72 LECKDCSHVF   81 (117)
T ss_pred             EEhhhCCCcc
Confidence            4566666444


No 122
>PF07282 OrfB_Zn_ribbon:  Putative transposase DNA-binding domain;  InterPro: IPR010095 This entry represents a region of a sequence similarity between a family of putative transposases of Thermoanaerobacter tengcongensis, smaller related proteins from Bacillus anthracis, putative transposes described by IPR001959 from INTERPRO, and other proteins. More information about these proteins can be found at Protein of the Month: Transposase [].
Probab=81.15  E-value=2.4  Score=18.62  Aligned_cols=9  Identities=33%  Similarity=1.490  Sum_probs=4.5

Q ss_pred             ccCCCCCcc
Q psy12019         63 YQCPQCPYR   71 (87)
Q Consensus        63 ~~c~~c~~~   71 (87)
                      +.|+.||..
T Consensus        47 ~~C~~Cg~~   55 (69)
T PF07282_consen   47 FTCPNCGFE   55 (69)
T ss_pred             EEcCCCCCE
Confidence            555555543


No 123
>COG4888 Uncharacterized Zn ribbon-containing protein [General function prediction only]
Probab=80.98  E-value=0.84  Score=22.07  Aligned_cols=30  Identities=23%  Similarity=0.476  Sum_probs=19.0

Q ss_pred             CCcccccccchhhhcc-------CCcceecCcccccc
Q psy12019         14 PKHNKCLINWSAVQQN-------HAGMFMCDVCGKGY   43 (87)
Q Consensus        14 ~~~~~c~~c~~~~~~~-------~~~~~~c~~c~~~~   43 (87)
                      ++.|.|+.|+..-...       ......|..||.+|
T Consensus        20 ~k~FtCp~Cghe~vs~ctvkk~~~~g~~~Cg~CGls~   56 (104)
T COG4888          20 PKTFTCPRCGHEKVSSCTVKKTVNIGTAVCGNCGLSF   56 (104)
T ss_pred             CceEecCccCCeeeeEEEEEecCceeEEEcccCcceE
Confidence            4567888888775542       22345677777655


No 124
>PF14446 Prok-RING_1:  Prokaryotic RING finger family 1
Probab=80.98  E-value=1.1  Score=19.13  Aligned_cols=26  Identities=23%  Similarity=0.611  Sum_probs=17.2

Q ss_pred             ccccccchhhhccCCcceecCcccccc
Q psy12019         17 NKCLINWSAVQQNHAGMFMCDVCGKGY   43 (87)
Q Consensus        17 ~~c~~c~~~~~~~~~~~~~c~~c~~~~   43 (87)
                      ..|..|++.|..... ...|+.||..+
T Consensus         6 ~~C~~Cg~~~~~~dD-iVvCp~Cgapy   31 (54)
T PF14446_consen    6 CKCPVCGKKFKDGDD-IVVCPECGAPY   31 (54)
T ss_pred             ccChhhCCcccCCCC-EEECCCCCCcc
Confidence            468888888865333 34788887653


No 125
>PHA00626 hypothetical protein
Probab=80.46  E-value=0.88  Score=19.56  Aligned_cols=13  Identities=31%  Similarity=0.950  Sum_probs=10.7

Q ss_pred             ccCCCCCcccccc
Q psy12019         63 YQCPQCPYRAKQN   75 (87)
Q Consensus        63 ~~c~~c~~~f~~~   75 (87)
                      |.|+.||..|...
T Consensus        24 YkCkdCGY~ft~~   36 (59)
T PHA00626         24 YVCCDCGYNDSKD   36 (59)
T ss_pred             eEcCCCCCeechh
Confidence            9999999888643


No 126
>COG4391 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=80.22  E-value=1.4  Score=19.28  Aligned_cols=15  Identities=7%  Similarity=-0.155  Sum_probs=7.2

Q ss_pred             eccccCCCCcccccc
Q psy12019          7 KPRTHREPKHNKCLI   21 (87)
Q Consensus         7 h~~~h~~~~~~~c~~   21 (87)
                      +..++.+..++-|+-
T Consensus        15 ~~~I~~~~~~l~C~g   29 (62)
T COG4391          15 HETIEIGDLPLMCPG   29 (62)
T ss_pred             ceEEEeCCeeEEcCC
Confidence            334455555555543


No 127
>COG1773 Rubredoxin [Energy production and conversion]
Probab=80.09  E-value=1.1  Score=19.20  Aligned_cols=14  Identities=7%  Similarity=0.124  Sum_probs=8.2

Q ss_pred             cccccccchhhhcc
Q psy12019         16 HNKCLINWSAVQQN   29 (87)
Q Consensus        16 ~~~c~~c~~~~~~~   29 (87)
                      -++|..|+..|...
T Consensus         3 ~~~C~~CG~vYd~e   16 (55)
T COG1773           3 RWRCSVCGYVYDPE   16 (55)
T ss_pred             ceEecCCceEeccc
Confidence            35666666666543


No 128
>PF08271 TF_Zn_Ribbon:  TFIIB zinc-binding;  InterPro: IPR013137 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents a zinc finger motif found in transcription factor IIB (TFIIB). In eukaryotes the initiation of transcription of protein encoding genes by the polymerase II complexe (Pol II) is modulated by general and specific transcription factors. The general transcription factors operate through common promoters elements (such as the TATA box). At least seven different proteins associate to form the general transcription factors: TFIIA, -IIB, -IID, -IIE, -IIF, -IIG, and -IIH [].  TFIIB and TFIID are responsible for promoter recognition and interaction with pol II; together with Pol II, they form a minimal initiation complex capable of transcription under certain conditions. The TATA box of a Pol II promoter is bound in the initiation complex by the TBP subunit of TFIID, which bends the DNA around the C-terminal domain of TFIIB whereas the N-terminal zinc finger of TFIIB interacts with Pol II [, ]. The TFIIB zinc finger adopts a zinc ribbon fold characterised by two beta-hairpins forming two structurally similar zinc-binding sub-sites []. The zinc finger contacts the rbp1 subunit of Pol II through its dock domain, a conserved region of about 70 amino acids located close to the polymerase active site []. In the Pol II complex this surface is located near the RNA exit groove. Interestingly this sequence is best conserved in the three polymerases that utilise a TFIIB-like general transcription factor (Pol II, Pol III, and archaeal RNA polymerase) but not in Pol I [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0006355 regulation of transcription, DNA-dependent; PDB: 1VD4_A 1PFT_A 3K1F_M 3K7A_M 1RO4_A 1RLY_A 1DL6_A.
Probab=79.31  E-value=1.1  Score=17.85  Aligned_cols=26  Identities=27%  Similarity=0.372  Sum_probs=12.8

Q ss_pred             ccccccchhhh--ccCCcceecCccccc
Q psy12019         17 NKCLINWSAVQ--QNHAGMFMCDVCGKG   42 (87)
Q Consensus        17 ~~c~~c~~~~~--~~~~~~~~c~~c~~~   42 (87)
                      +.|+.|+....  ......+.|..||..
T Consensus         1 m~Cp~Cg~~~~~~D~~~g~~vC~~CG~V   28 (43)
T PF08271_consen    1 MKCPNCGSKEIVFDPERGELVCPNCGLV   28 (43)
T ss_dssp             ESBTTTSSSEEEEETTTTEEEETTT-BB
T ss_pred             CCCcCCcCCceEEcCCCCeEECCCCCCE
Confidence            35666665431  113344567777654


No 129
>TIGR00416 sms DNA repair protein RadA. The gene protuct codes for a probable ATP-dependent protease involved in both DNA repair and degradation of proteins, peptides, glycopeptides. Also known as sms. Residues 11-28 of the SEED alignment contain a putative Zn binding domain. Residues 110-117 of the seed contain a putative ATP binding site both documented in Haemophilus and in Listeria monocytogenes. for E.coli see ( J. BACTERIOL. 178:5045-5048(1996)).
Probab=79.21  E-value=1.1  Score=27.59  Aligned_cols=24  Identities=13%  Similarity=0.055  Sum_probs=18.9

Q ss_pred             cccccccchhhhccCCcceecCccccc
Q psy12019         16 HNKCLINWSAVQQNHAGMFMCDVCGKG   42 (87)
Q Consensus        16 ~~~c~~c~~~~~~~~~~~~~c~~c~~~   42 (87)
                      .|.|..|+.....   +.+.|+.|+.+
T Consensus         7 ~y~C~~Cg~~~~~---~~g~Cp~C~~w   30 (454)
T TIGR00416         7 KFVCQHCGADSPK---WQGKCPACHAW   30 (454)
T ss_pred             eEECCcCCCCCcc---ccEECcCCCCc
Confidence            5999999977544   57899999853


No 130
>PRK14873 primosome assembly protein PriA; Provisional
Probab=79.08  E-value=2.2  Score=27.67  Aligned_cols=9  Identities=33%  Similarity=1.254  Sum_probs=6.9

Q ss_pred             ccCCCCCcc
Q psy12019         63 YQCPQCPYR   71 (87)
Q Consensus        63 ~~c~~c~~~   71 (87)
                      +.|+.||..
T Consensus       423 ~~Cp~Cgs~  431 (665)
T PRK14873        423 WRCPRCGSD  431 (665)
T ss_pred             ccCCCCcCC
Confidence            888888754


No 131
>COG5048 FOG: Zn-finger [General function prediction only]
Probab=79.03  E-value=2  Score=25.37  Aligned_cols=54  Identities=22%  Similarity=0.460  Sum_probs=41.8

Q ss_pred             cceecCcccccccchhhHHHHhhhhcCCCCCccCCC--CCcccccchHHHhhhhhcC
Q psy12019         32 GMFMCDVCGKGYKYKNGIYRHKKFECGQEPKYQCPQ--CPYRAKQNAHLTTHMAIKH   86 (87)
Q Consensus        32 ~~~~c~~c~~~~~~~~~~~~h~~~~~~~~~~~~c~~--c~~~f~~~~~l~~h~~~~h   86 (87)
                      ..+.|+.|...|........+.+.+.++++ +.|..  |...+.....+..+...++
T Consensus        32 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~   87 (467)
T COG5048          32 RPDSCPNCTDSFSRLEHLTRHIRSHTGEKP-SQCSYSGCDKSFSRPLELSRHLRTHH   87 (467)
T ss_pred             chhhcccccccccccchhhhhcccccccCC-ccccccccccccCCcchhhhhccccc
Confidence            457788999999999999999999999888 88865  4566666666666665544


No 132
>KOG2893|consensus
Probab=78.62  E-value=1.1  Score=25.32  Aligned_cols=26  Identities=27%  Similarity=0.588  Sum_probs=22.2

Q ss_pred             CCCccCCCCCcccccchHHHhhhhhcCC
Q psy12019         60 EPKYQCPQCPYRAKQNAHLTTHMAIKHY   87 (87)
Q Consensus        60 ~~~~~c~~c~~~f~~~~~l~~h~~~~h~   87 (87)
                      ++ | |..|++.|-...-|..|++..||
T Consensus        10 kp-w-cwycnrefddekiliqhqkakhf   35 (341)
T KOG2893|consen   10 KP-W-CWYCNREFDDEKILIQHQKAKHF   35 (341)
T ss_pred             Cc-e-eeecccccchhhhhhhhhhhccc
Confidence            44 4 78899999999999999998876


No 133
>TIGR01206 lysW lysine biosynthesis protein LysW. This very small, poorly characterized protein has been shown essential in Thermus thermophilus for an unusual pathway of Lys biosynthesis from aspartate by way of alpha-aminoadipate (AAA) rather than diaminopimelate. It is found also in Deinococcus radiodurans and Pyrococcus horikoshii, which appear to share the AAA pathway.
Probab=78.36  E-value=1.6  Score=18.62  Aligned_cols=9  Identities=22%  Similarity=0.652  Sum_probs=4.6

Q ss_pred             ccCCCCCcc
Q psy12019         63 YQCPQCPYR   71 (87)
Q Consensus        63 ~~c~~c~~~   71 (87)
                      ..|+.||..
T Consensus        23 V~Cp~CGae   31 (54)
T TIGR01206        23 VICDECGAE   31 (54)
T ss_pred             EeCCCCCCE
Confidence            455555543


No 134
>smart00661 RPOL9 RNA polymerase subunit 9.
Probab=77.95  E-value=1.9  Score=17.72  Aligned_cols=9  Identities=33%  Similarity=1.250  Sum_probs=4.0

Q ss_pred             ccCCCCCcc
Q psy12019         63 YQCPQCPYR   71 (87)
Q Consensus        63 ~~c~~c~~~   71 (87)
                      +.|+.||..
T Consensus        21 ~vC~~Cg~~   29 (52)
T smart00661       21 FVCRKCGYE   29 (52)
T ss_pred             EECCcCCCe
Confidence            444444433


No 135
>KOG0978|consensus
Probab=77.66  E-value=0.7  Score=29.86  Aligned_cols=52  Identities=15%  Similarity=0.259  Sum_probs=27.3

Q ss_pred             ccccccchhhhccCCcceecCcccccccchhhHHHHhhhhcCCCCCccCCCCCcccccchHHH
Q psy12019         17 NKCLINWSAVQQNHAGMFMCDVCGKGYKYKNGIYRHKKFECGQEPKYQCPQCPYRAKQNAHLT   79 (87)
Q Consensus        17 ~~c~~c~~~~~~~~~~~~~c~~c~~~~~~~~~~~~h~~~~~~~~~~~~c~~c~~~f~~~~~l~   79 (87)
                      ..|+.|...+...     .-..|+-.|.....     +.-...+. -.||.|+.+|...--+.
T Consensus       644 LkCs~Cn~R~Kd~-----vI~kC~H~FC~~Cv-----q~r~etRq-RKCP~Cn~aFganDv~~  695 (698)
T KOG0978|consen  644 LKCSVCNTRWKDA-----VITKCGHVFCEECV-----QTRYETRQ-RKCPKCNAAFGANDVHR  695 (698)
T ss_pred             eeCCCccCchhhH-----HHHhcchHHHHHHH-----HHHHHHhc-CCCCCCCCCCCcccccc
Confidence            3577776443332     22345555544432     22222244 58889999987664433


No 136
>PRK11823 DNA repair protein RadA; Provisional
Probab=77.64  E-value=1.3  Score=27.18  Aligned_cols=25  Identities=16%  Similarity=0.182  Sum_probs=19.1

Q ss_pred             CcccccccchhhhccCCcceecCccccc
Q psy12019         15 KHNKCLINWSAVQQNHAGMFMCDVCGKG   42 (87)
Q Consensus        15 ~~~~c~~c~~~~~~~~~~~~~c~~c~~~   42 (87)
                      ..|.|..|+.....   +.+.|+.|+.+
T Consensus         6 ~~y~C~~Cg~~~~~---~~g~Cp~C~~w   30 (446)
T PRK11823          6 TAYVCQECGAESPK---WLGRCPECGAW   30 (446)
T ss_pred             CeEECCcCCCCCcc---cCeeCcCCCCc
Confidence            46999999977544   57889999753


No 137
>PF05290 Baculo_IE-1:  Baculovirus immediate-early protein (IE-0);  InterPro: IPR007954 This entry contains the Baculovirus immediate-early protein IE-0.
Probab=77.14  E-value=2  Score=22.01  Aligned_cols=60  Identities=22%  Similarity=0.248  Sum_probs=31.5

Q ss_pred             CCCCcccccccchhhhccC-CcceecCcccccccchhhHHHHhhhhcCCCCCccCCCCCcccccchH
Q psy12019         12 REPKHNKCLINWSAVQQNH-AGMFMCDVCGKGYKYKNGIYRHKKFECGQEPKYQCPQCPYRAKQNAH   77 (87)
Q Consensus        12 ~~~~~~~c~~c~~~~~~~~-~~~~~c~~c~~~~~~~~~~~~h~~~~~~~~~~~~c~~c~~~f~~~~~   77 (87)
                      .+.+.|+|.+|..+...+. -+|-+|  ||...-..--.. -.+.-+ --  -.|++|.-+|.+++.
T Consensus        76 ~d~~lYeCnIC~etS~ee~FLKPneC--CgY~iCn~Cya~-LWK~~~-~y--pvCPvCkTSFKss~~  136 (140)
T PF05290_consen   76 LDPKLYECNICKETSAEERFLKPNEC--CGYSICNACYAN-LWKFCN-LY--PVCPVCKTSFKSSSS  136 (140)
T ss_pred             cCCCceeccCcccccchhhcCCcccc--cchHHHHHHHHH-HHHHcc-cC--CCCCccccccccccc
Confidence            4557899999998876541 234333  443332222111 112111 12  378888888876543


No 138
>COG2824 PhnA Uncharacterized Zn-ribbon-containing protein involved in phosphonate metabolism [Inorganic ion transport and metabolism]
Probab=77.11  E-value=1.7  Score=21.32  Aligned_cols=29  Identities=17%  Similarity=0.416  Sum_probs=21.2

Q ss_pred             cccccchhhhccCCcceecCcccccccch
Q psy12019         18 KCLINWSAVQQNHAGMFMCDVCGKGYKYK   46 (87)
Q Consensus        18 ~c~~c~~~~~~~~~~~~~c~~c~~~~~~~   46 (87)
                      .|+.|...+.......+.|+.|+.-+...
T Consensus         5 ~cp~c~sEytYed~~~~~cpec~~ew~~~   33 (112)
T COG2824           5 PCPKCNSEYTYEDGGQLICPECAHEWNEN   33 (112)
T ss_pred             CCCccCCceEEecCceEeCchhccccccc
Confidence            57888877777655678899988766533


No 139
>cd01121 Sms Sms (bacterial radA) DNA repair protein. This protein is not related to archael radA any more than is to other RecA-like NTPases. Sms has a role in recombination and recombinational repair and is responsible for the stabilization or processing of branched DNA molecules.
Probab=76.30  E-value=1.7  Score=26.06  Aligned_cols=23  Identities=17%  Similarity=0.186  Sum_probs=16.9

Q ss_pred             ccccccchhhhccCCcceecCccccc
Q psy12019         17 NKCLINWSAVQQNHAGMFMCDVCGKG   42 (87)
Q Consensus        17 ~~c~~c~~~~~~~~~~~~~c~~c~~~   42 (87)
                      |.|..|+.....   +.+.|+.|+.+
T Consensus         1 ~~c~~cg~~~~~---~~g~cp~c~~w   23 (372)
T cd01121           1 YVCSECGYVSPK---WLGKCPECGEW   23 (372)
T ss_pred             CCCCCCCCCCCC---ccEECcCCCCc
Confidence            678889876543   56789999853


No 140
>PF05191 ADK_lid:  Adenylate kinase, active site lid;  InterPro: IPR007862 Adenylate kinases (ADK; 2.7.4.3 from EC) are phosphotransferases that catalyse the Mg-dependent reversible conversion of ATP and AMP to two molecules of ADP, an essential reaction for many processes in living cells. In large variants of adenylate kinase, the AMP and ATP substrates are buried in a domain that undergoes conformational changes from an open to a closed state when bound to substrate; the ligand is then contained within a highly specific environment required for catalysis. Adenylate kinase is a 3-domain protein consisting of a large central CORE domain flanked by a LID domain on one side and the AMP-binding NMPbind domain on the other []. The LID domain binds ATP and covers the phosphates at the active site. The substrates first bind the CORE domain, followed by closure of the active site by the LID and NMPbind domains. Comparisons of adenylate kinases have revealed a particular divergence in the active site lid. In some organisms, particularly the Gram-positive bacteria, residues in the lid domain have been mutated to cysteines and these cysteine residues (two CX(n)C motifs) are responsible for the binding of a zinc ion. The bound zinc ion in the lid domain is clearly structurally homologous to Zinc-finger domains. However, it is unclear whether the adenylate kinase lid is a novel zinc-finger DNA/RNA binding domain, or that the lid bound zinc serves a purely structural function [].; GO: 0004017 adenylate kinase activity; PDB: 3BE4_A 2OSB_B 2ORI_A 2EU8_A 3DL0_A 1P3J_A 2QAJ_A 2OO7_A 2P3S_A 3DKV_A ....
Probab=75.95  E-value=2.5  Score=16.36  Aligned_cols=10  Identities=40%  Similarity=1.208  Sum_probs=6.0

Q ss_pred             ecCccccccc
Q psy12019         35 MCDVCGKGYK   44 (87)
Q Consensus        35 ~c~~c~~~~~   44 (87)
                      .|..||+.|.
T Consensus         3 ~C~~Cg~~Yh   12 (36)
T PF05191_consen    3 ICPKCGRIYH   12 (36)
T ss_dssp             EETTTTEEEE
T ss_pred             CcCCCCCccc
Confidence            5666666654


No 141
>COG4306 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=75.90  E-value=1  Score=22.74  Aligned_cols=10  Identities=30%  Similarity=1.182  Sum_probs=4.8

Q ss_pred             cCcccccccc
Q psy12019         36 CDVCGKGYKY   45 (87)
Q Consensus        36 c~~c~~~~~~   45 (87)
                      |..||..|.+
T Consensus        71 chncgs~fpw   80 (160)
T COG4306          71 CHNCGSRFPW   80 (160)
T ss_pred             hhcCCCCCCc
Confidence            4444444444


No 142
>KOG4167|consensus
Probab=75.36  E-value=0.42  Score=31.00  Aligned_cols=24  Identities=17%  Similarity=0.310  Sum_probs=20.3

Q ss_pred             CccCCCCCcccccchHHHhhhhhc
Q psy12019         62 KYQCPQCPYRAKQNAHLTTHMAIK   85 (87)
Q Consensus        62 ~~~c~~c~~~f~~~~~l~~h~~~~   85 (87)
                      .|-|.+|+|.|----+++.|++.|
T Consensus       792 iFpCreC~kvF~KiKSrNAHMK~H  815 (907)
T KOG4167|consen  792 IFPCRECGKVFFKIKSRNAHMKTH  815 (907)
T ss_pred             eeehHHHHHHHHHHhhhhHHHHHH
Confidence            488999999998888888888765


No 143
>COG2331 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=75.17  E-value=1.7  Score=19.94  Aligned_cols=10  Identities=30%  Similarity=1.188  Sum_probs=5.6

Q ss_pred             eecCcccccc
Q psy12019         34 FMCDVCGKGY   43 (87)
Q Consensus        34 ~~c~~c~~~~   43 (87)
                      |+|.+||..|
T Consensus        13 Y~c~~cg~~~   22 (82)
T COG2331          13 YECTECGNRF   22 (82)
T ss_pred             EeecccchHH
Confidence            5566666543


No 144
>PF01155 HypA:  Hydrogenase expression/synthesis hypA family;  InterPro: IPR000688 Bacterial membrane-bound nickel-dependent hydrogenases requires a number of accessory proteins which are involved in their maturation. The exact role of these proteins is not yet clear, but some seem to be required for the incorporation of the nickel ions []. One of these proteins is generally known as hypA. It is a protein of about 12 to 14 kDa that contains, in its C-terminal region, four conserved cysteines that form a zinc-finger like motif. Escherichia coli has two proteins that belong to this family, hypA and hybF. A homologue, MJ0214, has also been found in a number of archaeal species, including the genome of Methanocaldococcus jannaschii (Methanococcus jannaschii).; GO: 0016151 nickel ion binding, 0006464 protein modification process; PDB: 2KDX_A 3A44_D 3A43_B.
Probab=74.91  E-value=0.54  Score=23.15  Aligned_cols=12  Identities=25%  Similarity=0.706  Sum_probs=6.3

Q ss_pred             eecCcccccccc
Q psy12019         34 FMCDVCGKGYKY   45 (87)
Q Consensus        34 ~~c~~c~~~~~~   45 (87)
                      ..|..||..|..
T Consensus        71 ~~C~~Cg~~~~~   82 (113)
T PF01155_consen   71 ARCRDCGHEFEP   82 (113)
T ss_dssp             EEETTTS-EEEC
T ss_pred             EECCCCCCEEec
Confidence            456666665543


No 145
>KOG4167|consensus
Probab=74.30  E-value=0.78  Score=29.89  Aligned_cols=27  Identities=30%  Similarity=0.472  Sum_probs=23.4

Q ss_pred             cceecCcccccccchhhHHHHhhhhcC
Q psy12019         32 GMFMCDVCGKGYKYKNGIYRHKKFECG   58 (87)
Q Consensus        32 ~~~~c~~c~~~~~~~~~~~~h~~~~~~   58 (87)
                      .-|.|.+|++.|..-..+..|++.|.-
T Consensus       791 giFpCreC~kvF~KiKSrNAHMK~Hr~  817 (907)
T KOG4167|consen  791 GIFPCRECGKVFFKIKSRNAHMKTHRQ  817 (907)
T ss_pred             ceeehHHHHHHHHHHhhhhHHHHHHHH
Confidence            458999999999998889999998764


No 146
>COG3364 Zn-ribbon containing protein [General function prediction only]
Probab=74.03  E-value=0.97  Score=21.94  Aligned_cols=25  Identities=16%  Similarity=0.387  Sum_probs=13.8

Q ss_pred             cccccccchhhhccCCc-ceecCccc
Q psy12019         16 HNKCLINWSAVQQNHAG-MFMCDVCG   40 (87)
Q Consensus        16 ~~~c~~c~~~~~~~~~~-~~~c~~c~   40 (87)
                      |+.|..|+..|...... ..-|+.||
T Consensus         2 pH~CtrCG~vf~~g~~~il~GCp~CG   27 (112)
T COG3364           2 PHQCTRCGEVFDDGSEEILSGCPKCG   27 (112)
T ss_pred             CceecccccccccccHHHHccCcccc
Confidence            56677777777653111 22366665


No 147
>smart00440 ZnF_C2C2 C2C2 Zinc finger. Nucleic-acid-binding motif in transcriptional elongation factor TFIIS and RNA polymerases.
Probab=73.68  E-value=0.3  Score=19.37  Aligned_cols=10  Identities=40%  Similarity=0.939  Sum_probs=5.8

Q ss_pred             ccCCCCCccc
Q psy12019         63 YQCPQCPYRA   72 (87)
Q Consensus        63 ~~c~~c~~~f   72 (87)
                      |.|..|+..+
T Consensus        29 y~C~~C~~~w   38 (40)
T smart00440       29 YVCTKCGHRW   38 (40)
T ss_pred             EEeCCCCCEe
Confidence            5666666544


No 148
>PF13451 zf-trcl:  Probable zinc-binding domain
Probab=73.40  E-value=2.5  Score=17.70  Aligned_cols=16  Identities=19%  Similarity=0.708  Sum_probs=9.7

Q ss_pred             cceecCcccccccchh
Q psy12019         32 GMFMCDVCGKGYKYKN   47 (87)
Q Consensus        32 ~~~~c~~c~~~~~~~~   47 (87)
                      +.+.|..||..|....
T Consensus         3 k~l~C~dCg~~FvfTa   18 (49)
T PF13451_consen    3 KTLTCKDCGAEFVFTA   18 (49)
T ss_pred             eeEEcccCCCeEEEeh
Confidence            3556777776665544


No 149
>PF04810 zf-Sec23_Sec24:  Sec23/Sec24 zinc finger;  InterPro: IPR006895 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  COPII (coat protein complex II)-coated vesicles carry proteins from the endoplasmic reticulum (ER) to the Golgi complex []. COPII-coated vesicles form on the ER by the stepwise recruitment of three cytosolic components: Sar1-GTP to initiate coat formation, Sec23/24 heterodimer to select SNARE and cargo molecules, and Sec13/31 to induce coat polymerisation and membrane deformation [].  Sec23 p and Sec24p are structurally related, folding into five distinct domains: a beta-barrel, a zinc-finger, an alpha/beta trunk domain (IPR006896 from INTERPRO), an all-helical region (IPR006900 from INTERPRO), and a C-terminal gelsolin-like domain (IPR007123 from INTERPRO). This entry describes an approximately 55-residue Sec23/24 zinc-binding domain, which lies against the beta-barrel at the periphery of the complex. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0006886 intracellular protein transport, 0006888 ER to Golgi vesicle-mediated transport, 0030127 COPII vesicle coat; PDB: 3EFO_B 3EG9_B 3EGD_A 2YRC_A 2NUP_A 2YRD_A 3EGX_A 2NUT_A 3EH1_A 1PD0_A ....
Probab=72.91  E-value=3  Score=16.40  Aligned_cols=10  Identities=30%  Similarity=1.212  Sum_probs=4.3

Q ss_pred             cceecCcccc
Q psy12019         32 GMFMCDVCGK   41 (87)
Q Consensus        32 ~~~~c~~c~~   41 (87)
                      +.|.|..|+.
T Consensus        23 ~~w~C~~C~~   32 (40)
T PF04810_consen   23 KTWICNFCGT   32 (40)
T ss_dssp             TEEEETTT--
T ss_pred             CEEECcCCCC
Confidence            3455555553


No 150
>PF07649 C1_3:  C1-like domain;  InterPro: IPR011424 This short domain is rich in cysteines and histidines. The pattern of conservation is similar to that found in IPR002219 from INTERPRO. C1 domains are protein kinase C-like zinc finger structures. Diacylglycerol (DAG) kinases (DGKs) have a two or three commonly conserved cysteine-rich C1 domains []. DGKs modulate the balance between the two signaling lipids, DAG and phosphatidic acid (PA), by phosphorylating DAG to yield PA []. The PKD (protein kinase D) family are novel DAG receptors. They have twin C1 domains, designated C1a and C1b, which bind DAG or phorbol esters. Individual C1 domains differ in ligand-binding activity and selectivity []. ; GO: 0047134 protein-disulfide reductase activity, 0055114 oxidation-reduction process; PDB: 1V5N_A.
Probab=72.84  E-value=2.3  Score=15.44  Aligned_cols=8  Identities=25%  Similarity=1.111  Sum_probs=2.9

Q ss_pred             ceecCccc
Q psy12019         33 MFMCDVCG   40 (87)
Q Consensus        33 ~~~c~~c~   40 (87)
                      .|.|..|+
T Consensus        15 ~Y~C~~Cd   22 (30)
T PF07649_consen   15 FYRCSECD   22 (30)
T ss_dssp             EEE-TTT-
T ss_pred             eEECccCC
Confidence            44455443


No 151
>PF14803 Nudix_N_2:  Nudix N-terminal; PDB: 3CNG_C.
Probab=72.14  E-value=2.3  Score=16.27  Aligned_cols=7  Identities=43%  Similarity=1.550  Sum_probs=3.0

Q ss_pred             eecCccc
Q psy12019         34 FMCDVCG   40 (87)
Q Consensus        34 ~~c~~c~   40 (87)
                      +.|+.||
T Consensus        23 ~vC~~Cg   29 (34)
T PF14803_consen   23 LVCPACG   29 (34)
T ss_dssp             EEETTTT
T ss_pred             eECCCCC
Confidence            3444444


No 152
>PRK12496 hypothetical protein; Provisional
Probab=72.02  E-value=2.5  Score=22.34  Aligned_cols=11  Identities=36%  Similarity=0.776  Sum_probs=5.9

Q ss_pred             ceecCcccccc
Q psy12019         33 MFMCDVCGKGY   43 (87)
Q Consensus        33 ~~~c~~c~~~~   43 (87)
                      .+.|..|++.|
T Consensus       127 ~~~C~gC~~~~  137 (164)
T PRK12496        127 RKVCKGCKKKY  137 (164)
T ss_pred             eEECCCCCccc
Confidence            34566665554


No 153
>PF08792 A2L_zn_ribbon:  A2L zinc ribbon domain;  InterPro: IPR014900 This zinc ribbon protein is found associated with some viral A2L transcription factors []. 
Probab=71.93  E-value=3.5  Score=15.63  Aligned_cols=8  Identities=25%  Similarity=0.526  Sum_probs=3.2

Q ss_pred             cCCCCCcc
Q psy12019         64 QCPQCPYR   71 (87)
Q Consensus        64 ~c~~c~~~   71 (87)
                      .|..||..
T Consensus        23 ~C~~Cg~~   30 (33)
T PF08792_consen   23 VCIFCGSS   30 (33)
T ss_pred             EcccCCcE
Confidence            34444433


No 154
>PRK12380 hydrogenase nickel incorporation protein HybF; Provisional
Probab=71.51  E-value=1.9  Score=21.30  Aligned_cols=10  Identities=20%  Similarity=0.305  Sum_probs=6.0

Q ss_pred             eecCcccccc
Q psy12019         34 FMCDVCGKGY   43 (87)
Q Consensus        34 ~~c~~c~~~~   43 (87)
                      ..|..||..|
T Consensus        71 ~~C~~Cg~~~   80 (113)
T PRK12380         71 AWCWDCSQVV   80 (113)
T ss_pred             EEcccCCCEE
Confidence            4566676544


No 155
>PF12760 Zn_Tnp_IS1595:  Transposase zinc-ribbon domain;  InterPro: IPR024442 This zinc binding domain is found in a range of transposase proteins such as ISSPO8, ISSOD11, ISRSSP2 etc. It may be a zinc-binding beta ribbon domain that could bind DNA.
Probab=71.07  E-value=3.6  Score=16.67  Aligned_cols=8  Identities=38%  Similarity=1.186  Sum_probs=5.7

Q ss_pred             ccCCCCCc
Q psy12019         63 YQCPQCPY   70 (87)
Q Consensus        63 ~~c~~c~~   70 (87)
                      |.|..|++
T Consensus        38 ~~C~~C~~   45 (46)
T PF12760_consen   38 YRCKACRK   45 (46)
T ss_pred             EECCCCCC
Confidence            77777764


No 156
>PF00130 C1_1:  Phorbol esters/diacylglycerol binding domain (C1 domain);  InterPro: IPR002219 Diacylglycerol (DAG) is an important second messenger. Phorbol esters (PE) are analogues of DAG and potent tumour promoters that cause a variety of physiological changes when administered to both cells and tissues. DAG activates a family of serine/threonine protein kinases, collectively known as protein kinase C (PKC) []. Phorbol esters can directly stimulate PKC. The N-terminal region of PKC, known as C1, has been shown [] to bind PE and DAG in a phospholipid and zinc-dependent fashion. The C1 region contains one or two copies (depending on the isozyme of PKC) of a cysteine-rich domain, which is about 50 amino-acid residues long, and which is essential for DAG/PE-binding. The DAG/PE-binding domain binds two zinc ions; the ligands of these metal ions are probably the six cysteines and two histidines that are conserved in this domain.; GO: 0035556 intracellular signal transduction; PDB: 1RFH_A 2FNF_X 3PFQ_A 1PTQ_A 1PTR_A 2VRW_B 1XA6_A 2ENN_A 1TBN_A 1TBO_A ....
Probab=71.00  E-value=3.8  Score=16.88  Aligned_cols=29  Identities=17%  Similarity=0.221  Sum_probs=17.0

Q ss_pred             CCcccccccchhhhccCCcceecCccccc
Q psy12019         14 PKHNKCLINWSAVQQNHAGMFMCDVCGKG   42 (87)
Q Consensus        14 ~~~~~c~~c~~~~~~~~~~~~~c~~c~~~   42 (87)
                      ..|-.|..|++.........+.|..|+..
T Consensus         9 ~~~~~C~~C~~~i~g~~~~g~~C~~C~~~   37 (53)
T PF00130_consen    9 SKPTYCDVCGKFIWGLGKQGYRCSWCGLV   37 (53)
T ss_dssp             SSTEB-TTSSSBECSSSSCEEEETTTT-E
T ss_pred             CCCCCCcccCcccCCCCCCeEEECCCCCh
Confidence            34667777777764444456777777643


No 157
>KOG2071|consensus
Probab=70.68  E-value=3  Score=26.56  Aligned_cols=25  Identities=32%  Similarity=0.656  Sum_probs=21.6

Q ss_pred             CCCccCCCCCcccccchHHHhhhhhc
Q psy12019         60 EPKYQCPQCPYRAKQNAHLTTHMAIK   85 (87)
Q Consensus        60 ~~~~~c~~c~~~f~~~~~l~~h~~~~   85 (87)
                      .+ -+|..||.+|........|+.+|
T Consensus       417 ~p-nqC~~CG~R~~~~ee~sk~md~H  441 (579)
T KOG2071|consen  417 SP-NQCKSCGLRFDDSEERSKHMDIH  441 (579)
T ss_pred             Cc-chhcccccccccchhhhhHhhhh
Confidence            45 89999999999999988888775


No 158
>PF13878 zf-C2H2_3:  zinc-finger of acetyl-transferase ESCO
Probab=69.53  E-value=5.6  Score=15.81  Aligned_cols=11  Identities=36%  Similarity=0.827  Sum_probs=5.7

Q ss_pred             ecCcccccccc
Q psy12019         35 MCDVCGKGYKY   45 (87)
Q Consensus        35 ~c~~c~~~~~~   45 (87)
                      .|..||..+..
T Consensus        15 ~C~~CgM~Y~~   25 (41)
T PF13878_consen   15 TCPTCGMLYSP   25 (41)
T ss_pred             CCCCCCCEECC
Confidence            45555554433


No 159
>KOG0782|consensus
Probab=69.06  E-value=0.8  Score=29.16  Aligned_cols=44  Identities=23%  Similarity=0.401  Sum_probs=27.4

Q ss_pred             cceeeccccCCCCcccccccchhhhcc------CCcceecCcccccccch
Q psy12019          3 NVIVKPRTHREPKHNKCLINWSAVQQN------HAGMFMCDVCGKGYKYK   46 (87)
Q Consensus         3 ~l~~h~~~h~~~~~~~c~~c~~~~~~~------~~~~~~c~~c~~~~~~~   46 (87)
                      .|..|.=+|.....-+|..|++.|+..      ......|.+|..+|-..
T Consensus       240 ~fvrHHWVHrrRqeGkC~~CgKgFQQKf~FhsKEivAisCSWCKqayH~K  289 (1004)
T KOG0782|consen  240 GFVRHHWVHRRRQEGKCNTCGKGFQQKFFFHSKEIVAISCSWCKQAYHLK  289 (1004)
T ss_pred             cchHHhHhhHhhhccccchhhhhhhhheeeccccEEEEEehHHHHHhhcc
Confidence            344555555555566788888888765      22245677777666444


No 160
>PF09963 DUF2197:  Uncharacterized protein conserved in bacteria (DUF2197);  InterPro: IPR019241  This family represents various hypothetical bacterial proteins with no known function. 
Probab=68.58  E-value=1.9  Score=18.62  Aligned_cols=8  Identities=38%  Similarity=1.144  Sum_probs=4.6

Q ss_pred             ccCCCCCc
Q psy12019         63 YQCPQCPY   70 (87)
Q Consensus        63 ~~c~~c~~   70 (87)
                      |.|.+|..
T Consensus        32 YmC~eC~~   39 (56)
T PF09963_consen   32 YMCDECKE   39 (56)
T ss_pred             eeChhHHH
Confidence            66666643


No 161
>KOG2636|consensus
Probab=68.49  E-value=4.2  Score=25.17  Aligned_cols=28  Identities=25%  Similarity=0.462  Sum_probs=21.8

Q ss_pred             hhhcCCCCCccCCCCC-cccccchHHHhhh
Q psy12019         54 KFECGQEPKYQCPQCP-YRAKQNAHLTTHM   82 (87)
Q Consensus        54 ~~~~~~~~~~~c~~c~-~~f~~~~~l~~h~   82 (87)
                      +.|....- |.|.+|| +++...-.+.+|-
T Consensus       394 KLHGL~~e-y~CEICGNy~Y~GrkaF~RHF  422 (497)
T KOG2636|consen  394 KLHGLDIE-YNCEICGNYVYKGRKAFDRHF  422 (497)
T ss_pred             hhcCCCcc-cceeeccCccccCcHHHHHHh
Confidence            55666676 9999998 8888887777773


No 162
>KOG4173|consensus
Probab=68.49  E-value=2.2  Score=23.60  Aligned_cols=51  Identities=27%  Similarity=0.486  Sum_probs=34.7

Q ss_pred             ecCcccccccchhhHHHHhhh----------hcCCCCCccC--CCCCcccccchHHHhhhhhcC
Q psy12019         35 MCDVCGKGYKYKNGIYRHKKF----------ECGQEPKYQC--PQCPYRAKQNAHLTTHMAIKH   86 (87)
Q Consensus        35 ~c~~c~~~~~~~~~~~~h~~~----------~~~~~~~~~c--~~c~~~f~~~~~l~~h~~~~h   86 (87)
                      .|..|.+.|...-.|..|+.-          -.|..- |+|  ..|+.-|........|+-..|
T Consensus       108 sCs~C~r~~Pt~hLLd~HI~E~HDs~Fqa~veRG~dM-y~ClvEgCt~KFkT~r~RkdH~I~~H  170 (253)
T KOG4173|consen  108 SCSFCKRAFPTGHLLDAHILEWHDSLFQALVERGQDM-YQCLVEGCTEKFKTSRDRKDHMIRMH  170 (253)
T ss_pred             hhHHHHHhCCchhhhhHHHHHHHHHHHHHHHHcCccH-HHHHHHhhhhhhhhhhhhhhHHHHhc
Confidence            688888888877766666542          223233 777  568888888888777776655


No 163
>cd00065 FYVE FYVE domain; Zinc-binding domain; targets proteins to membrane lipids via interaction with phosphatidylinositol-3-phosphate, PI3P; present in Fab1, YOTB, Vac1, and EEA1;
Probab=68.30  E-value=3.7  Score=17.16  Aligned_cols=28  Identities=18%  Similarity=0.345  Sum_probs=17.1

Q ss_pred             cccccchhhhccCCcceecCcccccccch
Q psy12019         18 KCLINWSAVQQNHAGMFMCDVCGKGYKYK   46 (87)
Q Consensus        18 ~c~~c~~~~~~~~~~~~~c~~c~~~~~~~   46 (87)
                      .|..|++.|.... +.+.|..||+.|-..
T Consensus         4 ~C~~C~~~F~~~~-rk~~Cr~Cg~~~C~~   31 (57)
T cd00065           4 SCMGCGKPFTLTR-RRHHCRNCGRIFCSK   31 (57)
T ss_pred             cCcccCccccCCc-cccccCcCcCCcChH
Confidence            4667777776632 345677777766543


No 164
>PF01927 Mut7-C:  Mut7-C RNAse domain;  InterPro: IPR002782 This prokaryotic family of proteins have no known function. The proteins contain four conserved cysteines that may be involved in metal binding or disulphide bridges.
Probab=66.86  E-value=4.3  Score=20.95  Aligned_cols=19  Identities=21%  Similarity=0.531  Sum_probs=14.9

Q ss_pred             ccCCCCCcccccchHHHhh
Q psy12019         63 YQCPQCPYRAKQNAHLTTH   81 (87)
Q Consensus        63 ~~c~~c~~~f~~~~~l~~h   81 (87)
                      +.|+.||+.|..-++..+-
T Consensus       125 ~~C~~C~kiyW~GsH~~~~  143 (147)
T PF01927_consen  125 WRCPGCGKIYWEGSHWRRM  143 (147)
T ss_pred             EECCCCCCEecccccHHHH
Confidence            8999999999877665543


No 165
>TIGR00100 hypA hydrogenase nickel insertion protein HypA. In Hpylori, hypA mutant abolished hydrogenase activity and decrease in urease activity. Nickel supplementation in media restored urease activity and partial hydrogenase activity. HypA probably involved in inserting Ni in enzymes.
Probab=66.62  E-value=2.8  Score=20.74  Aligned_cols=12  Identities=17%  Similarity=0.465  Sum_probs=7.1

Q ss_pred             eecCcccccccc
Q psy12019         34 FMCDVCGKGYKY   45 (87)
Q Consensus        34 ~~c~~c~~~~~~   45 (87)
                      ..|..||..|..
T Consensus        71 ~~C~~Cg~~~~~   82 (115)
T TIGR00100        71 CECEDCSEEVSP   82 (115)
T ss_pred             EEcccCCCEEec
Confidence            567777755533


No 166
>PF07975 C1_4:  TFIIH C1-like domain;  InterPro: IPR004595 All proteins in this domain for which functions are known are components of the TFIIH complex which is involved in the initiation of transcription and nucleotide excision repair. It includes the yeast transcription factor Ssl1 (Suppressor of stem-loop protein 1) that is essential for translation initiation and affects UV resistance. The C-terminal region is essential for transcription activity. This regions binds three zinc atoms through two independent domain. The first contains a C4 zinc finger motif, whereas the second is characterised by a CX(2)CX(2-4)FCADCD motif. The solution structure of the second C-terminal domain revealed homology with the regulatory domain of protein kinase C [].; GO: 0006281 DNA repair, 0005634 nucleus; PDB: 1Z60_A.
Probab=66.47  E-value=2  Score=18.10  Aligned_cols=16  Identities=13%  Similarity=0.439  Sum_probs=5.9

Q ss_pred             ceecCcccccccchhh
Q psy12019         33 MFMCDVCGKGYKYKNG   48 (87)
Q Consensus        33 ~~~c~~c~~~~~~~~~   48 (87)
                      .|+|+.|.+.|-..-.
T Consensus        21 ~y~C~~C~~~FC~dCD   36 (51)
T PF07975_consen   21 RYRCPKCKNHFCIDCD   36 (51)
T ss_dssp             EE--TTTT--B-HHHH
T ss_pred             eEECCCCCCccccCcC
Confidence            4566666665554443


No 167
>KOG0320|consensus
Probab=66.42  E-value=2  Score=23.09  Aligned_cols=49  Identities=20%  Similarity=0.343  Sum_probs=29.2

Q ss_pred             CCcccccccchhhhccCCcceecCcccccccchhhHHHHhhhhcCCCCCccCCCCCccc
Q psy12019         14 PKHNKCLINWSAVQQNHAGMFMCDVCGKGYKYKNGIYRHKKFECGQEPKYQCPQCPYRA   72 (87)
Q Consensus        14 ~~~~~c~~c~~~~~~~~~~~~~c~~c~~~~~~~~~~~~h~~~~~~~~~~~~c~~c~~~f   72 (87)
                      +..|.|++|...+....   -....||-.|...-.     +.... .. ..|+.|+|..
T Consensus       129 ~~~~~CPiCl~~~sek~---~vsTkCGHvFC~~Ci-----k~alk-~~-~~CP~C~kkI  177 (187)
T KOG0320|consen  129 EGTYKCPICLDSVSEKV---PVSTKCGHVFCSQCI-----KDALK-NT-NKCPTCRKKI  177 (187)
T ss_pred             ccccCCCceecchhhcc---ccccccchhHHHHHH-----HHHHH-hC-CCCCCccccc
Confidence            44589999988876641   134567777755432     22111 23 6788888744


No 168
>KOG2785|consensus
Probab=66.34  E-value=6.2  Score=23.91  Aligned_cols=21  Identities=14%  Similarity=0.297  Sum_probs=15.4

Q ss_pred             ccCCCCCcccccchHHHhhhh
Q psy12019         63 YQCPQCPYRAKQNAHLTTHMA   83 (87)
Q Consensus        63 ~~c~~c~~~f~~~~~l~~h~~   83 (87)
                      +.|.+|.+.|........|+.
T Consensus        69 ~~c~~c~k~~~s~~a~~~hl~   89 (390)
T KOG2785|consen   69 VYCEACNKSFASPKAHENHLK   89 (390)
T ss_pred             eehHHhhccccChhhHHHHHH
Confidence            788888888877766666653


No 169
>PHA02942 putative transposase; Provisional
Probab=66.30  E-value=8.9  Score=23.26  Aligned_cols=8  Identities=50%  Similarity=1.800  Sum_probs=4.0

Q ss_pred             ccCCCCCc
Q psy12019         63 YQCPQCPY   70 (87)
Q Consensus        63 ~~c~~c~~   70 (87)
                      |.|+.||.
T Consensus       343 f~C~~CG~  350 (383)
T PHA02942        343 FHCPSCGY  350 (383)
T ss_pred             EECCCCCC
Confidence            55555543


No 170
>PF13445 zf-RING_UBOX:  RING-type zinc-finger; PDB: 2CT2_A.
Probab=65.47  E-value=9  Score=15.42  Aligned_cols=28  Identities=14%  Similarity=0.196  Sum_probs=12.0

Q ss_pred             ccccchhhhccCCcceecCcccccccchhh
Q psy12019         19 CLINWSAVQQNHAGMFMCDVCGKGYKYKNG   48 (87)
Q Consensus        19 c~~c~~~~~~~~~~~~~c~~c~~~~~~~~~   48 (87)
                      |++|.. |......|..-. ||-.|.....
T Consensus         1 CpIc~e-~~~~~n~P~~L~-CGH~~c~~cl   28 (43)
T PF13445_consen    1 CPICKE-FSTEENPPMVLP-CGHVFCKDCL   28 (43)
T ss_dssp             -TTT-----TTSS-EEE-S-SS-EEEHHHH
T ss_pred             CCcccc-ccCCCCCCEEEe-CccHHHHHHH
Confidence            556666 655444455544 8877766654


No 171
>cd00029 C1 Protein kinase C conserved region 1 (C1) . Cysteine-rich zinc binding domain. Some members of this domain family bind phorbol esters and diacylglycerol, some are reported to bind RasGTP. May occur in tandem arrangement. Diacylglycerol (DAG) is a second messenger, released by activation of Phospholipase D. Phorbol Esters (PE) can act as analogues of DAG and mimic its downstream effects in, for example, tumor promotion. Protein Kinases C are activated by DAG/PE, this activation is mediated by their N-terminal conserved region (C1). DAG/PE binding may be phospholipid dependent. C1 domains may also mediate DAG/PE signals in chimaerins (a family of Rac GTPase activating proteins), RasGRPs (exchange factors for Ras/Rap1), and Munc13 isoforms (scaffolding proteins involved in exocytosis).
Probab=65.32  E-value=5.2  Score=16.00  Aligned_cols=26  Identities=12%  Similarity=0.185  Sum_probs=13.8

Q ss_pred             cccccccchhhhccCCcceecCcccc
Q psy12019         16 HNKCLINWSAVQQNHAGMFMCDVCGK   41 (87)
Q Consensus        16 ~~~c~~c~~~~~~~~~~~~~c~~c~~   41 (87)
                      +..|..|.+.+.......+.|..|+.
T Consensus        11 ~~~C~~C~~~i~~~~~~~~~C~~C~~   36 (50)
T cd00029          11 PTFCDVCRKSIWGLFKQGLRCSWCKV   36 (50)
T ss_pred             CCChhhcchhhhccccceeEcCCCCC
Confidence            44566666665543233455666643


No 172
>PF05129 Elf1:  Transcription elongation factor Elf1 like;  InterPro: IPR007808 This family of uncharacterised, mostly short, proteins contain a putative zinc binding domain with four conserved cysteines.; PDB: 1WII_A.
Probab=65.31  E-value=3.2  Score=19.25  Aligned_cols=31  Identities=23%  Similarity=0.513  Sum_probs=11.1

Q ss_pred             Ccccccccchhhhc-------cCCcceecCcccccccc
Q psy12019         15 KHNKCLINWSAVQQ-------NHAGMFMCDVCGKGYKY   45 (87)
Q Consensus        15 ~~~~c~~c~~~~~~-------~~~~~~~c~~c~~~~~~   45 (87)
                      +.|.|+.|+..-+-       .+.....|..||..|..
T Consensus        21 ~~F~CPfC~~~~sV~v~idkk~~~~~~~C~~Cg~~~~~   58 (81)
T PF05129_consen   21 KVFDCPFCNHEKSVSVKIDKKEGIGILSCRVCGESFQT   58 (81)
T ss_dssp             S----TTT--SS-EEEEEETTTTEEEEEESSS--EEEE
T ss_pred             ceEcCCcCCCCCeEEEEEEccCCEEEEEecCCCCeEEE
Confidence            45778877733211       12234567777765543


No 173
>KOG0317|consensus
Probab=65.01  E-value=6.2  Score=22.98  Aligned_cols=48  Identities=17%  Similarity=0.420  Sum_probs=31.0

Q ss_pred             CcccccccchhhhccCCcceecCcccccccchhhHHHHhhhhcCCCCCccCCCCCccccc
Q psy12019         15 KHNKCLINWSAVQQNHAGMFMCDVCGKGYKYKNGIYRHKKFECGQEPKYQCPQCPYRAKQ   74 (87)
Q Consensus        15 ~~~~c~~c~~~~~~~~~~~~~c~~c~~~~~~~~~~~~h~~~~~~~~~~~~c~~c~~~f~~   74 (87)
                      ..++|..|...-+.    | .|..||-.|.+.--+.     +.+++.  +|+.|...|..
T Consensus       238 a~~kC~LCLe~~~~----p-SaTpCGHiFCWsCI~~-----w~~ek~--eCPlCR~~~~p  285 (293)
T KOG0317|consen  238 ATRKCSLCLENRSN----P-SATPCGHIFCWSCILE-----WCSEKA--ECPLCREKFQP  285 (293)
T ss_pred             CCCceEEEecCCCC----C-CcCcCcchHHHHHHHH-----HHcccc--CCCcccccCCC
Confidence            34677777655332    2 6778999998876543     455555  79999765543


No 174
>smart00154 ZnF_AN1 AN1-like Zinc finger. Zinc finger at the C-terminus of An1, a ubiquitin-like protein in Xenopus laevis.
Probab=64.11  E-value=3.7  Score=16.16  Aligned_cols=11  Identities=18%  Similarity=0.594  Sum_probs=8.4

Q ss_pred             ccCCCCCcccc
Q psy12019         63 YQCPQCPYRAK   73 (87)
Q Consensus        63 ~~c~~c~~~f~   73 (87)
                      +.|..|++.|-
T Consensus        13 f~C~~C~~~FC   23 (39)
T smart00154       13 FKCRHCGNLFC   23 (39)
T ss_pred             eECCccCCccc
Confidence            78888887774


No 175
>PF14311 DUF4379:  Domain of unknown function (DUF4379)
Probab=64.03  E-value=8.4  Score=16.17  Aligned_cols=14  Identities=29%  Similarity=0.795  Sum_probs=8.9

Q ss_pred             ceecCcccccccch
Q psy12019         33 MFMCDVCGKGYKYK   46 (87)
Q Consensus        33 ~~~c~~c~~~~~~~   46 (87)
                      -|.|..||..+...
T Consensus        28 ~W~C~~Cgh~w~~~   41 (55)
T PF14311_consen   28 WWKCPKCGHEWKAS   41 (55)
T ss_pred             EEECCCCCCeeEcc
Confidence            46777777655443


No 176
>KOG2907|consensus
Probab=63.88  E-value=3  Score=20.68  Aligned_cols=40  Identities=28%  Similarity=0.639  Sum_probs=21.1

Q ss_pred             eecCcccccccchhhHHHHhh-hhcCCCCCccCCCCCcccccc
Q psy12019         34 FMCDVCGKGYKYKNGIYRHKK-FECGQEPKYQCPQCPYRAKQN   75 (87)
Q Consensus        34 ~~c~~c~~~~~~~~~~~~h~~-~~~~~~~~~~c~~c~~~f~~~   75 (87)
                      ..|+.||..--.=..+  .+| .-.|.-..|.|+.|++.|...
T Consensus        75 ~kCpkCghe~m~Y~T~--QlRSADEGQTVFYTC~kC~~k~~e~  115 (116)
T KOG2907|consen   75 HKCPKCGHEEMSYHTL--QLRSADEGQTVFYTCPKCKYKFTEN  115 (116)
T ss_pred             ccCcccCCchhhhhhh--hcccccCCceEEEEcCccceeeecc
Confidence            4688888532111111  122 222333348899998887643


No 177
>PF08646 Rep_fac-A_C:  Replication factor-A C terminal domain;  InterPro: IPR013955 Replication factor A (RP-A) binds and subsequently stabilises single-stranded DNA intermediates and thus prevents complementary DNA from reannealing. It also plays an essential role in several cellular processes in DNA metabolism including replication, recombination and repair of DNA []. Replication factor-A protein is also known as Replication protein A 70 kDa DNA-binding subunit.  This entry is found at the C terminus of Replication factor A.; PDB: 1L1O_F 3U50_C.
Probab=63.38  E-value=4.5  Score=20.68  Aligned_cols=26  Identities=27%  Similarity=0.542  Sum_probs=15.3

Q ss_pred             ccc--ccchhhhccCCcceecCcccccc
Q psy12019         18 KCL--INWSAVQQNHAGMFMCDVCGKGY   43 (87)
Q Consensus        18 ~c~--~c~~~~~~~~~~~~~c~~c~~~~   43 (87)
                      .|+  .|.+.....+...|.|..|++..
T Consensus        20 aC~~~~C~kKv~~~~~~~y~C~~C~~~~   47 (146)
T PF08646_consen   20 ACPNEKCNKKVTENGDGSYRCEKCNKTV   47 (146)
T ss_dssp             E-TSTTTS-B-EEETTTEEEETTTTEEE
T ss_pred             CCCCccCCCEeecCCCcEEECCCCCCcC
Confidence            477  77776655544567787777654


No 178
>PF00628 PHD:  PHD-finger;  InterPro: IPR019787 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents the PHD (homeodomain) zinc finger domain [,], which is a C4HC3 zinc-finger-like motif found in nuclear proteins thought to be involved in chromatin-mediated transcriptional regulation. The PHD finger motif is reminiscent of, but distinct from the C3HC4 type RING finger. The function of this domain is not yet known but in analogy with the LIM domain it could be involved in protein-protein interaction and be important for the assembly or activity of multicomponent complexes involved in transcriptional activation or repression. Alternatively, the interactions could be intra-molecular and be important in maintaining the structural integrity of the protein. In similarity to the RING finger and the LIM domain, the PHD finger is thought to bind two zinc ions. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0005515 protein binding; PDB: 3ZVY_A 2LGG_A 3SOW_A 3SOU_B 3ASL_A 3ASK_A 3ZVZ_B 3T6R_A 2LGK_A 3SOX_B ....
Probab=63.35  E-value=6.9  Score=15.89  Aligned_cols=12  Identities=42%  Similarity=1.054  Sum_probs=7.4

Q ss_pred             cceecCcccccc
Q psy12019         32 GMFMCDVCGKGY   43 (87)
Q Consensus        32 ~~~~c~~c~~~~   43 (87)
                      ....|+.|++.|
T Consensus        13 ~~i~C~~C~~~~   24 (51)
T PF00628_consen   13 DMIQCDSCNRWY   24 (51)
T ss_dssp             SEEEBSTTSCEE
T ss_pred             CeEEcCCCChhh
Confidence            345677777654


No 179
>PF03107 C1_2:  C1 domain;  InterPro: IPR004146 This short domain is rich in cysteines and histidines. The pattern of conservation is similar to that found in DAG_PE-bind (IPR002219 from INTERPRO), therefore we have termed this domain DC1 for divergent C1 domain. This domain probably also binds to two zinc ions. The function of proteins with this domain is uncertain, however this domain may bind to molecules such as diacylglycerol. This family are found in plant proteins.
Probab=62.76  E-value=5.4  Score=14.52  Aligned_cols=6  Identities=33%  Similarity=1.408  Sum_probs=2.4

Q ss_pred             eecCcc
Q psy12019         34 FMCDVC   39 (87)
Q Consensus        34 ~~c~~c   39 (87)
                      |.|..|
T Consensus        16 Y~C~~c   21 (30)
T PF03107_consen   16 YHCSEC   21 (30)
T ss_pred             EEeCCC
Confidence            344333


No 180
>KOG2231|consensus
Probab=61.72  E-value=9.8  Score=24.98  Aligned_cols=51  Identities=20%  Similarity=0.440  Sum_probs=31.8

Q ss_pred             ecCcccccccchhhHHHHhhhhcCCCCCccC---CCCCcccccchHHHhhhhhcCC
Q psy12019         35 MCDVCGKGYKYKNGIYRHKKFECGQEPKYQC---PQCPYRAKQNAHLTTHMAIKHY   87 (87)
Q Consensus        35 ~c~~c~~~~~~~~~~~~h~~~~~~~~~~~~c---~~c~~~f~~~~~l~~h~~~~h~   87 (87)
                      .|..|...|.....+..|++...-...  -|   ..++.-|.....|..|-+..||
T Consensus       184 ~C~~C~~~fld~~el~rH~~~~h~~ch--fC~~~~~~neyy~~~~dLe~HfR~~Hf  237 (669)
T KOG2231|consen  184 LCKFCHERFLDDDELYRHLRFDHEFCH--FCDYKTGQNEYYNDYDDLEEHFRKGHF  237 (669)
T ss_pred             cchhhhhhhccHHHHHHhhccceehee--ecCcccccchhcccchHHHHHhhhcCc
Confidence            577777777777777777775432221  11   1233456677777888777775


No 181
>KOG0402|consensus
Probab=61.69  E-value=4.1  Score=19.07  Aligned_cols=26  Identities=19%  Similarity=0.447  Sum_probs=11.5

Q ss_pred             ccccccchhhhcc-CCcceecCccccc
Q psy12019         17 NKCLINWSAVQQN-HAGMFMCDVCGKG   42 (87)
Q Consensus        17 ~~c~~c~~~~~~~-~~~~~~c~~c~~~   42 (87)
                      |.|+.|++.-... ...-|.|..|.+.
T Consensus        37 y~CsfCGK~~vKR~AvGiW~C~~C~kv   63 (92)
T KOG0402|consen   37 YTCSFCGKKTVKRKAVGIWKCGSCKKV   63 (92)
T ss_pred             hhhhhcchhhhhhhceeEEecCCccce
Confidence            4555555543221 2223455555443


No 182
>PF14634 zf-RING_5:  zinc-RING finger domain
Probab=61.28  E-value=11  Score=14.94  Aligned_cols=43  Identities=19%  Similarity=0.244  Sum_probs=19.7

Q ss_pred             ccccchhhhccCCcceecCcccccccchhhHHHHhhhhcCCCCCccCCCCCc
Q psy12019         19 CLINWSAVQQNHAGMFMCDVCGKGYKYKNGIYRHKKFECGQEPKYQCPQCPY   70 (87)
Q Consensus        19 c~~c~~~~~~~~~~~~~c~~c~~~~~~~~~~~~h~~~~~~~~~~~~c~~c~~   70 (87)
                      |++|...+  ....++.-..||-.|-..-...     .. ... ..|+.|++
T Consensus         2 C~~C~~~~--~~~~~~~l~~CgH~~C~~C~~~-----~~-~~~-~~CP~C~k   44 (44)
T PF14634_consen    2 CNICFEKY--SEERRPRLTSCGHIFCEKCLKK-----LK-GKS-VKCPICRK   44 (44)
T ss_pred             CcCcCccc--cCCCCeEEcccCCHHHHHHHHh-----hc-CCC-CCCcCCCC
Confidence            55666665  1122234445555554432211     11 244 67777753


No 183
>cd04476 RPA1_DBD_C RPA1_DBD_C: A subfamily of OB folds corresponding to the C-terminal OB fold, the ssDNA-binding domain (DBD)-C, of human RPA1 (also called RPA70). RPA1 is the large subunit of Replication protein A (RPA). RPA is a nuclear ssDNA-binding protein (SSB) which appears to be involved in all aspects of DNA metabolism including replication, recombination, and repair. RPA also mediates specific interactions of various nuclear proteins. In animals, plants, and fungi, RPA is a heterotrimer with subunits of 70KDa (RPA1), 32kDa (RPA2), and 14 KDa (RPA3). In addition to DBD-C, RPA1 contains three other OB folds: DBD-A, DBD-B, and RPA1N. The major DNA binding activity of RPA is associated with RPA1 DBD-A and DBD-B. RPA1 DBD-C is involved in DNA binding and trimerization. It contains two structural insertions not found to date in other OB-folds: a zinc ribbon and a three-helix bundle. RPA1 DBD-C also contains a Cys4-type zinc-binding motif, which plays a role in the ssDNA binding fun
Probab=60.77  E-value=6.1  Score=20.67  Aligned_cols=25  Identities=24%  Similarity=0.518  Sum_probs=12.1

Q ss_pred             cccccchhhhccCCcceecCccccc
Q psy12019         18 KCLINWSAVQQNHAGMFMCDVCGKG   42 (87)
Q Consensus        18 ~c~~c~~~~~~~~~~~~~c~~c~~~   42 (87)
                      .|+.|.+.........|.|..|++.
T Consensus        36 aC~~C~kkv~~~~~~~~~C~~C~~~   60 (166)
T cd04476          36 ACPGCNKKVVEEGNGTYRCEKCNKS   60 (166)
T ss_pred             cccccCcccEeCCCCcEECCCCCCc
Confidence            3555555544333234555555544


No 184
>TIGR00570 cdk7 CDK-activating kinase assembly factor MAT1. All proteins in this family for which functions are known are cyclin dependent protein kinases that are components of TFIIH, a complex that is involved in nucleotide excision repair and transcription initiation. Also known as MAT1 (menage a trois 1). This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=59.96  E-value=20  Score=21.26  Aligned_cols=52  Identities=15%  Similarity=0.244  Sum_probs=28.9

Q ss_pred             ccccccchhh-hccCCcceecCcccccccchhhHHHHhhhhcCCCCCccCCCCCcccccc
Q psy12019         17 NKCLINWSAV-QQNHAGMFMCDVCGKGYKYKNGIYRHKKFECGQEPKYQCPQCPYRAKQN   75 (87)
Q Consensus        17 ~~c~~c~~~~-~~~~~~~~~c~~c~~~~~~~~~~~~h~~~~~~~~~~~~c~~c~~~f~~~   75 (87)
                      +.|+.|...- .+...+.+.. .||-.|..+-.-..     ....+ ..|+.|+..+...
T Consensus         4 ~~CP~Ck~~~y~np~~kl~i~-~CGH~~C~sCv~~l-----~~~~~-~~CP~C~~~lrk~   56 (309)
T TIGR00570         4 QGCPRCKTTKYRNPSLKLMVN-VCGHTLCESCVDLL-----FVRGS-GSCPECDTPLRKN   56 (309)
T ss_pred             CCCCcCCCCCccCcccccccC-CCCCcccHHHHHHH-----hcCCC-CCCCCCCCccchh
Confidence            5788887642 2222233333 67877766543221     12233 6899998876544


No 185
>PRK00762 hypA hydrogenase nickel incorporation protein; Provisional
Probab=59.72  E-value=4.4  Score=20.37  Aligned_cols=13  Identities=23%  Similarity=0.399  Sum_probs=8.2

Q ss_pred             ceecCcccccccch
Q psy12019         33 MFMCDVCGKGYKYK   46 (87)
Q Consensus        33 ~~~c~~c~~~~~~~   46 (87)
                      .+.| .||..|...
T Consensus        70 ~~~C-~Cg~~~~~~   82 (124)
T PRK00762         70 EIEC-ECGYEGVVD   82 (124)
T ss_pred             eEEe-eCcCccccc
Confidence            3568 888666543


No 186
>PF10013 DUF2256:  Uncharacterized protein conserved in bacteria (DUF2256);  InterPro: IPR017136 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function.
Probab=59.55  E-value=6.4  Score=15.91  Aligned_cols=16  Identities=25%  Similarity=0.908  Sum_probs=11.0

Q ss_pred             ecCcccccccchhhHH
Q psy12019         35 MCDVCGKGYKYKNGIY   50 (87)
Q Consensus        35 ~c~~c~~~~~~~~~~~   50 (87)
                      .|..||+.|.......
T Consensus        10 ~C~~C~rpf~WRKKW~   25 (42)
T PF10013_consen   10 ICPVCGRPFTWRKKWA   25 (42)
T ss_pred             cCcccCCcchHHHHHH
Confidence            4778888887765544


No 187
>KOG2482|consensus
Probab=59.26  E-value=5.3  Score=23.95  Aligned_cols=22  Identities=23%  Similarity=0.434  Sum_probs=19.8

Q ss_pred             ccCCCCCcccccchHHHhhhhh
Q psy12019         63 YQCPQCPYRAKQNAHLTTHMAI   84 (87)
Q Consensus        63 ~~c~~c~~~f~~~~~l~~h~~~   84 (87)
                      .+|-.|.+.|+....|..||+-
T Consensus       196 ~~CLyCekifrdkntLkeHMrk  217 (423)
T KOG2482|consen  196 LRCLYCEKIFRDKNTLKEHMRK  217 (423)
T ss_pred             heeeeeccccCCcHHHHHHHHh
Confidence            6889999999999999999873


No 188
>COG1675 TFA1 Transcription initiation factor IIE, alpha subunit [Transcription]
Probab=59.16  E-value=9.7  Score=20.57  Aligned_cols=32  Identities=25%  Similarity=0.833  Sum_probs=19.1

Q ss_pred             CcceecCcccccccchhhHHHHhhhhcCCCCCccCCCCCccc
Q psy12019         31 AGMFMCDVCGKGYKYKNGIYRHKKFECGQEPKYQCPQCPYRA   72 (87)
Q Consensus        31 ~~~~~c~~c~~~~~~~~~~~~h~~~~~~~~~~~~c~~c~~~f   72 (87)
                      ..-|.|+.|...++...+.      ..+    |.|+.||...
T Consensus       111 ~~~y~C~~~~~r~sfdeA~------~~~----F~Cp~Cg~~L  142 (176)
T COG1675         111 NNYYVCPNCHVKYSFDEAM------ELG----FTCPKCGEDL  142 (176)
T ss_pred             CCceeCCCCCCcccHHHHH------HhC----CCCCCCCchh
Confidence            3457887776655544432      222    7888888644


No 189
>PF04423 Rad50_zn_hook:  Rad50 zinc hook motif;  InterPro: IPR007517 The Mre11 complex (Mre11 Rad50 Nbs1) is central to chromosomal maintenance and functions in homologous recombination, telomere maintenance and sister chromatid association. The Rad50 coiled-coil region contains a dimer interface at the apex of the coiled coils in which pairs of conserved Cys-X-X-Cys motifs form interlocking hooks that bind one Zn ion. This alignment includes the zinc hook motif and a short stretch of coiled-coil on either side.; GO: 0004518 nuclease activity, 0005524 ATP binding, 0008270 zinc ion binding, 0006281 DNA repair; PDB: 1L8D_B.
Probab=59.15  E-value=4.1  Score=17.09  Aligned_cols=11  Identities=27%  Similarity=0.706  Sum_probs=5.7

Q ss_pred             cCCCCCccccc
Q psy12019         64 QCPQCPYRAKQ   74 (87)
Q Consensus        64 ~c~~c~~~f~~   74 (87)
                      .|+.|++.|..
T Consensus        22 ~CPlC~r~l~~   32 (54)
T PF04423_consen   22 CCPLCGRPLDE   32 (54)
T ss_dssp             E-TTT--EE-H
T ss_pred             cCCCCCCCCCH
Confidence            88999988863


No 190
>KOG0717|consensus
Probab=58.82  E-value=5  Score=25.05  Aligned_cols=21  Identities=24%  Similarity=0.412  Sum_probs=16.6

Q ss_pred             ccCCCCCcccccchHHHhhhh
Q psy12019         63 YQCPQCPYRAKQNAHLTTHMA   83 (87)
Q Consensus        63 ~~c~~c~~~f~~~~~l~~h~~   83 (87)
                      +.|.+|.|.|.+.-.|..|..
T Consensus       293 lyC~vCnKsFKseKq~kNHEn  313 (508)
T KOG0717|consen  293 LYCVVCNKSFKSEKQLKNHEN  313 (508)
T ss_pred             eEEeeccccccchHHHHhhHH
Confidence            568888888888888887753


No 191
>TIGR00595 priA primosomal protein N'. All proteins in this family for which functions are known are components of the primosome which is involved in replication, repair, and recombination.This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=58.46  E-value=7.3  Score=24.49  Aligned_cols=8  Identities=50%  Similarity=1.153  Sum_probs=4.4

Q ss_pred             ccCCCCCc
Q psy12019         63 YQCPQCPY   70 (87)
Q Consensus        63 ~~c~~c~~   70 (87)
                      ..|+.|+.
T Consensus       254 ~~Cp~C~s  261 (505)
T TIGR00595       254 KTCPQCGS  261 (505)
T ss_pred             CCCCCCCC
Confidence            55555553


No 192
>KOG1729|consensus
Probab=58.33  E-value=0.94  Score=26.18  Aligned_cols=30  Identities=13%  Similarity=0.206  Sum_probs=18.6

Q ss_pred             cccccccchhhhccCCcceecCcccccccc
Q psy12019         16 HNKCLINWSAVQQNHAGMFMCDVCGKGYKY   45 (87)
Q Consensus        16 ~~~c~~c~~~~~~~~~~~~~c~~c~~~~~~   45 (87)
                      .-.|..|..+.-....+.+.|..||..|..
T Consensus       168 a~~C~~C~~~~Ftl~~RRHHCR~CG~ivC~  197 (288)
T KOG1729|consen  168 ATECMVCGCTEFTLSERRHHCRNCGDIVCA  197 (288)
T ss_pred             ceecccCCCccccHHHHHHHHHhcchHhhh
Confidence            356888888432323334568888877766


No 193
>PF09297 zf-NADH-PPase:  NADH pyrophosphatase zinc ribbon domain;  InterPro: IPR015376 This domain has a zinc ribbon structure and is often found between two NUDIX domains.; GO: 0016787 hydrolase activity, 0046872 metal ion binding; PDB: 1VK6_A 2GB5_A.
Probab=57.76  E-value=6.5  Score=14.50  Aligned_cols=8  Identities=38%  Similarity=0.929  Sum_probs=3.4

Q ss_pred             ceecCccc
Q psy12019         33 MFMCDVCG   40 (87)
Q Consensus        33 ~~~c~~c~   40 (87)
                      .-.|+.|+
T Consensus        21 ~r~C~~Cg   28 (32)
T PF09297_consen   21 ARRCPSCG   28 (32)
T ss_dssp             -EEESSSS
T ss_pred             EeECCCCc
Confidence            33455554


No 194
>PF10083 DUF2321:  Uncharacterized protein conserved in bacteria (DUF2321);  InterPro: IPR016891 This entry is represented by Bacteriophage 'Lactobacillus prophage Lj928', Orf-Ljo1454. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches. There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function.
Probab=57.67  E-value=7.2  Score=20.61  Aligned_cols=12  Identities=17%  Similarity=0.249  Sum_probs=6.4

Q ss_pred             ccCCCCCccccc
Q psy12019         63 YQCPQCPYRAKQ   74 (87)
Q Consensus        63 ~~c~~c~~~f~~   74 (87)
                      .-|..||+.|++
T Consensus        69 sYC~~CGkpyPW   80 (158)
T PF10083_consen   69 SYCHNCGKPYPW   80 (158)
T ss_pred             hhHHhCCCCCch
Confidence            445555555554


No 195
>PF01428 zf-AN1:  AN1-like Zinc finger;  InterPro: IPR000058 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents the AN1-type zinc finger domain, which has a dimetal (zinc)-bound alpha/beta fold. This domain was first identified as a zinc finger at the C terminus of AN1 Q91889 from SWISSPROT, a ubiquitin-like protein in Xenopus laevis []. The AN1-type zinc finger contains six conserved cysteines and two histidines that could potentially coordinate 2 zinc atoms. Certain stress-associated proteins (SAP) contain AN1 domain, often in combination with A20 zinc finger domains (SAP8) or C2H2 domains (SAP16) []. For example, the human protein Znf216 has an A20 zinc-finger at the N terminus and an AN1 zinc-finger at the C terminus, acting to negatively regulate the NFkappaB activation pathway and to interact with components of the immune response like RIP, IKKgamma and TRAF6. The interact of Znf216 with IKK-gamma and RIP is mediated by the A20 zinc-finger domain, while its interaction with TRAF6 is mediated by the AN1 zinc-finger domain; therefore, both zinc-finger domains are involved in regulating the immune response []. The AN1 zinc finger domain is also found in proteins containing a ubiquitin-like domain, which are involved in the ubiquitination pathway []. Proteins containing an AN1-type zinc finger include:   Ascidian posterior end mark 6 (pem-6) protein []. Human AWP1 protein (associated with PRK1), which is expressed during early embryogenesis []. Human immunoglobulin mu binding protein 2 (SMUBP-2), mutations in which cause muscular atrophy with respiratory distress type 1 [].   More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 1WFP_A 1WYS_A 1WG2_A 1WFH_A 1X4W_A 1WFE_A 1WFL_A 1X4V_A.
Probab=57.61  E-value=4.5  Score=16.13  Aligned_cols=15  Identities=40%  Similarity=0.800  Sum_probs=9.1

Q ss_pred             cceecCcccccccch
Q psy12019         32 GMFMCDVCGKGYKYK   46 (87)
Q Consensus        32 ~~~~c~~c~~~~~~~   46 (87)
                      .++.|..|++.|-..
T Consensus        12 ~~~~C~~C~~~FC~~   26 (43)
T PF01428_consen   12 LPFKCKHCGKSFCLK   26 (43)
T ss_dssp             SHEE-TTTS-EE-TT
T ss_pred             CCeECCCCCcccCcc
Confidence            478899998888554


No 196
>PF11672 DUF3268:  Protein of unknown function (DUF3268);  InterPro: IPR021686 This entry is represented by Listeria phage P100, Gp150. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches.
Probab=57.59  E-value=4.9  Score=19.61  Aligned_cols=9  Identities=11%  Similarity=-0.105  Sum_probs=4.0

Q ss_pred             cccccccch
Q psy12019         16 HNKCLINWS   24 (87)
Q Consensus        16 ~~~c~~c~~   24 (87)
                      |..|+.|+.
T Consensus         2 p~~CpYCg~   10 (102)
T PF11672_consen    2 PIICPYCGG   10 (102)
T ss_pred             CcccCCCCC
Confidence            344444443


No 197
>PLN02294 cytochrome c oxidase subunit Vb
Probab=57.55  E-value=6.2  Score=21.18  Aligned_cols=20  Identities=25%  Similarity=0.581  Sum_probs=14.1

Q ss_pred             HhhhhcCCCCCccCCCCCcccc
Q psy12019         52 HKKFECGQEPKYQCPQCPYRAK   73 (87)
Q Consensus        52 h~~~~~~~~~~~~c~~c~~~f~   73 (87)
                      ....+.| ++ ..|++||..|.
T Consensus       133 Wf~L~kG-kp-~RCpeCG~~fk  152 (174)
T PLN02294        133 WFWLEKG-KS-FECPVCTQYFE  152 (174)
T ss_pred             EEEecCC-Cc-eeCCCCCCEEE
Confidence            3344555 66 89999998875


No 198
>smart00064 FYVE Protein present in Fab1, YOTB, Vac1, and EEA1. The FYVE zinc finger is named after four proteins where it was first found: Fab1, YOTB/ZK632.12, Vac1, and EEA1. The FYVE finger has been shown to bind two Zn2+ ions. The FYVE finger has eight potential zinc coordinating cysteine positions. The FYVE finger is structurally related to the PF02176 zf-TRAF:  TRAF-type zinc finger; PDB: 2EOD_A 2YUC_A 3HCU_A 3HCS_B 3HCT_A.
Probab=57.34  E-value=9  Score=16.12  Aligned_cols=40  Identities=25%  Similarity=0.533  Sum_probs=18.8

Q ss_pred             ceecCc-ccccccchhhHHHHhhhhcCCCCCccCCC----CCcccc
Q psy12019         33 MFMCDV-CGKGYKYKNGIYRHKKFECGQEPKYQCPQ----CPYRAK   73 (87)
Q Consensus        33 ~~~c~~-c~~~~~~~~~~~~h~~~~~~~~~~~~c~~----c~~~f~   73 (87)
                      +..|+. |+..-.....|..|....-...+ ..|..    |+..+.
T Consensus         9 ~v~C~~~cc~~~i~r~~l~~H~~~~C~~~~-v~C~~~~~GC~~~~~   53 (60)
T PF02176_consen    9 PVPCPNGCCNEMIPRKELDDHLENECPKRP-VPCPYSPYGCKERVP   53 (60)
T ss_dssp             EEE-TT--S-BEEECCCHHHHHHTTSTTSE-EE-SS----S--EEE
T ss_pred             EeeCCCCCcccceeHHHHHHHHHccCCCCc-EECCCCCCCCCCccc
Confidence            446766 33332334557788774334344 67776    766654


No 200
>PF11023 DUF2614:  Protein of unknown function (DUF2614);  InterPro: IPR020912 This entry describes proteins of unknown function, which are thought to be membrane proteins.; GO: 0005887 integral to plasma membrane
Probab=56.80  E-value=7.7  Score=19.30  Aligned_cols=29  Identities=10%  Similarity=0.032  Sum_probs=16.6

Q ss_pred             CcccccccchhhhccCCcceecCccccccc
Q psy12019         15 KHNKCLINWSAVQQNHAGMFMCDVCGKGYK   44 (87)
Q Consensus        15 ~~~~c~~c~~~~~~~~~~~~~c~~c~~~~~   44 (87)
                      ...+|+.|++...-.+.. ..|..|+....
T Consensus        68 v~V~CP~C~K~TKmLGr~-D~CM~C~~pLT   96 (114)
T PF11023_consen   68 VQVECPNCGKQTKMLGRV-DACMHCKEPLT   96 (114)
T ss_pred             eeeECCCCCChHhhhchh-hccCcCCCcCc
Confidence            345677777766544333 36666665443


No 201
>PRK04023 DNA polymerase II large subunit; Validated
Probab=56.55  E-value=9.9  Score=26.32  Aligned_cols=22  Identities=23%  Similarity=0.353  Sum_probs=13.7

Q ss_pred             cccccccchhhhccCCcceecCccccc
Q psy12019         16 HNKCLINWSAVQQNHAGMFMCDVCGKG   42 (87)
Q Consensus        16 ~~~c~~c~~~~~~~~~~~~~c~~c~~~   42 (87)
                      ...|+.|+...     ..+.|+.||..
T Consensus       626 ~RfCpsCG~~t-----~~frCP~CG~~  647 (1121)
T PRK04023        626 RRKCPSCGKET-----FYRRCPFCGTH  647 (1121)
T ss_pred             CccCCCCCCcC-----CcccCCCCCCC
Confidence            45677777663     23567777754


No 202
>PF01286 XPA_N:  XPA protein N-terminal;  InterPro: IPR022652 Xeroderma pigmentosum (XP) [] is a human autosomal recessive disease, characterised by a high incidence of sunlight-induced skin cancer. Skin cells of individual's with this condition are hypersensitive to ultraviolet light, due to defects in the incision step of DNA excision repair. There are a minimum of seven genetic complementation groups involved in this pathway: XP-A to XP-G. XP-A is the most severe form of the disease and is due to defects in a 30 kDa nuclear protein called XPA (or XPAC) []. The sequence of the XPA protein is conserved from higher eukaryotes [] to yeast (gene RAD14) []. XPA is a hydrophilic protein of 247 to 296 amino-acid residues which has a C4-type zinc finger motif in its central section. This entry contains the zinc-finger containing region in the XPA protein. It is found N-terminal to PF05181 from PFAM ; PDB: 1D4U_A 1XPA_A.
Probab=55.84  E-value=5.9  Score=15.21  Aligned_cols=12  Identities=17%  Similarity=0.528  Sum_probs=4.9

Q ss_pred             cCCCCCcccccc
Q psy12019         64 QCPQCPYRAKQN   75 (87)
Q Consensus        64 ~c~~c~~~f~~~   75 (87)
                      .|.+|++.|..+
T Consensus         5 ~C~eC~~~f~dS   16 (34)
T PF01286_consen    5 KCDECGKPFMDS   16 (34)
T ss_dssp             E-TTT--EES-S
T ss_pred             hHhHhCCHHHHH
Confidence            566777766543


No 203
>CHL00174 accD acetyl-CoA carboxylase beta subunit; Reviewed
Probab=55.76  E-value=4.5  Score=23.66  Aligned_cols=11  Identities=36%  Similarity=0.906  Sum_probs=5.3

Q ss_pred             eecCccccccc
Q psy12019         34 FMCDVCGKGYK   44 (87)
Q Consensus        34 ~~c~~c~~~~~   44 (87)
                      +.|+.|+..|.
T Consensus        58 ~vcp~c~~h~r   68 (296)
T CHL00174         58 NICEQCGYHLK   68 (296)
T ss_pred             CCCCCCCCCcC
Confidence            45555554443


No 204
>TIGR00244 transcriptional regulator NrdR. Members of this almost entirely bacterial family contain an ATP cone domain (PFAM:PF03477). There is never more than one member per genome. Common gene symbols given include nrdR, ybaD, ribX and ytcG. The member from Streptomyces coelicolor is found upstream in the operon of the class II oxygen-independent ribonucleotide reductase gene nrdJ and was shown to repress nrdJ expression. Many members of this family are found near genes for riboflavin biosynthesis in Gram-negative bacteria, suggesting a role in that pathway. However, a phylogenetic profiling study associates members of this family with the presence of a palindromic signal with consensus acaCwAtATaTwGtgt, termed the NrdR-box, an upstream element for most operons for ribonucleotide reductase of all three classes in bacterial genomes.
Probab=55.45  E-value=6  Score=20.67  Aligned_cols=14  Identities=21%  Similarity=0.427  Sum_probs=11.1

Q ss_pred             ccCCCCCcccccch
Q psy12019         63 YQCPQCPYRAKQNA   76 (87)
Q Consensus        63 ~~c~~c~~~f~~~~   76 (87)
                      -+|..|++.|.+..
T Consensus        29 ReC~~C~~RFTTyE   42 (147)
T TIGR00244        29 RECLECHERFTTFE   42 (147)
T ss_pred             ccCCccCCccceee
Confidence            68899999987654


No 205
>PF10537 WAC_Acf1_DNA_bd:  ATP-utilising chromatin assembly and remodelling N-terminal;  InterPro: IPR013136 ACF (for ATP-utilising chromatin assembly and remodeling factor) is a chromatin-remodeling complex that catalyzes the ATP-dependent assembly of periodic nucleosome arrays. This reaction utilises the energy of ATP hydrolysis by ISWI, the smaller of the two subunits of ACF. Acf1, the large subunit of ACF, is essential for the full activity of the complex. The WAC (WSTF/Acf1/cbp146) domain is an ~110-residue module present at the N-termini of Acf1-related proteins in a variety of organisms. It is found in association with other domains such as the bromodomain, the PHD-type zinc finger, DDT or WAKS. The DNA-binding region of Acf1 includes the WAC domain, which is necessary for the efficient binding of ACF complex to DNA. It seems probable that the WAC domain will be involved in DNA binding in other related factors [, ].   Some proteins known to contain a WAC domain are the Drosophila melanogaster (Fruit fly) ATP-dependent chromatin assembly factor large subunit Acf1, human WSTF (Williams syndrome transcription factor), mouse cbp146, yeast imitation switch two complex protein 1 (ITC1 or YGL133w), and yeast protein YPL216w. 
Probab=55.43  E-value=21  Score=17.41  Aligned_cols=36  Identities=8%  Similarity=0.147  Sum_probs=17.9

Q ss_pred             ceecCcccccccchhhHHHHhhhhcCCCCCccCCCCCc
Q psy12019         33 MFMCDVCGKGYKYKNGIYRHKKFECGQEPKYQCPQCPY   70 (87)
Q Consensus        33 ~~~c~~c~~~~~~~~~~~~h~~~~~~~~~~~~c~~c~~   70 (87)
                      .|.|+..|..|.+=......+..... +. |.|...|+
T Consensus         3 Vf~i~~T~EiF~dYe~Y~~R~~~y~~-~v-wtC~~TGk   38 (102)
T PF10537_consen    3 VFYIPFTGEIFRDYEEYLKRMILYNQ-RV-WTCEITGK   38 (102)
T ss_pred             eEEeCCCCcccCCHHHHHHHHHHHhC-Ce-eEEecCCC
Confidence            35555555555555444444433332 33 66665554


No 206
>TIGR00515 accD acetyl-CoA carboxylase, carboxyl transferase, beta subunit. The enzyme acetyl-CoA carboxylase contains a biotin carboxyl carrier protein or domain, a biotin carboxylase, and a carboxyl transferase. This model represents the beta chain of the carboxyl transferase for cases in which the architecture of the protein is as in E. coli, in which the carboxyltransferase portion consists of two non-identical subnits, alpha and beta.
Probab=55.19  E-value=4.6  Score=23.46  Aligned_cols=28  Identities=14%  Similarity=0.342  Sum_probs=15.6

Q ss_pred             cccccchhhhcc--CCcceecCcccccccc
Q psy12019         18 KCLINWSAVQQN--HAGMFMCDVCGKGYKY   45 (87)
Q Consensus        18 ~c~~c~~~~~~~--~~~~~~c~~c~~~~~~   45 (87)
                      +|+.|+...-..  ....+.|+.||..|.-
T Consensus        28 ~c~~c~~~~~~~~l~~~~~vc~~c~~h~rl   57 (285)
T TIGR00515        28 KCPKCGQVLYTKELERNLEVCPKCDHHMRM   57 (285)
T ss_pred             ECCCCcchhhHHHHHhhCCCCCCCCCcCcC
Confidence            566666665432  2234567777766543


No 207
>PLN03208 E3 ubiquitin-protein ligase RMA2; Provisional
Probab=54.57  E-value=26  Score=19.31  Aligned_cols=53  Identities=19%  Similarity=0.350  Sum_probs=29.8

Q ss_pred             CcccccccchhhhccCCcceecCcccccccchhhHHHHhhh----------hcCCCCCccCCCCCcccc
Q psy12019         15 KHNKCLINWSAVQQNHAGMFMCDVCGKGYKYKNGIYRHKKF----------ECGQEPKYQCPQCPYRAK   73 (87)
Q Consensus        15 ~~~~c~~c~~~~~~~~~~~~~c~~c~~~~~~~~~~~~h~~~----------~~~~~~~~~c~~c~~~f~   73 (87)
                      ..+.|++|...+...     ....||-.|.+.-........          ...... ..|+.|...+.
T Consensus        17 ~~~~CpICld~~~dP-----VvT~CGH~FC~~CI~~wl~~s~~s~~~~~~~~~~k~~-~~CPvCR~~Is   79 (193)
T PLN03208         17 GDFDCNICLDQVRDP-----VVTLCGHLFCWPCIHKWTYASNNSRQRVDQYDHKREP-PKCPVCKSDVS   79 (193)
T ss_pred             CccCCccCCCcCCCc-----EEcCCCchhHHHHHHHHHHhccccccccccccccCCC-CcCCCCCCcCC
Confidence            468999998876543     223577766665543221100          011233 68999987654


No 208
>PF13824 zf-Mss51:  Zinc-finger of mitochondrial splicing suppressor 51
Probab=54.50  E-value=14  Score=15.89  Aligned_cols=9  Identities=44%  Similarity=0.988  Sum_probs=4.4

Q ss_pred             ceecCcccc
Q psy12019         33 MFMCDVCGK   41 (87)
Q Consensus        33 ~~~c~~c~~   41 (87)
                      .|+|+.||-
T Consensus        14 ~~~Cp~cGi   22 (55)
T PF13824_consen   14 NFECPDCGI   22 (55)
T ss_pred             CCcCCCCCC
Confidence            345555553


No 209
>PHA02998 RNA polymerase subunit; Provisional
Probab=54.28  E-value=1.9  Score=23.21  Aligned_cols=11  Identities=27%  Similarity=0.588  Sum_probs=8.3

Q ss_pred             ccCCCCCcccc
Q psy12019         63 YQCPQCPYRAK   73 (87)
Q Consensus        63 ~~c~~c~~~f~   73 (87)
                      |.|..||+.|.
T Consensus       172 YkC~~CG~~wk  182 (195)
T PHA02998        172 HACRDCKKHFK  182 (195)
T ss_pred             EEcCCCCCccC
Confidence            68888887765


No 210
>COG1594 RPB9 DNA-directed RNA polymerase, subunit M/Transcription elongation factor TFIIS [Transcription]
Probab=54.00  E-value=2.4  Score=21.01  Aligned_cols=11  Identities=45%  Similarity=1.328  Sum_probs=8.1

Q ss_pred             ccCCCCCcccc
Q psy12019         63 YQCPQCPYRAK   73 (87)
Q Consensus        63 ~~c~~c~~~f~   73 (87)
                      |.|..||..++
T Consensus       101 y~C~~Cg~~wr  111 (113)
T COG1594         101 YKCTRCGYRWR  111 (113)
T ss_pred             EEecccCCEee
Confidence            77888887664


No 211
>cd00924 Cyt_c_Oxidase_Vb Cytochrome c oxidase subunit Vb.  Cytochrome c oxidase (CcO), the terminal oxidase in the respiratory chains of eukaryotes and most bacteria, is a multi-chain transmembrane protein located in the inner membrane of mitochondria and the cell membrane of prokaryotes.  It catalyzes the reduction of O2 and simultaneously pumps protons across the membrane.  The number of subunits varies from three to five in bacteria and up to 13 in mammalian mitochondria. Subunits I, II, and III of mammalian CcO are encoded within the mitochondrial genome and the remaining 10 subunits are encoded within the nuclear genome.  Found only in eukaryotes, subunit Vb is one of three mammalian subunits that lacks a transmembrane region.  Subunit Vb is located on the matrix side of the membrane and binds the regulatory subunit of protein kinase A.  The abnormally extended conformation is stable only in the CcO assembly.
Probab=53.44  E-value=8.8  Score=18.56  Aligned_cols=15  Identities=27%  Similarity=0.561  Sum_probs=10.5

Q ss_pred             CCcceecCccccccc
Q psy12019         30 HAGMFMCDVCGKGYK   44 (87)
Q Consensus        30 ~~~~~~c~~c~~~~~   44 (87)
                      ...+..|.+||..|.
T Consensus        76 ~g~~~rC~eCG~~fk   90 (97)
T cd00924          76 KGKPKRCPECGHVFK   90 (97)
T ss_pred             CCCceeCCCCCcEEE
Confidence            335778888887764


No 212
>PF04780 DUF629:  Protein of unknown function (DUF629);  InterPro: IPR006865 This domain represents a region of several plant proteins of unknown function. A C2H2 zinc finger is predicted in this region in some family members, but the spacing between the cysteine residues is not conserved throughout the family.
Probab=53.02  E-value=9.6  Score=23.88  Aligned_cols=22  Identities=23%  Similarity=0.616  Sum_probs=14.5

Q ss_pred             ccCCCCCcccccchHHHhhhhh
Q psy12019         63 YQCPQCPYRAKQNAHLTTHMAI   84 (87)
Q Consensus        63 ~~c~~c~~~f~~~~~l~~h~~~   84 (87)
                      |.|+.|.+.|.....+..|+..
T Consensus        58 WiCp~CskkF~d~~~~~~H~~~   79 (466)
T PF04780_consen   58 WICPRCSKKFSDAESCLSHMEQ   79 (466)
T ss_pred             eeCCcccceeCCHHHHHHHHHH
Confidence            6666676667766666666543


No 213
>TIGR03830 CxxCG_CxxCG_HTH putative zinc finger/helix-turn-helix protein, YgiT family. This model describes a family of predicted regulatory proteins with a conserved zinc finger/HTH architecture. The amino-terminal region contains a novel domain, featuring two CXXC motifs and occuring in a number of small bacterial proteins as well as in the present family. The carboxyl-terminal region consists of a helix-turn-helix domain, modeled by pfam01381. The predicted function is DNA binding and transcriptional regulation.
Probab=52.57  E-value=18  Score=17.79  Aligned_cols=17  Identities=18%  Similarity=0.434  Sum_probs=11.0

Q ss_pred             ceecCcccccccchhhH
Q psy12019         33 MFMCDVCGKGYKYKNGI   49 (87)
Q Consensus        33 ~~~c~~c~~~~~~~~~~   49 (87)
                      .+.|+.||..+......
T Consensus        31 ~~~C~~CGe~~~~~e~~   47 (127)
T TIGR03830        31 GWYCPACGEELLDPEES   47 (127)
T ss_pred             eeECCCCCCEEEcHHHH
Confidence            46788888766655443


No 214
>TIGR00627 tfb4 transcription factor tfb4. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=52.49  E-value=8.2  Score=22.41  Aligned_cols=25  Identities=24%  Similarity=0.392  Sum_probs=15.8

Q ss_pred             ceecCcccccccchhhHHHHhhhhcCCCCCccCCCCCccc
Q psy12019         33 MFMCDVCGKGYKYKNGIYRHKKFECGQEPKYQCPQCPYRA   72 (87)
Q Consensus        33 ~~~c~~c~~~~~~~~~~~~h~~~~~~~~~~~~c~~c~~~f   72 (87)
                      .|.|+.|.-.|..              -| -+|+.||-.|
T Consensus       255 GyvCs~Clsi~C~--------------~p-~~C~~Cgt~f  279 (279)
T TIGR00627       255 GFVCSVCLSVLCQ--------------YT-PICKTCKTAF  279 (279)
T ss_pred             eEECCCccCCcCC--------------CC-CCCCCCCCCC
Confidence            4888888655432              23 4778887554


No 215
>PF12773 DZR:  Double zinc ribbon
Probab=52.16  E-value=8.3  Score=15.66  Aligned_cols=10  Identities=30%  Similarity=0.786  Sum_probs=5.8

Q ss_pred             ccCCCCCccc
Q psy12019         63 YQCPQCPYRA   72 (87)
Q Consensus        63 ~~c~~c~~~f   72 (87)
                      ..|+.|+...
T Consensus        30 ~~C~~Cg~~~   39 (50)
T PF12773_consen   30 KICPNCGAEN   39 (50)
T ss_pred             CCCcCCcCCC
Confidence            5566666543


No 216
>PF02891 zf-MIZ:  MIZ/SP-RING zinc finger;  InterPro: IPR004181 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents MIZ-type zinc finger domains. Miz1 (Msx-interacting-zinc finger) is a zinc finger-containing protein with homology to the yeast protein, Nfi-1. Miz1 is a sequence specific DNA binding protein that can function as a positive-acting transcription factor. Miz1 binds to the homeobox protein Msx2, enhancing the specific DNA-binding ability of Msx2 []. Other proteins containing this domain include the human pias family (protein inhibitor of activated STAT protein). More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 3I2D_A.
Probab=51.87  E-value=10  Score=15.78  Aligned_cols=23  Identities=13%  Similarity=0.519  Sum_probs=9.1

Q ss_pred             ccchhhHHHHhhhhcCCCCCccCCCCCc
Q psy12019         43 YKYKNGIYRHKKFECGQEPKYQCPQCPY   70 (87)
Q Consensus        43 ~~~~~~~~~h~~~~~~~~~~~~c~~c~~   70 (87)
                      |...+.+....+.    .. |.|++|++
T Consensus        27 FDl~~fl~~~~~~----~~-W~CPiC~~   49 (50)
T PF02891_consen   27 FDLESFLESNQRT----PK-WKCPICNK   49 (50)
T ss_dssp             EEHHHHHHHHHHS--------B-TTT--
T ss_pred             ECHHHHHHHhhcc----CC-eECcCCcC
Confidence            5444444433332    33 89999875


No 217
>PF15616 TerY-C:  TerY-C metal binding domain
Probab=51.83  E-value=12  Score=19.21  Aligned_cols=9  Identities=33%  Similarity=0.896  Sum_probs=5.4

Q ss_pred             ccCCCCCcc
Q psy12019         63 YQCPQCPYR   71 (87)
Q Consensus        63 ~~c~~c~~~   71 (87)
                      ..|+.|++.
T Consensus       106 ~~CPwCg~~  114 (131)
T PF15616_consen  106 VTCPWCGNE  114 (131)
T ss_pred             EECCCCCCe
Confidence            566666654


No 218
>PRK05654 acetyl-CoA carboxylase subunit beta; Validated
Probab=51.64  E-value=5.4  Score=23.26  Aligned_cols=28  Identities=21%  Similarity=0.479  Sum_probs=15.9

Q ss_pred             cccccchhhhcc--CCcceecCcccccccc
Q psy12019         18 KCLINWSAVQQN--HAGMFMCDVCGKGYKY   45 (87)
Q Consensus        18 ~c~~c~~~~~~~--~~~~~~c~~c~~~~~~   45 (87)
                      +|+.|+...-..  ....+.|+.|+..|.-
T Consensus        29 ~c~~c~~~~~~~~l~~~~~vc~~c~~h~rl   58 (292)
T PRK05654         29 KCPSCGQVLYRKELEANLNVCPKCGHHMRI   58 (292)
T ss_pred             ECCCccchhhHHHHHhcCCCCCCCCCCeeC
Confidence            567776665433  2234567777766543


No 219
>PF07191 zinc-ribbons_6:  zinc-ribbons;  InterPro: IPR010807 This family consists of several short, hypothetical bacterial proteins of around 70 residues in length. Members of this family 8 highly conserved cysteine residues. The function of the family is unknown.; PDB: 2JRP_A 2JNE_A.
Probab=51.34  E-value=8  Score=17.54  Aligned_cols=24  Identities=25%  Similarity=0.665  Sum_probs=8.7

Q ss_pred             ccccchhhhccCCcceecCcccccc
Q psy12019         19 CLINWSAVQQNHAGMFMCDVCGKGY   43 (87)
Q Consensus        19 c~~c~~~~~~~~~~~~~c~~c~~~~   43 (87)
                      |+.|.......+ ..|.|..|++.|
T Consensus         4 CP~C~~~L~~~~-~~~~C~~C~~~~   27 (70)
T PF07191_consen    4 CPKCQQELEWQG-GHYHCEACQKDY   27 (70)
T ss_dssp             -SSS-SBEEEET-TEEEETTT--EE
T ss_pred             CCCCCCccEEeC-CEEECccccccc
Confidence            445554433322 334555555443


No 220
>PF07503 zf-HYPF:  HypF finger;  InterPro: IPR011125 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  Proteins of the HypF family are involved in the maturation and regulation of hydrogenase []. In the N terminus they appear to have two zinc finger domains that are similar to those found in the DnaJ chaperone []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 3TTD_A 3TSQ_A 3TTC_A 3TSP_A 3TTF_A 3TSU_A.
Probab=51.06  E-value=5.8  Score=15.29  Aligned_cols=10  Identities=30%  Similarity=0.703  Sum_probs=3.8

Q ss_pred             ccCCCCCccc
Q psy12019         63 YQCPQCPYRA   72 (87)
Q Consensus        63 ~~c~~c~~~f   72 (87)
                      ..|..||-.+
T Consensus        22 isC~~CGPr~   31 (35)
T PF07503_consen   22 ISCTNCGPRY   31 (35)
T ss_dssp             --BTTCC-SC
T ss_pred             ccCCCCCCCE
Confidence            4555565443


No 221
>PRK07591 threonine synthase; Validated
Probab=51.06  E-value=8.4  Score=23.60  Aligned_cols=27  Identities=15%  Similarity=0.165  Sum_probs=19.8

Q ss_pred             cccccccchhhhccCCcceecCccccccc
Q psy12019         16 HNKCLINWSAVQQNHAGMFMCDVCGKGYK   44 (87)
Q Consensus        16 ~~~c~~c~~~~~~~~~~~~~c~~c~~~~~   44 (87)
                      -+.|..|++.+... .. +.|+.||..+.
T Consensus        18 ~l~C~~Cg~~~~~~-~~-~~C~~cg~~l~   44 (421)
T PRK07591         18 ALKCRECGAEYPLG-PI-HVCEECFGPLE   44 (421)
T ss_pred             EEEeCCCCCcCCCC-CC-ccCCCCCCeEE
Confidence            47899999998764 33 88998975443


No 222
>KOG1813|consensus
Probab=50.86  E-value=5.8  Score=23.24  Aligned_cols=16  Identities=19%  Similarity=0.119  Sum_probs=12.2

Q ss_pred             CCcccccccchhhhcc
Q psy12019         14 PKHNKCLINWSAVQQN   29 (87)
Q Consensus        14 ~~~~~c~~c~~~~~~~   29 (87)
                      .-||.|.+|.+.|...
T Consensus       239 ~~Pf~c~icr~~f~~p  254 (313)
T KOG1813|consen  239 LLPFKCFICRKYFYRP  254 (313)
T ss_pred             cCCccccccccccccc
Confidence            3578888888888765


No 223
>PF15269 zf-C2H2_7:  Zinc-finger
Probab=50.45  E-value=11  Score=15.44  Aligned_cols=21  Identities=43%  Similarity=1.059  Sum_probs=10.6

Q ss_pred             ccCCCCCcccccchHHHhhhh
Q psy12019         63 YQCPQCPYRAKQNAHLTTHMA   83 (87)
Q Consensus        63 ~~c~~c~~~f~~~~~l~~h~~   83 (87)
                      |+|-.|.-+..-.+.|-.|++
T Consensus        21 ykcfqcpftc~~kshl~nhmk   41 (54)
T PF15269_consen   21 YKCFQCPFTCNEKSHLFNHMK   41 (54)
T ss_pred             ceeecCCcccchHHHHHHHHH
Confidence            344445544455555555554


No 224
>COG1998 RPS31 Ribosomal protein S27AE [Translation, ribosomal structure and biogenesis]
Probab=50.24  E-value=13  Score=15.64  Aligned_cols=9  Identities=33%  Similarity=1.213  Sum_probs=6.2

Q ss_pred             ccCCCCCcc
Q psy12019         63 YQCPQCPYR   71 (87)
Q Consensus        63 ~~c~~c~~~   71 (87)
                      +.|..||++
T Consensus        38 ~~CGkCgyT   46 (51)
T COG1998          38 WACGKCGYT   46 (51)
T ss_pred             eEeccccce
Confidence            677777764


No 225
>COG3677 Transposase and inactivated derivatives [DNA replication, recombination, and repair]
Probab=50.09  E-value=11  Score=19.21  Aligned_cols=14  Identities=21%  Similarity=0.667  Sum_probs=11.1

Q ss_pred             CCCCccCCCCCcccc
Q psy12019         59 QEPKYQCPQCPYRAK   73 (87)
Q Consensus        59 ~~~~~~c~~c~~~f~   73 (87)
                      ... |.|..|++.|.
T Consensus        51 ~qR-yrC~~C~~tf~   64 (129)
T COG3677          51 HQR-YKCKSCGSTFT   64 (129)
T ss_pred             ccc-cccCCcCccee
Confidence            344 99999999885


No 226
>PF02591 DUF164:  Putative zinc ribbon domain;  InterPro: IPR003743 This entry describes proteins of unknown function.
Probab=49.44  E-value=19  Score=15.16  Aligned_cols=32  Identities=22%  Similarity=0.393  Sum_probs=18.0

Q ss_pred             ecCcccccccchhhHHHHhhhhcCCCCCccCCCCCcc
Q psy12019         35 MCDVCGKGYKYKNGIYRHKKFECGQEPKYQCPQCPYR   71 (87)
Q Consensus        35 ~c~~c~~~~~~~~~~~~h~~~~~~~~~~~~c~~c~~~   71 (87)
                      .|..|+...+.....    ....++.. ..|+.||+.
T Consensus        24 ~C~gC~~~l~~~~~~----~i~~~~~i-~~Cp~CgRi   55 (56)
T PF02591_consen   24 TCSGCHMELPPQELN----EIRKGDEI-VFCPNCGRI   55 (56)
T ss_pred             ccCCCCEEcCHHHHH----HHHcCCCe-EECcCCCcc
Confidence            567776555443321    22334455 788888864


No 227
>PRK05452 anaerobic nitric oxide reductase flavorubredoxin; Provisional
Probab=49.43  E-value=10  Score=23.75  Aligned_cols=14  Identities=29%  Similarity=0.487  Sum_probs=8.0

Q ss_pred             cceecCcccccccc
Q psy12019         32 GMFMCDVCGKGYKY   45 (87)
Q Consensus        32 ~~~~c~~c~~~~~~   45 (87)
                      ..|+|..||..+..
T Consensus       424 ~~~~c~~c~~~yd~  437 (479)
T PRK05452        424 PRMQCSVCQWIYDP  437 (479)
T ss_pred             CeEEECCCCeEECC
Confidence            35666666655543


No 228
>PF14787 zf-CCHC_5:  GAG-polyprotein viral zinc-finger; PDB: 1CL4_A 1DSV_A.
Probab=48.86  E-value=10  Score=14.80  Aligned_cols=15  Identities=20%  Similarity=0.414  Sum_probs=8.5

Q ss_pred             ccCCCCCcccccchH
Q psy12019         63 YQCPQCPYRAKQNAH   77 (87)
Q Consensus        63 ~~c~~c~~~f~~~~~   77 (87)
                      -.|+.|++.|-..+.
T Consensus         3 ~~CprC~kg~Hwa~~   17 (36)
T PF14787_consen    3 GLCPRCGKGFHWASE   17 (36)
T ss_dssp             -C-TTTSSSCS-TTT
T ss_pred             ccCcccCCCcchhhh
Confidence            468888888755443


No 229
>PF07295 DUF1451:  Protein of unknown function (DUF1451);  InterPro: IPR009912 This family consists of several hypothetical bacterial proteins of around 160 residues in length. Members of this family contain four highly conserved cysteine resides toward the C-terminal region of the protein. The function of this family is unknown.
Probab=48.58  E-value=5.1  Score=20.85  Aligned_cols=31  Identities=23%  Similarity=0.606  Sum_probs=17.6

Q ss_pred             CCcceecCcccccccchhhHHHHhhhhcCCCCCccCCCCCcc
Q psy12019         30 HAGMFMCDVCGKGYKYKNGIYRHKKFECGQEPKYQCPQCPYR   71 (87)
Q Consensus        30 ~~~~~~c~~c~~~~~~~~~~~~h~~~~~~~~~~~~c~~c~~~   71 (87)
                      +.+.+.|..||.....         .+++.-  -.|+.|+..
T Consensus       109 g~G~l~C~~Cg~~~~~---------~~~~~l--~~Cp~C~~~  139 (146)
T PF07295_consen  109 GPGTLVCENCGHEVEL---------THPERL--PPCPKCGHT  139 (146)
T ss_pred             cCceEecccCCCEEEe---------cCCCcC--CCCCCCCCC
Confidence            4456888888864311         123323  477888753


No 230
>COG5112 UFD2 U1-like Zn-finger-containing protein [General function prediction only]
Probab=48.23  E-value=9.7  Score=18.77  Aligned_cols=26  Identities=23%  Similarity=0.424  Sum_probs=21.5

Q ss_pred             CCcceecCcccccccchhhHHHHhhh
Q psy12019         30 HAGMFMCDVCGKGYKYKNGIYRHKKF   55 (87)
Q Consensus        30 ~~~~~~c~~c~~~~~~~~~~~~h~~~   55 (87)
                      +...+-|.+|.+-|....+|..|.+.
T Consensus        52 GlGqhYCieCaryf~t~~aL~~Hkkg   77 (126)
T COG5112          52 GLGQHYCIECARYFITEKALMEHKKG   77 (126)
T ss_pred             CCceeeeehhHHHHHHHHHHHHHhcc
Confidence            44567899999999999999888764


No 231
>smart00249 PHD PHD zinc finger. The plant homeodomain (PHD) finger is a C4HC3 zinc-finger-like motif found in nuclear proteins thought to be involved in epigenetics and chromatin-mediated transcriptional regulation. The PHD finger binds two zinc ions using the so-called 'cross-brace' motif and is thus structurally related to the PF11931 DUF3449:  Domain of unknown function (DUF3449);  InterPro: IPR024598 This presumed domain is functionally uncharacterised. It has two conserved sequence motifs: PIP and CEICG and contains a zinc-finger of the C2H2-type.; PDB: 4DGW_A.
Probab=47.10  E-value=6.3  Score=21.63  Aligned_cols=26  Identities=19%  Similarity=0.336  Sum_probs=0.0

Q ss_pred             hhcCCCCCccCCCCC-cccccchHHHhh
Q psy12019         55 FECGQEPKYQCPQCP-YRAKQNAHLTTH   81 (87)
Q Consensus        55 ~~~~~~~~~~c~~c~-~~f~~~~~l~~h   81 (87)
                      .|-.... |.|.+|| ..|.....+.+|
T Consensus        95 LhGL~~e-y~CEICGN~~Y~GrkaFekH  121 (196)
T PF11931_consen   95 LHGLGVE-YKCEICGNQSYKGRKAFEKH  121 (196)
T ss_dssp             ----------------------------
T ss_pred             HhCCCCe-eeeEeCCCcceecHHHHHHh
Confidence            3444455 8888886 344344444444


No 233
>PF04606 Ogr_Delta:  Ogr/Delta-like zinc finger;  InterPro: IPR007684 This entry is represented by Bacteriophage P2, Ogr. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches. This is a viral family of phage zinc-binding transcriptional activators, which also contains cryptic members in some bacterial genomes []. The P4 phage delta protein contains two such domains attached covalently, while the P2 phage Ogr proteins possess one domain but function as dimers. All the members of this family have the following consensus sequence: C-X(2)-C-X(3)-A-(X)2-R-X(15)-C-X(4)-C-X(3)-F [].; GO: 0006355 regulation of transcription, DNA-dependent
Probab=46.79  E-value=4.1  Score=16.65  Aligned_cols=13  Identities=31%  Similarity=0.580  Sum_probs=7.5

Q ss_pred             ccCC--CCCcccccc
Q psy12019         63 YQCP--QCPYRAKQN   75 (87)
Q Consensus        63 ~~c~--~c~~~f~~~   75 (87)
                      ++|.  +||..|...
T Consensus        26 ~qC~N~~Cg~tfv~~   40 (47)
T PF04606_consen   26 CQCTNPECGHTFVAN   40 (47)
T ss_pred             EEECCCcCCCEEEEE
Confidence            5564  377776543


No 234
>COG4338 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=46.77  E-value=7.6  Score=16.18  Aligned_cols=16  Identities=19%  Similarity=0.750  Sum_probs=10.7

Q ss_pred             ecCcccccccchhhHH
Q psy12019         35 MCDVCGKGYKYKNGIY   50 (87)
Q Consensus        35 ~c~~c~~~~~~~~~~~   50 (87)
                      .|+.|++.|.+.....
T Consensus        14 ICpvCqRPFsWRkKW~   29 (54)
T COG4338          14 ICPVCQRPFSWRKKWA   29 (54)
T ss_pred             hhhhhcCchHHHHHHH
Confidence            4777887777665544


No 235
>smart00109 C1 Protein kinase C conserved region 1 (C1) domains (Cysteine-rich domains). Some bind phorbol esters and diacylglycerol. Some bind RasGTP. Zinc-binding domains.
Probab=46.61  E-value=18  Score=14.13  Aligned_cols=24  Identities=17%  Similarity=0.408  Sum_probs=10.9

Q ss_pred             cccccccchhhhccCCcceecCccc
Q psy12019         16 HNKCLINWSAVQQNHAGMFMCDVCG   40 (87)
Q Consensus        16 ~~~c~~c~~~~~~~~~~~~~c~~c~   40 (87)
                      +..|..|.+.+.... ..+.|..|+
T Consensus        11 ~~~C~~C~~~i~~~~-~~~~C~~C~   34 (49)
T smart00109       11 PTKCCVCRKSIWGSF-QGLRCSWCK   34 (49)
T ss_pred             CCCccccccccCcCC-CCcCCCCCC
Confidence            444555555544322 234455553


No 236
>smart00132 LIM Zinc-binding domain present in Lin-11, Isl-1, Mec-3. Zinc-binding domain family. Some LIM domains bind protein partners via tyrosine-containing motifs. LIM domains are found in many key regulators of developmental pathways.
Probab=46.53  E-value=3.8  Score=15.22  Aligned_cols=10  Identities=20%  Similarity=0.856  Sum_probs=5.5

Q ss_pred             ccCCCCCccc
Q psy12019         63 YQCPQCPYRA   72 (87)
Q Consensus        63 ~~c~~c~~~f   72 (87)
                      |.|..|+..+
T Consensus        28 f~C~~C~~~L   37 (39)
T smart00132       28 FKCSKCGKPL   37 (39)
T ss_pred             CCCcccCCcC
Confidence            5566665544


No 237
>KOG3362|consensus
Probab=46.00  E-value=6.8  Score=20.41  Aligned_cols=19  Identities=32%  Similarity=0.576  Sum_probs=8.1

Q ss_pred             ccCCCCCcccccchHHHhh
Q psy12019         63 YQCPQCPYRAKQNAHLTTH   81 (87)
Q Consensus        63 ~~c~~c~~~f~~~~~l~~h   81 (87)
                      |.|..||-.+-...-+..|
T Consensus       130 ysC~~CG~kyCsv~C~~~H  148 (156)
T KOG3362|consen  130 YSCVNCGTKYCSVRCLKTH  148 (156)
T ss_pred             hHHHhcCCceeechhhhhc
Confidence            4444444444433334333


No 238
>COG1327 Predicted transcriptional regulator, consists of a Zn-ribbon and ATP-cone domains [Transcription]
Probab=45.94  E-value=9.7  Score=20.06  Aligned_cols=13  Identities=23%  Similarity=0.447  Sum_probs=10.4

Q ss_pred             ccCCCCCcccccc
Q psy12019         63 YQCPQCPYRAKQN   75 (87)
Q Consensus        63 ~~c~~c~~~f~~~   75 (87)
                      -+|..|+..|.+.
T Consensus        29 ReC~~C~~RFTTf   41 (156)
T COG1327          29 RECLECGERFTTF   41 (156)
T ss_pred             hcccccccccchh
Confidence            6888899888754


No 239
>PRK06450 threonine synthase; Validated
Probab=45.68  E-value=11  Score=22.44  Aligned_cols=25  Identities=16%  Similarity=0.387  Sum_probs=17.0

Q ss_pred             ccccccchhhhccCCcceecCcccccc
Q psy12019         17 NKCLINWSAVQQNHAGMFMCDVCGKGY   43 (87)
Q Consensus        17 ~~c~~c~~~~~~~~~~~~~c~~c~~~~   43 (87)
                      +.|..|++.+..  ...+.|+.||..+
T Consensus         4 ~~C~~Cg~~~~~--~~~~~C~~cg~~l   28 (338)
T PRK06450          4 EVCMKCGKERES--IYEIRCKKCGGPF   28 (338)
T ss_pred             eEECCcCCcCCC--cccccCCcCCCEe
Confidence            678888888754  2346788887543


No 240
>COG0675 Transposase and inactivated derivatives [DNA replication, recombination, and repair]
Probab=45.55  E-value=25  Score=20.35  Aligned_cols=24  Identities=21%  Similarity=0.330  Sum_probs=15.2

Q ss_pred             cccccchhhhccCCcceecCcccccccc
Q psy12019         18 KCLINWSAVQQNHAGMFMCDVCGKGYKY   45 (87)
Q Consensus        18 ~c~~c~~~~~~~~~~~~~c~~c~~~~~~   45 (87)
                      .|+.|+.    ...+.|.|+.||..+..
T Consensus       311 ~C~~cg~----~~~r~~~C~~cg~~~~r  334 (364)
T COG0675         311 TCPCCGH----LSGRLFKCPRCGFVHDR  334 (364)
T ss_pred             cccccCC----ccceeEECCCCCCeehh
Confidence            4777776    23456778888865443


No 241
>PF07800 DUF1644:  Protein of unknown function (DUF1644);  InterPro: IPR012866 This family consists of sequences found in a number of hypothetical plant proteins of unknown function. The region of interest contains nine highly conserved cysteine residues and is approximately 160 amino acids in length, which probably represent a zinc-binding domain. 
Probab=45.09  E-value=39  Score=18.10  Aligned_cols=52  Identities=15%  Similarity=0.181  Sum_probs=32.3

Q ss_pred             ceecCcccccccchhhHHHHhhhhcCCCCCccCCCCCcccc-cchHHHhhhhhcC
Q psy12019         33 MFMCDVCGKGYKYKNGIYRHKKFECGQEPKYQCPQCPYRAK-QNAHLTTHMAIKH   86 (87)
Q Consensus        33 ~~~c~~c~~~~~~~~~~~~h~~~~~~~~~~~~c~~c~~~f~-~~~~l~~h~~~~h   86 (87)
                      ...|+.|.-....+..... .|.+...++ -.|..=+-.|. ....|..|.+.-|
T Consensus        80 ~L~CPLCRG~V~GWtvve~-AR~~LN~K~-RsC~~e~C~F~GtY~eLrKHar~~H  132 (162)
T PF07800_consen   80 ELACPLCRGEVKGWTVVEP-ARRFLNAKK-RSCSQESCSFSGTYSELRKHARSEH  132 (162)
T ss_pred             cccCccccCceeceEEchH-HHHHhccCC-ccCcccccccccCHHHHHHHHHhhC
Confidence            3578888866666655444 444455566 66754333443 5678999988665


No 242
>KOG1842|consensus
Probab=45.04  E-value=11  Score=23.60  Aligned_cols=21  Identities=19%  Similarity=0.502  Sum_probs=10.4

Q ss_pred             eecCcccccccchhhHHHHhh
Q psy12019         34 FMCDVCGKGYKYKNGIYRHKK   54 (87)
Q Consensus        34 ~~c~~c~~~~~~~~~~~~h~~   54 (87)
                      |.|+.|...|..-..|..|..
T Consensus        16 flCPiC~~dl~~~~~L~~H~d   36 (505)
T KOG1842|consen   16 FLCPICLLDLPNLSALNDHLD   36 (505)
T ss_pred             ccCchHhhhhhhHHHHHHHHh
Confidence            445555555555555544433


No 243
>PRK04351 hypothetical protein; Provisional
Probab=44.96  E-value=14  Score=19.35  Aligned_cols=34  Identities=26%  Similarity=0.750  Sum_probs=21.8

Q ss_pred             cceecCcccccccchhhHHHHhhhhcCCCCCccCCCCCccccc
Q psy12019         32 GMFMCDVCGKGYKYKNGIYRHKKFECGQEPKYQCPQCPYRAKQ   74 (87)
Q Consensus        32 ~~~~c~~c~~~~~~~~~~~~h~~~~~~~~~~~~c~~c~~~f~~   74 (87)
                      -.|.|..||..+...      .+.  .... |.|..|+-.+..
T Consensus       111 y~Y~C~~Cg~~~~r~------Rr~--n~~~-yrCg~C~g~L~~  144 (149)
T PRK04351        111 YLYECQSCGQQYLRK------RRI--NTKR-YRCGKCRGKLKL  144 (149)
T ss_pred             EEEECCCCCCEeeee------eec--CCCc-EEeCCCCcEeee
Confidence            368899999765332      122  2255 999999876643


No 244
>COG1779 C4-type Zn-finger protein [General function prediction only]
Probab=44.65  E-value=9.4  Score=21.05  Aligned_cols=28  Identities=14%  Similarity=0.355  Sum_probs=15.4

Q ss_pred             ccccccchhhhcc---------CC---cceecCccccccc
Q psy12019         17 NKCLINWSAVQQN---------HA---GMFMCDVCGKGYK   44 (87)
Q Consensus        17 ~~c~~c~~~~~~~---------~~---~~~~c~~c~~~~~   44 (87)
                      ..|+.|+..+.-.         +.   ..+.|..||..+.
T Consensus        15 ~~CPvCg~~l~~~~~~~~IPyFG~V~i~t~~C~~CgYR~~   54 (201)
T COG1779          15 IDCPVCGGTLKAHMYLYDIPYFGEVLISTGVCERCGYRST   54 (201)
T ss_pred             ecCCcccceeeEEEeeecCCccceEEEEEEEccccCCccc
Confidence            4677777755432         11   1346777775543


No 245
>COG1645 Uncharacterized Zn-finger containing protein [General function prediction only]
Probab=44.32  E-value=15  Score=18.86  Aligned_cols=23  Identities=26%  Similarity=0.598  Sum_probs=10.8

Q ss_pred             cccccchhhhccCCcceecCcccc
Q psy12019         18 KCLINWSAVQQNHAGMFMCDVCGK   41 (87)
Q Consensus        18 ~c~~c~~~~~~~~~~~~~c~~c~~   41 (87)
                      .|+.|+-..-. ..+...|+.|+.
T Consensus        30 hCp~Cg~PLF~-KdG~v~CPvC~~   52 (131)
T COG1645          30 HCPKCGTPLFR-KDGEVFCPVCGY   52 (131)
T ss_pred             hCcccCCccee-eCCeEECCCCCc
Confidence            45555554333 222335666663


No 246
>PRK06260 threonine synthase; Validated
Probab=44.25  E-value=12  Score=22.63  Aligned_cols=26  Identities=19%  Similarity=0.410  Sum_probs=17.2

Q ss_pred             ccccccchhhhccCCcceecCcccccc
Q psy12019         17 NKCLINWSAVQQNHAGMFMCDVCGKGY   43 (87)
Q Consensus        17 ~~c~~c~~~~~~~~~~~~~c~~c~~~~   43 (87)
                      +.|..|+..+... ...+.|+.||..+
T Consensus         4 ~~C~~cg~~~~~~-~~~~~Cp~cg~~l   29 (397)
T PRK06260          4 LKCIECGKEYDPD-EIIYTCPECGGLL   29 (397)
T ss_pred             EEECCCCCCCCCC-CccccCCCCCCeE
Confidence            5788888887643 2356788887543


No 247
>TIGR03831 YgiT_finger YgiT-type zinc finger domain. This domain model describes a small domain with two copies of a putative zinc-binding motif CXXC (usually CXXCG). Most member proteins consist largely of this domain or else carry an additional C-terminal helix-turn-helix domain, resembling that of the phage protein Cro and modeled by pfam01381.
Probab=44.15  E-value=10  Score=14.86  Aligned_cols=12  Identities=33%  Similarity=1.010  Sum_probs=7.9

Q ss_pred             ceecCccccccc
Q psy12019         33 MFMCDVCGKGYK   44 (87)
Q Consensus        33 ~~~c~~c~~~~~   44 (87)
                      .+.|+.||..+.
T Consensus        32 ~~~C~~CGE~~~   43 (46)
T TIGR03831        32 ALVCPQCGEEYL   43 (46)
T ss_pred             ccccccCCCEee
Confidence            356888886653


No 248
>smart00504 Ubox Modified RING finger domain. Modified RING finger domain, without the full complement of Zn2+-binding ligands. Probable involvement in E2-dependent ubiquitination.
Probab=44.11  E-value=28  Score=14.60  Aligned_cols=45  Identities=11%  Similarity=0.011  Sum_probs=25.1

Q ss_pred             ccccccchhhhccCCcceecCcccccccchhhHHHHhhhhcCCCCCccCCCCCcccc
Q psy12019         17 NKCLINWSAVQQNHAGMFMCDVCGKGYKYKNGIYRHKKFECGQEPKYQCPQCPYRAK   73 (87)
Q Consensus        17 ~~c~~c~~~~~~~~~~~~~c~~c~~~~~~~~~~~~h~~~~~~~~~~~~c~~c~~~f~   73 (87)
                      +.|++|...+..    | ....||..|..... ..+...     . ..|+.|+..+.
T Consensus         2 ~~Cpi~~~~~~~----P-v~~~~G~v~~~~~i-~~~~~~-----~-~~cP~~~~~~~   46 (63)
T smart00504        2 FLCPISLEVMKD----P-VILPSGQTYERRAI-EKWLLS-----H-GTDPVTGQPLT   46 (63)
T ss_pred             cCCcCCCCcCCC----C-EECCCCCEEeHHHH-HHHHHH-----C-CCCCCCcCCCC
Confidence            457777777655    3 23356766655543 333332     2 36777776663


No 249
>PF08209 Sgf11:  Sgf11 (transcriptional regulation protein);  InterPro: IPR013246 The Sgf11 family is a SAGA complex subunit in Saccharomyces cerevisiae (Baker's yeast). The SAGA complex is a multisubunit protein complex involved in transcriptional regulation. SAGA combines proteins involved in interactions with DNA-bound activators and TATA-binding protein (TBP), as well as enzymes for histone acetylation and deubiquitylation [].; PDB: 3M99_B 2LO2_A 3MHH_C 3MHS_C.
Probab=43.94  E-value=23  Score=13.47  Aligned_cols=21  Identities=19%  Similarity=0.425  Sum_probs=11.7

Q ss_pred             ceecCcccccccchhhHHHHhh
Q psy12019         33 MFMCDVCGKGYKYKNGIYRHKK   54 (87)
Q Consensus        33 ~~~c~~c~~~~~~~~~~~~h~~   54 (87)
                      .+.|+.|++.+. .+.+..|+.
T Consensus         4 ~~~C~nC~R~v~-a~RfA~HLe   24 (33)
T PF08209_consen    4 YVECPNCGRPVA-ASRFAPHLE   24 (33)
T ss_dssp             EEE-TTTSSEEE-GGGHHHHHH
T ss_pred             eEECCCCcCCcc-hhhhHHHHH
Confidence            467888887653 334555554


No 250
>COG1326 Uncharacterized archaeal Zn-finger protein [General function prediction only]
Probab=43.88  E-value=27  Score=19.34  Aligned_cols=10  Identities=30%  Similarity=0.780  Sum_probs=5.0

Q ss_pred             eecCcccccc
Q psy12019         34 FMCDVCGKGY   43 (87)
Q Consensus        34 ~~c~~c~~~~   43 (87)
                      ..|..||..+
T Consensus        31 vrC~eCG~V~   40 (201)
T COG1326          31 VRCEECGTVH   40 (201)
T ss_pred             EEccCCCcEe
Confidence            4455555443


No 251
>COG4640 Predicted membrane protein [Function unknown]
Probab=43.87  E-value=18  Score=22.33  Aligned_cols=15  Identities=20%  Similarity=0.751  Sum_probs=9.4

Q ss_pred             eecCcccccccchhh
Q psy12019         34 FMCDVCGKGYKYKNG   48 (87)
Q Consensus        34 ~~c~~c~~~~~~~~~   48 (87)
                      ..|..||..|.....
T Consensus        16 ~qC~qCG~~~t~~~s   30 (465)
T COG4640          16 VQCTQCGHKFTSRQS   30 (465)
T ss_pred             ccccccCCcCCchhh
Confidence            347777776665544


No 252
>COG1066 Sms Predicted ATP-dependent serine protease [Posttranslational modification, protein turnover, chaperones]
Probab=43.41  E-value=12  Score=23.23  Aligned_cols=24  Identities=17%  Similarity=0.213  Sum_probs=16.8

Q ss_pred             CcccccccchhhhccCCcceecCcccc
Q psy12019         15 KHNKCLINWSAVQQNHAGMFMCDVCGK   41 (87)
Q Consensus        15 ~~~~c~~c~~~~~~~~~~~~~c~~c~~   41 (87)
                      ..|.|+.|+..+..   |.=+|+.|+.
T Consensus         6 t~f~C~~CG~~s~K---W~GkCp~Cg~   29 (456)
T COG1066           6 TAFVCQECGYVSPK---WLGKCPACGA   29 (456)
T ss_pred             cEEEcccCCCCCcc---ccccCCCCCC
Confidence            46899999977654   3336788874


No 253
>PF10276 zf-CHCC:  Zinc-finger domain;  InterPro: IPR019401 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.   This entry represents a short conserved zinc-finger domain. It contains the sequence motif Cx8Hx14Cx2C. ; PDB: 2JVM_A 2JRR_A 2JZ8_A.
Probab=43.15  E-value=8.6  Score=15.33  Aligned_cols=10  Identities=40%  Similarity=0.843  Sum_probs=5.9

Q ss_pred             ccCCCCCccc
Q psy12019         63 YQCPQCPYRA   72 (87)
Q Consensus        63 ~~c~~c~~~f   72 (87)
                      -.|+.|+..|
T Consensus        30 ~~CpYCg~~y   39 (40)
T PF10276_consen   30 VVCPYCGTRY   39 (40)
T ss_dssp             EEETTTTEEE
T ss_pred             EECCCCCCEE
Confidence            4566666554


No 254
>PTZ00303 phosphatidylinositol kinase; Provisional
Probab=42.61  E-value=16  Score=24.90  Aligned_cols=31  Identities=16%  Similarity=0.150  Sum_probs=22.9

Q ss_pred             ccccccchhhhcc----CCcceecCcccccccchh
Q psy12019         17 NKCLINWSAVQQN----HAGMFMCDVCGKGYKYKN   47 (87)
Q Consensus        17 ~~c~~c~~~~~~~----~~~~~~c~~c~~~~~~~~   47 (87)
                      -.|..|++.|...    ..+.+.|..||..|...-
T Consensus       461 dtC~~C~kkFfSlsK~L~~RKHHCRkCGrVFC~~C  495 (1374)
T PTZ00303        461 DSCPSCGRAFISLSRPLGTRAHHCRSCGIRLCVFC  495 (1374)
T ss_pred             CcccCcCCcccccccccccccccccCCccccCccc
Confidence            4699999999653    345678999998776653


No 255
>PRK05978 hypothetical protein; Provisional
Probab=42.09  E-value=16  Score=19.22  Aligned_cols=11  Identities=18%  Similarity=0.446  Sum_probs=7.1

Q ss_pred             ccCCCCCcccc
Q psy12019         63 YQCPQCPYRAK   73 (87)
Q Consensus        63 ~~c~~c~~~f~   73 (87)
                      -.|+.||-.|.
T Consensus        53 ~~C~~CG~~~~   63 (148)
T PRK05978         53 DHCAACGEDFT   63 (148)
T ss_pred             CCccccCCccc
Confidence            46777776554


No 256
>PF10263 SprT-like:  SprT-like family;  InterPro: IPR006640 This is a family of uncharacterised bacterial proteins which includes Escherichia coli SprT (P39902 from SWISSPROT). SprT is described as a regulator of bolA gene in stationary phase []. The majority of members contain the metallopeptidase zinc binding signature which has a HExxH motif, however there is no evidence for them being metallopeptidases. 
Probab=41.17  E-value=13  Score=19.12  Aligned_cols=32  Identities=25%  Similarity=0.736  Sum_probs=19.6

Q ss_pred             ceecCcccccccchhhHHHHhhhhcCCCCCccCCCCCcccc
Q psy12019         33 MFMCDVCGKGYKYKNGIYRHKKFECGQEPKYQCPQCPYRAK   73 (87)
Q Consensus        33 ~~~c~~c~~~~~~~~~~~~h~~~~~~~~~~~~c~~c~~~f~   73 (87)
                      .|.|..|+..+...      .+.  .... |.|..|+..|.
T Consensus       123 ~~~C~~C~~~~~r~------~~~--~~~~-~~C~~C~~~l~  154 (157)
T PF10263_consen  123 VYRCPSCGREYKRH------RRS--KRKR-YRCGRCGGPLV  154 (157)
T ss_pred             EEEcCCCCCEeeee------ccc--chhh-EECCCCCCEEE
Confidence            57888888765222      222  2233 78888886654


No 257
>PRK12366 replication factor A; Reviewed
Probab=41.11  E-value=14  Score=24.09  Aligned_cols=22  Identities=27%  Similarity=0.800  Sum_probs=9.3

Q ss_pred             ccccchhhhccCCcceecCcccc
Q psy12019         19 CLINWSAVQQNHAGMFMCDVCGK   41 (87)
Q Consensus        19 c~~c~~~~~~~~~~~~~c~~c~~   41 (87)
                      |+.|.+.... ....|.|+.|++
T Consensus       535 Cp~CnkKv~~-~~g~~~C~~c~~  556 (637)
T PRK12366        535 CPNCRKRVEE-VDGEYICEFCGE  556 (637)
T ss_pred             ccccCeEeEc-CCCcEECCCCCC
Confidence            4444444332 223344544443


No 258
>KOG1280|consensus
Probab=41.02  E-value=27  Score=21.20  Aligned_cols=24  Identities=25%  Similarity=0.614  Sum_probs=16.8

Q ss_pred             ccCCCCCcccccchHHHhhhhhcC
Q psy12019         63 YQCPQCPYRAKQNAHLTTHMAIKH   86 (87)
Q Consensus        63 ~~c~~c~~~f~~~~~l~~h~~~~h   86 (87)
                      |.|+.|++.--....+..|....|
T Consensus        80 ftCPyC~~~Gfte~~f~~Hv~s~H  103 (381)
T KOG1280|consen   80 FTCPYCGIMGFTERQFGTHVLSQH  103 (381)
T ss_pred             ccCCcccccccchhHHHHHhhhcC
Confidence            778888877666777777765444


No 259
>PF02146 SIR2:  Sir2 family;  InterPro: IPR003000 These sequences represent the Sirtuin (Sir2-related) family of NAD+-dependent deacetylases. This family of enzymes is broadly conserved from bacteria to humans. In yeast, Sir2 proteins form complexes with other proteins to silence chromatin by accessing histones and deacetylating them. Sir2 proteins have been proposed to play a role in silencing, chromosome stability and ageing []. The bacterial enzyme CobB, an homologue of Sir2, is a phosphoribosyltransferase []. An in vitro ADP ribosyltransferase activity has also been associated with human members of this family []. Sir2-like enzymes employ NAD+ as a cosubstrate in deacetylation reactions [] and catalyse a reaction in which the cleavage of NAD(+)and histone and/or protein deacetylation are coupled to the formation of O-acetyl-ADP-ribose, a novel metabolite. The dependence of the reaction on both NAD(+) and the generation of this potential second messenger offers new clues to understanding the function and regulation of nuclear, cytoplasmic and mitochondrial Sir2-like enzymes []. Silent Information Regulator protein of Saccharomyces cerevisiae (Sir2) is one of several factors critical for silencing at least three loci. Among them, it is unique because it silences the rDNA as well as the mating type loci and telomeres []. Sir2 interacts in a complex with itself and with Sir3 and Sir4, two proteins that are able to interact with nucleosomes. In addition Sir2 also interacts with ubiquitination factors and/or complexes [].  Homologues of Sir2 share a core domain including the GAG and NID motifs and a putative C4 Zinc finger. The regions containing these three conserved motifs are individually essential for Sir2 silencing function, as are the four cysteins []. In addition, the conserved residues HG next to the putative Zn finger have been shown to be essential for the ADP ribosyltransferase activity []. ; GO: 0008270 zinc ion binding, 0070403 NAD+ binding, 0006476 protein deacetylation; PDB: 1S5P_A 3PKI_E 3PKJ_F 3K35_A 1ICI_A 1M2K_A 1M2G_A 1M2N_B 1M2H_A 1M2J_A ....
Probab=40.86  E-value=47  Score=17.62  Aligned_cols=35  Identities=29%  Similarity=0.646  Sum_probs=20.6

Q ss_pred             ceecCcccccccchhhHHHHhhhhcCCCCCccCCCCCccc
Q psy12019         33 MFMCDVCGKGYKYKNGIYRHKKFECGQEPKYQCPQCPYRA   72 (87)
Q Consensus        33 ~~~c~~c~~~~~~~~~~~~h~~~~~~~~~~~~c~~c~~~f   72 (87)
                      ...|..|++.+.......   ..... .. -.|+.|+...
T Consensus       105 ~~~C~~C~~~~~~~~~~~---~~~~~-~~-~~C~~C~~~l  139 (178)
T PF02146_consen  105 RLRCSKCGKEYDREDIVD---SIDEE-EP-PRCPKCGGLL  139 (178)
T ss_dssp             EEEETTTSBEEEGHHHHH---HHHTT-SS-CBCTTTSCBE
T ss_pred             eeeecCCCccccchhhcc---ccccc-cc-ccccccCccC
Confidence            357889998876554322   12222 33 4888888644


No 260
>TIGR01384 TFS_arch transcription factor S, archaeal. There has been an apparent duplication event in the Halobacteriaceae lineage (Haloarcula, Haloferax, Haloquadratum, Halobacterium and Natromonas). There appears to be a separate duplication in Methanosphaera stadtmanae.
Probab=40.67  E-value=22  Score=17.02  Aligned_cols=10  Identities=30%  Similarity=1.052  Sum_probs=7.1

Q ss_pred             ccCCCCCccc
Q psy12019         63 YQCPQCPYRA   72 (87)
Q Consensus        63 ~~c~~c~~~f   72 (87)
                      ..|+.||..-
T Consensus        63 ~~Cp~Cg~~~   72 (104)
T TIGR01384        63 VECPKCGHKE   72 (104)
T ss_pred             CCCCCCCCCe
Confidence            6888888543


No 261
>PRK05580 primosome assembly protein PriA; Validated
Probab=40.57  E-value=21  Score=23.56  Aligned_cols=24  Identities=17%  Similarity=0.415  Sum_probs=9.6

Q ss_pred             ccccccchhhhcc-CCcceecCccc
Q psy12019         17 NKCLINWSAVQQN-HAGMFMCDVCG   40 (87)
Q Consensus        17 ~~c~~c~~~~~~~-~~~~~~c~~c~   40 (87)
                      ..|+.|+..+... ......|..||
T Consensus       391 ~~C~~C~~~l~~h~~~~~l~Ch~Cg  415 (679)
T PRK05580        391 AECPHCDASLTLHRFQRRLRCHHCG  415 (679)
T ss_pred             cCCCCCCCceeEECCCCeEECCCCc
Confidence            3444444443321 22233455554


No 262
>PRK08402 replication factor A; Reviewed
Probab=40.53  E-value=17  Score=21.93  Aligned_cols=23  Identities=17%  Similarity=0.378  Sum_probs=13.2

Q ss_pred             cccccchhhh-ccCCcceecCccc
Q psy12019         18 KCLINWSAVQ-QNHAGMFMCDVCG   40 (87)
Q Consensus        18 ~c~~c~~~~~-~~~~~~~~c~~c~   40 (87)
                      .|+.|.+.+. ..+...|.|..|+
T Consensus       214 aCp~CnKkv~~~~~~~~~~Ce~~~  237 (355)
T PRK08402        214 ACPECRRKVDYDPATDTWICPEHG  237 (355)
T ss_pred             cCCCCCeEEEEecCCCCEeCCCCC
Confidence            4666666665 3334456666665


No 263
>COG5216 Uncharacterized conserved protein [Function unknown]
Probab=40.51  E-value=17  Score=15.84  Aligned_cols=6  Identities=50%  Similarity=1.669  Sum_probs=2.5

Q ss_pred             ccCCCC
Q psy12019         63 YQCPQC   68 (87)
Q Consensus        63 ~~c~~c   68 (87)
                      -.|+.|
T Consensus        45 ArCPSC   50 (67)
T COG5216          45 ARCPSC   50 (67)
T ss_pred             EEcCCc
Confidence            444444


No 264
>COG5188 PRP9 Splicing factor 3a, subunit 3 [RNA processing and modification]
Probab=40.43  E-value=19  Score=21.93  Aligned_cols=28  Identities=18%  Similarity=0.344  Sum_probs=18.9

Q ss_pred             hhhhcCCCCCccCCCCC-cccccchHHHhh
Q psy12019         53 KKFECGQEPKYQCPQCP-YRAKQNAHLTTH   81 (87)
Q Consensus        53 ~~~~~~~~~~~~c~~c~-~~f~~~~~l~~h   81 (87)
                      -+.|..++- |.|.+|| +.+.....+.+|
T Consensus       366 ~klhgLd~e-f~CEICgNyvy~GR~~FdrH  394 (470)
T COG5188         366 CKLHGLDIE-FECEICGNYVYYGRDRFDRH  394 (470)
T ss_pred             HHhcCCCcc-eeeeecccccccchHHHHhh
Confidence            345666676 9999998 666655555555


No 265
>PF01096 TFIIS_C:  Transcription factor S-II (TFIIS);  InterPro: IPR001222 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents a zinc finger motif found in transcription factor IIs (TFIIS). In eukaryotes the initiation of transcription of protein encoding genes by polymerase II (Pol II) is modulated by general and specific transcription factors. The general transcription factors operate through common promoters elements (such as the TATA box). At least eight different proteins associate to form the general transcription factors: TFIIA, -IIB, -IID, -IIE, -IIF, -IIG, -IIH and -IIS []. During mRNA elongation, Pol II can encounter DNA sequences that cause reverse movement of the enzyme. Such backtracking involves extrusion of the RNA 3'-end into the pore, and can lead to transcriptional arrest. Escape from arrest requires cleavage of the extruded RNA with the help of TFIIS, which induces mRNA cleavage by enhancing the intrinsic nuclease activity of RNA polymerase (Pol) II, past template-encoded pause sites []. TFIIS extends from the polymerase surface via a pore to the internal active site. Two essential and invariant acidic residues in a TFIIS loop complement the Pol II active site and could position a metal ion and a water molecule for hydrolytic RNA cleavage. TFIIS also induces extensive structural changes in Pol II that would realign nucleic acids in the active centre.  TFIIS is a protein of about 300 amino acids. It contains three regions: a variable N-terminal domain not required for TFIIS activity; a conserved central domain required for Pol II binding; and a conserved C-terminal C4-type zinc finger essential for RNA cleavage. The zinc finger folds in a conformation termed a zinc ribbon [] characterised by a three-stranded antiparallel beta-sheet and two beta-hairpins. A backbone model for Pol II-TFIIS complex was obtained from X-ray analysis. It shows that a beta hairpin protrudes from the zinc finger and complements the pol II active site [].  Some viral proteins also contain the TFIIS zinc ribbon C-terminal domain. The Vaccinia virus protein, unlike its eukaryotic homologue, is an integral RNA polymerase subunit rather than a readily separable transcription factor []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003676 nucleic acid binding, 0008270 zinc ion binding, 0006351 transcription, DNA-dependent; PDB: 3M4O_I 3S14_I 2E2J_I 4A3J_I 3HOZ_I 1TWA_I 3S1Q_I 3S1N_I 1TWG_I 3I4M_I ....
Probab=40.31  E-value=9.5  Score=14.91  Aligned_cols=9  Identities=44%  Similarity=1.028  Sum_probs=4.0

Q ss_pred             ccCCCCCcc
Q psy12019         63 YQCPQCPYR   71 (87)
Q Consensus        63 ~~c~~c~~~   71 (87)
                      |.|..|++.
T Consensus        29 y~C~~C~~~   37 (39)
T PF01096_consen   29 YVCCNCGHR   37 (39)
T ss_dssp             EEESSSTEE
T ss_pred             EEeCCCCCe
Confidence            444444443


No 266
>PF06677 Auto_anti-p27:  Sjogren's syndrome/scleroderma autoantigen 1 (Autoantigen p27);  InterPro: IPR009563 The proteins in this entry are functionally uncharacterised and include several proteins that characterise Sjogren's syndrome/scleroderma autoantigen 1 (Autoantigen p27). It is thought that the potential association of anti-p27 with anti-centromere antibodies suggests that autoantigen p27 might play a role in mitosis [].
Probab=40.01  E-value=23  Score=14.16  Aligned_cols=6  Identities=50%  Similarity=1.370  Sum_probs=2.7

Q ss_pred             ecCccc
Q psy12019         35 MCDVCG   40 (87)
Q Consensus        35 ~c~~c~   40 (87)
                      .|+.|+
T Consensus        19 ~Cp~C~   24 (41)
T PF06677_consen   19 HCPDCG   24 (41)
T ss_pred             ccCCCC
Confidence            344454


No 267
>PF04641 Rtf2:  Rtf2 RING-finger
Probab=39.78  E-value=19  Score=20.57  Aligned_cols=51  Identities=18%  Similarity=0.280  Sum_probs=29.9

Q ss_pred             CCCcccccccchhhhccCCcceec-CcccccccchhhHHHHhhhhcCCCCCccCCCCCcccc
Q psy12019         13 EPKHNKCLINWSAVQQNHAGMFMC-DVCGKGYKYKNGIYRHKKFECGQEPKYQCPQCPYRAK   73 (87)
Q Consensus        13 ~~~~~~c~~c~~~~~~~~~~~~~c-~~c~~~~~~~~~~~~h~~~~~~~~~~~~c~~c~~~f~   73 (87)
                      ....|.|++.+..|...  ..|.. ..||-.|..... ..- .     .. ..|+.|+..|.
T Consensus       110 ~~~~~~CPvt~~~~~~~--~~fv~l~~cG~V~s~~al-ke~-k-----~~-~~Cp~c~~~f~  161 (260)
T PF04641_consen  110 SEGRFICPVTGKEFNGK--HKFVYLRPCGCVFSEKAL-KEL-K-----KS-KKCPVCGKPFT  161 (260)
T ss_pred             CCceeECCCCCcccCCc--eeEEEEcCCCCEeeHHHH-Hhh-c-----cc-ccccccCCccc
Confidence            34578999988888332  23333 347766655542 211 1     22 56888888876


No 268
>PRK14138 NAD-dependent deacetylase; Provisional
Probab=39.68  E-value=42  Score=19.07  Aligned_cols=33  Identities=30%  Similarity=0.640  Sum_probs=18.7

Q ss_pred             ceecCcccccccchhhHHHHhhhhcCCCCCccCCCCCc
Q psy12019         33 MFMCDVCGKGYKYKNGIYRHKKFECGQEPKYQCPQCPY   70 (87)
Q Consensus        33 ~~~c~~c~~~~~~~~~~~~h~~~~~~~~~~~~c~~c~~   70 (87)
                      ...|..|++.+.......   ..... .. -.|+.|+.
T Consensus       119 ~~~C~~C~~~~~~~~~~~---~~~~~-~~-p~Cp~Cgg  151 (244)
T PRK14138        119 EYYCVRCGKRYTVEDVIE---KLEKS-DV-PRCDDCSG  151 (244)
T ss_pred             eeEECCCCCcccHHHHHH---HHhcC-CC-CCCCCCCC
Confidence            356888988776544332   11112 22 36888874


No 269
>COG0846 SIR2 NAD-dependent protein deacetylases, SIR2 family [Transcription]
Probab=39.60  E-value=26  Score=20.10  Aligned_cols=33  Identities=30%  Similarity=0.547  Sum_probs=17.6

Q ss_pred             ceecCcccccccchhhHHHHhhhhcCCCCCccCCCCCc
Q psy12019         33 MFMCDVCGKGYKYKNGIYRHKKFECGQEPKYQCPQCPY   70 (87)
Q Consensus        33 ~~~c~~c~~~~~~~~~~~~h~~~~~~~~~~~~c~~c~~   70 (87)
                      .+.|..|+..+........   ...+ .+ -.|+.||.
T Consensus       122 ~~~C~~C~~~~~~~~~~~~---~~~~-~~-p~C~~Cg~  154 (250)
T COG0846         122 RVRCSKCGNQYYDEDVIKF---IEDG-LI-PRCPKCGG  154 (250)
T ss_pred             eeEeCCCcCccchhhhhhh---cccC-CC-CcCccCCC
Confidence            4568888877654442111   1112 22 46777876


No 270
>PRK11827 hypothetical protein; Provisional
Probab=39.39  E-value=28  Score=15.27  Aligned_cols=30  Identities=10%  Similarity=0.257  Sum_probs=16.3

Q ss_pred             ccccccchhhhcc-CCcceecCcccccccch
Q psy12019         17 NKCLINWSAVQQN-HAGMFMCDVCGKGYKYK   46 (87)
Q Consensus        17 ~~c~~c~~~~~~~-~~~~~~c~~c~~~~~~~   46 (87)
                      ..|+.|...+... ......|..|+..|.-.
T Consensus         9 LaCP~ckg~L~~~~~~~~Lic~~~~laYPI~   39 (60)
T PRK11827          9 IACPVCNGKLWYNQEKQELICKLDNLAFPLR   39 (60)
T ss_pred             eECCCCCCcCeEcCCCCeEECCccCeecccc
Confidence            3566666555443 22345677777666544


No 271
>PF12907 zf-met2:  Zinc-binding
Probab=39.36  E-value=8.2  Score=15.42  Aligned_cols=6  Identities=33%  Similarity=0.982  Sum_probs=2.6

Q ss_pred             cCCCCC
Q psy12019         64 QCPQCP   69 (87)
Q Consensus        64 ~c~~c~   69 (87)
                      .|.+|-
T Consensus         3 ~C~iC~    8 (40)
T PF12907_consen    3 ICKICR    8 (40)
T ss_pred             CcHHhh
Confidence            344444


No 272
>COG0068 HypF Hydrogenase maturation factor [Posttranslational modification, protein turnover, chaperones]
Probab=39.21  E-value=3.4  Score=27.08  Aligned_cols=29  Identities=34%  Similarity=0.914  Sum_probs=15.7

Q ss_pred             cCcccccccchhhHHHHhhhhcCCCCCccCCCCCcc
Q psy12019         36 CDVCGKGYKYKNGIYRHKKFECGQEPKYQCPQCPYR   71 (87)
Q Consensus        36 c~~c~~~~~~~~~~~~h~~~~~~~~~~~~c~~c~~~   71 (87)
                      |+.|.+.+....+    +|.|.  .+ ..|+.||-.
T Consensus       154 C~~C~~EY~dP~n----RRfHA--Qp-~aCp~CGP~  182 (750)
T COG0068         154 CPFCDKEYKDPLN----RRFHA--QP-IACPKCGPH  182 (750)
T ss_pred             CHHHHHHhcCccc----ccccc--cc-ccCcccCCC
Confidence            5555554444432    34443  33 778888753


No 273
>PF12230 PRP21_like_P:  Pre-mRNA splicing factor PRP21 like protein;  InterPro: IPR022030  This domain family is found in eukaryotes, and is typically between 212 and 238 amino acids in length. The family is found in association with PF01805 from PFAM. There are two completely conserved residues (W and H) that may be functionally important. PRP21 is required for assembly of the prespliceosome and it interacts with U2 snRNP and/or pre-mRNA in the prespliceosome. This family also contains proteins similar to PRP21, such as the mammalian SF3a. SF3a also interacts with U2 snRNP from the prespliceosome, converting it to its active form. ; PDB: 4DGW_B.
Probab=38.75  E-value=10  Score=21.11  Aligned_cols=22  Identities=23%  Similarity=0.366  Sum_probs=0.0

Q ss_pred             ccCCCCCcccccchHHHhhhhhc
Q psy12019         63 YQCPQCPYRAKQNAHLTTHMAIK   85 (87)
Q Consensus        63 ~~c~~c~~~f~~~~~l~~h~~~~   85 (87)
                      ..|++||...+ .+.+..|+|+.
T Consensus       169 ~~cPitGe~IP-~~e~~eHmRi~  190 (229)
T PF12230_consen  169 IICPITGEMIP-ADEMDEHMRIE  190 (229)
T ss_dssp             -----------------------
T ss_pred             ccccccccccc-ccccccccccc
Confidence            78999998876 44677888763


No 274
>PRK07218 replication factor A; Provisional
Probab=38.42  E-value=17  Score=22.59  Aligned_cols=9  Identities=11%  Similarity=0.239  Sum_probs=4.3

Q ss_pred             cccccchhh
Q psy12019         18 KCLINWSAV   26 (87)
Q Consensus        18 ~c~~c~~~~   26 (87)
                      .|+.|.+..
T Consensus       299 rCP~C~r~v  307 (423)
T PRK07218        299 RCPECGRVI  307 (423)
T ss_pred             cCcCccccc
Confidence            355555443


No 275
>PF01215 COX5B:  Cytochrome c oxidase subunit Vb This family consists of chains F and S ;  InterPro: IPR002124 Cytochrome c oxidase (1.9.3.1 from EC) is an oligomeric enzymatic complex which is a component of the respiratory chain complex and is involved in the transfer of electrons from cytochrome c to oxygen []. In eukaryotes this enzyme complex is located in the mitochondrial inner membrane; in aerobic prokaryotes it is found in the plasma membrane.  In eukaryotes, in addition to the three large subunits, I, II and III, that form the catalytic centre of the enzyme complex, there are a variable number of small polypeptidic subunits. One of these subunits, which is known as Vb in mammals, V in Dictyostelium discoideum (Slime mold) and IV in yeast, binds a zinc atom. The sequence of subunit Vb is well conserved and includes three conserved cysteines that coordinate the zinc ion [, ]. Two of these cysteines are clustered in the C-terminal section of the subunit.; GO: 0004129 cytochrome-c oxidase activity, 0005740 mitochondrial envelope; PDB: 2EIL_S 2ZXW_S 3ASN_S 1OCO_S 3AG4_S 3ABK_S 1OCZ_S 1OCC_F 3ASO_S 3ABL_S ....
Probab=38.28  E-value=17  Score=18.82  Aligned_cols=17  Identities=29%  Similarity=0.589  Sum_probs=12.2

Q ss_pred             CCcceecCcccccccch
Q psy12019         30 HAGMFMCDVCGKGYKYK   46 (87)
Q Consensus        30 ~~~~~~c~~c~~~~~~~   46 (87)
                      ..++..|.+||..|.-.
T Consensus       109 ~g~~~RCpeCG~~fkL~  125 (136)
T PF01215_consen  109 KGKPQRCPECGQVFKLK  125 (136)
T ss_dssp             TTSEEEETTTEEEEEEE
T ss_pred             CCCccCCCCCCeEEEEE
Confidence            34578899999877543


No 276
>PF06827 zf-FPG_IleRS:  Zinc finger found in FPG and IleRS;  InterPro: IPR010663 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents a zinc finger domain found at the C-terminal in both DNA glycosylase/AP lyase enzymes and in isoleucyl tRNA synthetase. In these two types of enzymes, the C-terminal domain forms a zinc finger. Some related proteins may not bind zinc.  DNA glycosylase/AP lyase enzymes are involved in base excision repair of DNA damaged by oxidation or by mutagenic agents. These enzymes have both DNA glycosylase activity (3.2.2 from EC) and AP lyase activity (4.2.99.18 from EC) []. Examples include formamidopyrimidine-DNA glycosylases (Fpg; MutM) and endonuclease VIII (Nei). Formamidopyrimidine-DNA glycosylases (Fpg, MutM) is a trifunctional DNA base excision repair enzyme that removes a wide range of oxidation-damaged bases (N-glycosylase activity; 3.2.2.23 from EC) and cleaves both the 3'- and 5'-phosphodiester bonds of the resulting apurinic/apyrimidinic site (AP lyase activity; 4.2.99.18 from EC). Fpg has a preference for oxidised purines, excising oxidized purine bases such as 7,8-dihydro-8-oxoguanine (8-oxoG). ITs AP (apurinic/apyrimidinic) lyase activity introduces nicks in the DNA strand, cleaving the DNA backbone by beta-delta elimination to generate a single-strand break at the site of the removed base with both 3'- and 5'-phosphates. Fpg is a monomer composed of 2 domains connected by a flexible hinge []. The two DNA-binding motifs (a zinc finger and the helix-two-turns-helix motifs) suggest that the oxidized base is flipped out from double-stranded DNA in the binding mode and excised by a catalytic mechanism similar to that of bifunctional base excision repair enzymes []. Fpg binds one ion of zinc at the C terminus, which contains four conserved and essential cysteines []. Endonuclease VIII (Nei) has the same enzyme activities as Fpg above, but with a preference for oxidized pyrimidines, such as thymine glycol, 5,6-dihydrouracil and 5,6-dihydrothymine [, ].  An Fpg-type zinc finger is also found at the C terminus of isoleucyl tRNA synthetase (6.1.1.5 from EC) [, ]. This enzyme catalyses the attachment of isoleucine to tRNA(Ile). As IleRS can inadvertently accommodate and process structurally similar amino acids such as valine, to avoid such errors it has two additional distinct tRNA(Ile)-dependent editing activities. One activity is designated as 'pre-transfer' editing and involves the hydrolysis of activated Val-AMP. The other activity is designated 'post-transfer' editing and involves deacylation of mischarged Val-tRNA(Ile) [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003824 catalytic activity; PDB: 1K82_C 1Q39_A 2OQ4_B 2OPF_A 1K3X_A 1K3W_A 1Q3B_A 2EA0_A 1Q3C_A 2XZF_A ....
Probab=37.88  E-value=17  Score=13.05  Aligned_cols=7  Identities=29%  Similarity=0.852  Sum_probs=1.7

Q ss_pred             ccccchh
Q psy12019         19 CLINWSA   25 (87)
Q Consensus        19 c~~c~~~   25 (87)
                      |+-|+..
T Consensus         4 C~rC~~~   10 (30)
T PF06827_consen    4 CPRCWNY   10 (30)
T ss_dssp             -TTT--B
T ss_pred             CccCCCc
Confidence            4444444


No 277
>PF06397 Desulfoferrod_N:  Desulfoferrodoxin, N-terminal domain;  InterPro: IPR004462 This domain is found as essentially the full length of desulforedoxin, a 37-residue homodimeric non-haem iron protein. It is also found as the N-terminal domain of desulfoferrodoxin (rbo), a homodimeric non-haem iron protein with 2 Fe atoms per monomer in different oxidation states. This domain binds the ferric rather than the ferrous Fe of desulfoferrodoxin. Neelaredoxin, a monomeric blue non-haem iron protein, lacks this domain.; GO: 0005506 iron ion binding; PDB: 1DFX_A 1VZI_B 2JI2_D 1VZH_B 2JI3_C 2JI1_C 1VZG_A 1CFW_A 2LK5_B 1DHG_B ....
Probab=37.65  E-value=17  Score=14.15  Aligned_cols=11  Identities=27%  Similarity=0.933  Sum_probs=5.5

Q ss_pred             ceecCcccccc
Q psy12019         33 MFMCDVCGKGY   43 (87)
Q Consensus        33 ~~~c~~c~~~~   43 (87)
                      -|.|..||+..
T Consensus         6 ~YkC~~CGniV   16 (36)
T PF06397_consen    6 FYKCEHCGNIV   16 (36)
T ss_dssp             EEE-TTT--EE
T ss_pred             EEEccCCCCEE
Confidence            57788888654


No 278
>smart00731 SprT SprT homologues. Predicted to have roles in transcription elongation. Contains a conserved HExxH motif, indicating a metalloprotease function.
Probab=37.65  E-value=19  Score=18.55  Aligned_cols=34  Identities=21%  Similarity=0.524  Sum_probs=19.5

Q ss_pred             cceecCcccccccchhhHHHHhhhhcCCCCCccCCCCCcccc
Q psy12019         32 GMFMCDVCGKGYKYKNGIYRHKKFECGQEPKYQCPQCPYRAK   73 (87)
Q Consensus        32 ~~~~c~~c~~~~~~~~~~~~h~~~~~~~~~~~~c~~c~~~f~   73 (87)
                      -.|.|..|+..+..      +.+.. .... |.|..|+-.+.
T Consensus       111 ~~y~C~~C~~~~~~------~rr~~-~~~~-y~C~~C~g~l~  144 (146)
T smart00731      111 YPYRCTGCGQRYLR------VRRSN-NVSR-YRCGKCGGKLI  144 (146)
T ss_pred             EEEECCCCCCCCce------Ecccc-Ccce-EEcCCCCCEEE
Confidence            36788888876532      22221 1144 88888876553


No 279
>PF02318 FYVE_2:  FYVE-type zinc finger;  InterPro: IPR003315 This entry represents the zinc-binding domain found in rabphilin Rab3A. The small G protein Rab3A plays an important role in the regulation of neurotransmitter release. The crystal structure of the small G protein Rab3A complexed with the effector domain of rabphilin-3A shows that the effector domain of rabphilin-3A contacts Rab3A in two distinct areas. The first interface involves the Rab3A switch I and switch II regions, which are sensitive to the nucleotide-binding state of Rab3A. The second interface consists of a deep pocket in Rab3A that interacts with a SGAWFF structural element of rabphilin-3A. Sequence and structure analysis, and biochemical data suggest that this pocket, or Rab complementarity-determining region (RabCDR), establishes a specific interaction between each Rab protein and its effectors. It has been suggested that RabCDRs could be major determinants of effector specificity during vesicle trafficking and fusion [].; GO: 0008270 zinc ion binding, 0017137 Rab GTPase binding, 0006886 intracellular protein transport; PDB: 2CSZ_A 2ZET_C 1ZBD_B 3BC1_B 2CJS_C 2A20_A.
Probab=37.04  E-value=24  Score=17.52  Aligned_cols=49  Identities=16%  Similarity=0.243  Sum_probs=27.2

Q ss_pred             cccccccchhhhccCCcceecCcccccccchhhHHHHhhhhcCCCCCccCCCCCc
Q psy12019         16 HNKCLINWSAVQQNHAGMFMCDVCGKGYKYKNGIYRHKKFECGQEPKYQCPQCPY   70 (87)
Q Consensus        16 ~~~c~~c~~~~~~~~~~~~~c~~c~~~~~~~~~~~~h~~~~~~~~~~~~c~~c~~   70 (87)
                      ...|..|...|.........|..|...+-..-...     ..++.. |.|..|.+
T Consensus        54 ~~~C~~C~~~fg~l~~~~~~C~~C~~~VC~~C~~~-----~~~~~~-WlC~vC~k  102 (118)
T PF02318_consen   54 ERHCARCGKPFGFLFNRGRVCVDCKHRVCKKCGVY-----SKKEPI-WLCKVCQK  102 (118)
T ss_dssp             CSB-TTTS-BCSCTSTTCEEETTTTEEEETTSEEE-----TSSSCC-EEEHHHHH
T ss_pred             CcchhhhCCcccccCCCCCcCCcCCccccCccCCc-----CCCCCC-EEChhhHH
Confidence            45788898888766544456666665554443211     223344 78877743


No 280
>PRK14892 putative transcription elongation factor Elf1; Provisional
Probab=35.95  E-value=26  Score=17.04  Aligned_cols=8  Identities=13%  Similarity=-0.126  Sum_probs=4.4

Q ss_pred             cccccccc
Q psy12019         16 HNKCLINW   23 (87)
Q Consensus        16 ~~~c~~c~   23 (87)
                      .|.|+.|+
T Consensus        21 ~f~CP~Cg   28 (99)
T PRK14892         21 IFECPRCG   28 (99)
T ss_pred             EeECCCCC
Confidence            35566655


No 281
>PRK11788 tetratricopeptide repeat protein; Provisional
Probab=35.92  E-value=24  Score=20.79  Aligned_cols=21  Identities=14%  Similarity=0.308  Sum_probs=9.4

Q ss_pred             ccccccchhhhccCCcceecCccc
Q psy12019         17 NKCLINWSAVQQNHAGMFMCDVCG   40 (87)
Q Consensus        17 ~~c~~c~~~~~~~~~~~~~c~~c~   40 (87)
                      +.|..|+.+...   +.+.|+.|+
T Consensus       355 ~~c~~cg~~~~~---~~~~c~~c~  375 (389)
T PRK11788        355 YRCRNCGFTART---LYWHCPSCK  375 (389)
T ss_pred             EECCCCCCCCcc---ceeECcCCC
Confidence            445555543222   344555554


No 282
>PF14445 Prok-RING_2:  Prokaryotic RING finger family 2
Probab=35.88  E-value=3.7  Score=17.29  Aligned_cols=12  Identities=17%  Similarity=0.080  Sum_probs=5.9

Q ss_pred             ccccccchhhhc
Q psy12019         17 NKCLINWSAVQQ   28 (87)
Q Consensus        17 ~~c~~c~~~~~~   28 (87)
                      |.|..|..++..
T Consensus         8 y~CDLCn~~~p~   19 (57)
T PF14445_consen    8 YSCDLCNSSHPI   19 (57)
T ss_pred             HhHHhhcccCcH
Confidence            445555555443


No 283
>PRK08222 hydrogenase 4 subunit H; Validated
Probab=35.87  E-value=28  Score=18.73  Aligned_cols=17  Identities=12%  Similarity=0.413  Sum_probs=13.4

Q ss_pred             ccCCCCCcccccchHHH
Q psy12019         63 YQCPQCPYRAKQNAHLT   79 (87)
Q Consensus        63 ~~c~~c~~~f~~~~~l~   79 (87)
                      ..|..||+.|.....+.
T Consensus       115 ~~C~~Cg~~f~~~k~i~  131 (181)
T PRK08222        115 QRCSRCERPFAPQKTVA  131 (181)
T ss_pred             CcCcccCCccCcHhHHH
Confidence            88999999998665543


No 284
>cd01413 SIR2_Af2 SIR2_Af2: Archaeal and prokaryotic group which includes Archaeoglobus fulgidus Sir2-Af2, Sulfolobus solfataricus ssSir2, and several bacterial homologs; and are members of the SIR2 family of proteins, silent information regulator 2 (Sir2) enzymes which catalyze NAD+-dependent protein/histone deacetylation. Sir2 proteins have been shown to regulate gene silencing, DNA repair, metabolic enzymes, and life span. The Sir2 homolog from the archaea Sulfolobus solftaricus deacetylates the non-specific DNA protein Alba to mediate transcription repression.
Probab=35.85  E-value=42  Score=18.68  Aligned_cols=32  Identities=28%  Similarity=0.521  Sum_probs=17.4

Q ss_pred             ceecCcccccccchhhHHHHhhhhcCCCCCccCCCCCc
Q psy12019         33 MFMCDVCGKGYKYKNGIYRHKKFECGQEPKYQCPQCPY   70 (87)
Q Consensus        33 ~~~c~~c~~~~~~~~~~~~h~~~~~~~~~~~~c~~c~~   70 (87)
                      ...|..|++.+.....    ...... .. -.|+.|+.
T Consensus       113 ~~~C~~C~~~~~~~~~----~~~~~~-~~-p~C~~Cgg  144 (222)
T cd01413         113 TAYCVNCGSKYDLEEV----KYAKKH-EV-PRCPKCGG  144 (222)
T ss_pred             cceECCCCCCcchhHH----HHhccC-CC-CcCCCCCC
Confidence            3568888877655432    111112 22 36888874


No 285
>COG1656 Uncharacterized conserved protein [Function unknown]
Probab=35.70  E-value=28  Score=18.71  Aligned_cols=18  Identities=28%  Similarity=0.695  Sum_probs=14.1

Q ss_pred             ccCCCCCcccccchHHHh
Q psy12019         63 YQCPQCPYRAKQNAHLTT   80 (87)
Q Consensus        63 ~~c~~c~~~f~~~~~l~~   80 (87)
                      +.|+.||+.|---++...
T Consensus       131 ~~C~~CgkiYW~GsHw~~  148 (165)
T COG1656         131 YRCPKCGKIYWKGSHWRR  148 (165)
T ss_pred             eECCCCcccccCchHHHH
Confidence            779999999887766544


No 286
>TIGR03826 YvyF flagellar operon protein TIGR03826. This gene is found in flagellar operons of Bacillus-related organisms. Its function has not been determined and an official gene symbol has not been assigned, although the gene is designated yvyF in B. subtilus. A tentative assignment as a regulator is suggested in the NCBI record GI:16080597.
Probab=35.66  E-value=14  Score=19.10  Aligned_cols=23  Identities=17%  Similarity=0.313  Sum_probs=16.4

Q ss_pred             ccccccchhhhccCCcceecCcccc
Q psy12019         17 NKCLINWSAVQQNHAGMFMCDVCGK   41 (87)
Q Consensus        17 ~~c~~c~~~~~~~~~~~~~c~~c~~   41 (87)
                      -.|+.|++.|...  ....|+.|.+
T Consensus         4 ~nC~~CgklF~~~--~~~iCp~C~~   26 (137)
T TIGR03826         4 ANCPKCGRLFVKT--GRDVCPSCYE   26 (137)
T ss_pred             ccccccchhhhhc--CCccCHHHhH
Confidence            3688999999874  2345888774


No 287
>KOG3214|consensus
Probab=35.27  E-value=21  Score=17.44  Aligned_cols=12  Identities=17%  Similarity=0.767  Sum_probs=6.4

Q ss_pred             eecCcccccccc
Q psy12019         34 FMCDVCGKGYKY   45 (87)
Q Consensus        34 ~~c~~c~~~~~~   45 (87)
                      ..|..|+.+|..
T Consensus        48 ~sC~iC~esFqt   59 (109)
T KOG3214|consen   48 ASCRICEESFQT   59 (109)
T ss_pred             eeeeehhhhhcc
Confidence            345556555544


No 288
>PF06689 zf-C4_ClpX:  ClpX C4-type zinc finger;  InterPro: IPR010603 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The ClpX heat shock protein of Escherichia coli is a member of the universally conserved Hsp100 family of proteins, and possesses a putative zinc finger motif of the C4 type []. This presumed zinc binding domain (ZBD) is found at the N terminus of the ClpX protein. ClpX is an ATPase which functions both as a substrate specificity component of the ClpXP protease and as a molecular chaperone. ZBD is a member of the treble clef zinc finger family, a motif known to facilitate protein-ligand, protein-DNA, and protein-protein interactions and forms a constitutive dimer that is essential for the degradation of some, but not all, ClpX substrates []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0016887 ATPase activity, 0046983 protein dimerization activity, 0006200 ATP catabolic process, 0019538 protein metabolic process; PDB: 2DS8_B 2DS6_B 2DS5_A 1OVX_A 2DS7_A.
Probab=35.00  E-value=9.7  Score=15.10  Aligned_cols=10  Identities=10%  Similarity=0.192  Sum_probs=3.4

Q ss_pred             cccccchhhh
Q psy12019         18 KCLINWSAVQ   27 (87)
Q Consensus        18 ~c~~c~~~~~   27 (87)
                      .|+.|++.-.
T Consensus         3 ~CSFCgr~~~   12 (41)
T PF06689_consen    3 RCSFCGRPES   12 (41)
T ss_dssp             B-TTT--BTT
T ss_pred             CccCCCCCHH
Confidence            3555555543


No 289
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only]
Probab=34.99  E-value=46  Score=20.37  Aligned_cols=51  Identities=20%  Similarity=0.319  Sum_probs=29.4

Q ss_pred             ecCcccccccchhhHHHHhhhhcCCCCCccCCCCC----cccccchHHHhhhhhcCC
Q psy12019         35 MCDVCGKGYKYKNGIYRHKKFECGQEPKYQCPQCP----YRAKQNAHLTTHMAIKHY   87 (87)
Q Consensus        35 ~c~~c~~~~~~~~~~~~h~~~~~~~~~~~~c~~c~----~~f~~~~~l~~h~~~~h~   87 (87)
                      .|..|...|.....|..|.+.... +- +-|..-+    .-|....+|-.|-+--||
T Consensus       222 ~C~FC~~~FYdDDEL~~HcR~~HE-~C-hICD~v~p~~~QYFK~Y~~Le~HF~~~hy  276 (493)
T COG5236         222 LCIFCKIYFYDDDELRRHCRLRHE-AC-HICDMVGPIRYQYFKSYEDLEAHFRNAHY  276 (493)
T ss_pred             hhhhccceecChHHHHHHHHhhhh-hh-hhhhccCccchhhhhCHHHHHHHhhcCce
Confidence            477777777777777777775332 33 3333222    235555666666655554


No 290
>COG3091 SprT Zn-dependent metalloprotease, SprT family [General function prediction only]
Probab=34.42  E-value=20  Score=18.98  Aligned_cols=34  Identities=26%  Similarity=0.672  Sum_probs=21.6

Q ss_pred             ceecCcccccccchhhHHHHhhhhcCCCCCccCCCCCccc
Q psy12019         33 MFMCDVCGKGYKYKNGIYRHKKFECGQEPKYQCPQCPYRA   72 (87)
Q Consensus        33 ~~~c~~c~~~~~~~~~~~~h~~~~~~~~~~~~c~~c~~~f   72 (87)
                      +|.|. |+..+...   ..|-..-.|+ . |.|..|+-.+
T Consensus       117 ~Y~C~-C~q~~l~~---RRhn~~~~g~-~-YrC~~C~gkL  150 (156)
T COG3091         117 PYRCQ-CQQHYLRI---RRHNTVRRGE-V-YRCGKCGGKL  150 (156)
T ss_pred             eEEee-cCCccchh---hhcccccccc-e-EEeccCCceE
Confidence            68898 98775443   2333444554 5 8998887543


No 291
>PTZ00043 cytochrome c oxidase subunit; Provisional
Probab=34.40  E-value=20  Score=20.37  Aligned_cols=16  Identities=6%  Similarity=-0.276  Sum_probs=12.7

Q ss_pred             CCcccccccchhhhcc
Q psy12019         14 PKHNKCLINWSAVQQN   29 (87)
Q Consensus        14 ~~~~~c~~c~~~~~~~   29 (87)
                      .++.+|.+|+..|.-.
T Consensus       179 GkpqRCpECGqVFKLV  194 (268)
T PTZ00043        179 GFLYRCGECDQIFMLV  194 (268)
T ss_pred             CCCccCCCCCcEEEEE
Confidence            3488999999998753


No 292
>KOG2923|consensus
Probab=34.21  E-value=28  Score=15.51  Aligned_cols=7  Identities=43%  Similarity=1.450  Sum_probs=3.2

Q ss_pred             ccCCCCC
Q psy12019         63 YQCPQCP   69 (87)
Q Consensus        63 ~~c~~c~   69 (87)
                      -.|+.|.
T Consensus        45 a~CpsCS   51 (67)
T KOG2923|consen   45 ARCPSCS   51 (67)
T ss_pred             ecCCCce
Confidence            4444443


No 293
>PF15227 zf-C3HC4_4:  zinc finger of C3HC4-type, RING; PDB: 2EGP_A 2ECV_A 2ECJ_A 2YSL_A 2YSJ_A.
Probab=34.09  E-value=24  Score=13.90  Aligned_cols=10  Identities=20%  Similarity=0.537  Sum_probs=5.0

Q ss_pred             cccccccchh
Q psy12019         38 VCGKGYKYKN   47 (87)
Q Consensus        38 ~c~~~~~~~~   47 (87)
                      .||-.|-..-
T Consensus        15 ~CGH~FC~~C   24 (42)
T PF15227_consen   15 PCGHSFCRSC   24 (42)
T ss_dssp             SSSSEEEHHH
T ss_pred             CCcCHHHHHH
Confidence            4555554443


No 294
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism]
Probab=33.98  E-value=25  Score=21.37  Aligned_cols=9  Identities=11%  Similarity=0.017  Sum_probs=4.3

Q ss_pred             cccccccch
Q psy12019         16 HNKCLINWS   24 (87)
Q Consensus        16 ~~~c~~c~~   24 (87)
                      .|.|..|+-
T Consensus       354 ~YRC~~CGF  362 (389)
T COG2956         354 RYRCQNCGF  362 (389)
T ss_pred             CceecccCC
Confidence            355555543


No 295
>COG1379 PHP family phosphoesterase with a Zn ribbon [General function prediction only]
Probab=33.93  E-value=12  Score=22.56  Aligned_cols=28  Identities=18%  Similarity=0.369  Sum_probs=17.0

Q ss_pred             cccccchhhhccC--CcceecCcccccccc
Q psy12019         18 KCLINWSAVQQNH--AGMFMCDVCGKGYKY   45 (87)
Q Consensus        18 ~c~~c~~~~~~~~--~~~~~c~~c~~~~~~   45 (87)
                      .|..|...|+-..  ...|.|+.||..+..
T Consensus       248 AC~rC~t~y~le~A~~~~wrCpkCGg~ikK  277 (403)
T COG1379         248 ACSRCYTRYSLEEAKSLRWRCPKCGGKIKK  277 (403)
T ss_pred             HHHHhhhccCcchhhhhcccCcccccchhh
Confidence            4666666665542  224788888875544


No 296
>PF00412 LIM:  LIM domain;  InterPro: IPR001781 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents LIM-type zinc finger (Znf) domains. LIM domains coordinate one or more zinc atoms, and are named after the three proteins (LIN-11, Isl1 and MEC-3) in which they were first found. They consist of two zinc-binding motifs that resemble GATA-like Znf's, however the residues holding the zinc atom(s) are variable, involving Cys, His, Asp or Glu residues. LIM domains are involved in proteins with differing functions, including gene expression, and cytoskeleton organisation and development [, ]. Protein containing LIM Znf domains include:    Caenorhabditis elegans mec-3; a protein required for the differentiation of the set of six touch receptor neurons in this nematode. C. elegans. lin-11; a protein required for the asymmetric division of vulval blast cells. Vertebrate insulin gene enhancer binding protein isl-1. Isl-1 binds to one of the two cis-acting protein-binding domains of the insulin gene. Vertebrate homeobox proteins lim-1, lim-2 (lim-5) and lim3. Vertebrate lmx-1, which acts as a transcriptional activator by binding to the FLAT element; a beta-cell-specific transcriptional enhancer found in the insulin gene. Mammalian LH-2, a transcriptional regulatory protein involved in the control of cell differentiation in developing lymphoid and neural cell types.  Drosophila melanogaster (Fruit fly) protein apterous, required for the normal development of the wing and halter imaginal discs. Vertebrate protein kinases LIMK-1 and LIMK-2. Mammalian rhombotins. Rhombotin 1 (RBTN1 or TTG-1) and rhombotin-2 (RBTN2 or TTG-2) are proteins of about 160 amino acids whose genes are disrupted by chromosomal translocations in T-cell leukemia. Mammalian and avian cysteine-rich protein (CRP), a 192 amino-acid protein of unknown function. Seems to interact with zyxin. Mammalian cysteine-rich intestinal protein (CRIP), a small protein which seems to have a role in zinc absorption and may function as an intracellular zinc transport protein. Vertebrate paxillin, a cytoskeletal focal adhesion protein.  Mus musculus (Mouse) testin which should not be confused with rat testin which is a thiol protease homologue (see IPR000169 from INTERPRO).  Helianthus annuus (Common sunflower) pollen specific protein SF3. Chicken zyxin. Zyxin is a low-abundance adhesion plaque protein which has been shown to interact with CRP. Yeast protein LRG1 which is involved in sporulation [].  Saccharomyces cerevisiae (Baker's yeast) rho-type GTPase activating protein RGA1/DBM1. C. elegans homeobox protein ceh-14. C. elegans homeobox protein unc-97. S. cerevisiae hypothetical protein YKR090w. C. elegans hypothetical proteins C28H8.6.   These proteins generally contain two tandem copies of the LIM domain in their N-terminal section. Zyxin and paxillin are exceptions in that they contain respectively three and four LIM domains at their C-terminal extremity. In apterous, isl-1, LH-2, lin-11, lim-1 to lim-3, lmx-1 and ceh-14 and mec-3 there is a homeobox domain some 50 to 95 amino acids after the LIM domains. LIM domains contain seven conserved cysteine residues and a histidine. The arrangement followed by these conserved residues is:  C-x(2)-C-x(16,23)-H-x(2)-[CH]-x(2)-C-x(2)-C-x(16,21)-C-x(2,3)-[CHD]  LIM domains bind two zinc ions []. LIM does not bind DNA, rather it seems to act as an interface for protein-protein interaction. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 2CO8_A 2EGQ_A 2CUR_A 3IXE_B 1CTL_A 1B8T_A 1X62_A 2DFY_C 1IML_A 2CUQ_A ....
Probab=33.63  E-value=4.8  Score=16.72  Aligned_cols=10  Identities=20%  Similarity=0.856  Sum_probs=4.4

Q ss_pred             ccCCCCCccc
Q psy12019         63 YQCPQCPYRA   72 (87)
Q Consensus        63 ~~c~~c~~~f   72 (87)
                      +.|..|++.+
T Consensus        27 f~C~~C~~~l   36 (58)
T PF00412_consen   27 FKCSKCGKPL   36 (58)
T ss_dssp             SBETTTTCBT
T ss_pred             cccCCCCCcc
Confidence            4444444443


No 297
>KOG4215|consensus
Probab=33.62  E-value=17  Score=22.24  Aligned_cols=37  Identities=27%  Similarity=0.461  Sum_probs=21.2

Q ss_pred             ccccccchhhhccCCcceecCcccccccchhhHHHHhh
Q psy12019         17 NKCLINWSAVQQNHAGMFMCDVCGKGYKYKNGIYRHKK   54 (87)
Q Consensus        17 ~~c~~c~~~~~~~~~~~~~c~~c~~~~~~~~~~~~h~~   54 (87)
                      -.|-+|+..-....-+...|+-| |.|...+..+.|+-
T Consensus        20 ~~CaICGDkaTGKHYGA~SCdGC-KGFFRRSVrk~~~Y   56 (432)
T KOG4215|consen   20 EFCAICGDKATGKHYGAISCDGC-KGFFRRSVRKNHQY   56 (432)
T ss_pred             chhheeCCcccccccceeecCcc-hHHHHHHHHhccee
Confidence            45777776543333334567777 46666666665543


No 298
>PRK12387 formate hydrogenlyase complex iron-sulfur subunit; Provisional
Probab=33.07  E-value=28  Score=18.64  Aligned_cols=18  Identities=11%  Similarity=0.255  Sum_probs=13.7

Q ss_pred             CccCCCCCcccccchHHH
Q psy12019         62 KYQCPQCPYRAKQNAHLT   79 (87)
Q Consensus        62 ~~~c~~c~~~f~~~~~l~   79 (87)
                      ++.|..||+.|.....+.
T Consensus       114 ~~~C~~CG~~f~~~~~i~  131 (180)
T PRK12387        114 LCNCRVCGRPFAVQKEID  131 (180)
T ss_pred             cccchhhCCccccHHHHH
Confidence            389999999997665443


No 299
>PRK11088 rrmA 23S rRNA methyltransferase A; Provisional
Probab=32.68  E-value=37  Score=19.38  Aligned_cols=21  Identities=10%  Similarity=0.398  Sum_probs=13.2

Q ss_pred             ccccccchhhhccCCcceecCc
Q psy12019         17 NKCLINWSAVQQNHAGMFMCDV   38 (87)
Q Consensus        17 ~~c~~c~~~~~~~~~~~~~c~~   38 (87)
                      +.|+.|...+.. ....+.|..
T Consensus         3 ~~CP~C~~~l~~-~~~~~~C~~   23 (272)
T PRK11088          3 YQCPLCHQPLTL-EENSWICPQ   23 (272)
T ss_pred             ccCCCCCcchhc-CCCEEEcCC
Confidence            678888887743 233456654


No 300
>PRK12286 rpmF 50S ribosomal protein L32; Reviewed
Probab=32.67  E-value=36  Score=14.68  Aligned_cols=7  Identities=43%  Similarity=1.251  Sum_probs=3.5

Q ss_pred             eecCccc
Q psy12019         34 FMCDVCG   40 (87)
Q Consensus        34 ~~c~~c~   40 (87)
                      ..|..||
T Consensus        41 ~vC~~CG   47 (57)
T PRK12286         41 RVCPSCG   47 (57)
T ss_pred             EECCCCC
Confidence            3455555


No 301
>PF03966 Trm112p:  Trm112p-like protein;  InterPro: IPR005651 This family of short proteins have no known function. The bacterial members are about 60-70 amino acids in length and the eukaryotic examples are about 120 amino acids in length. The C terminus contains the strongest conservation. The function of this family is uncertain. The bacterial members are about 60-70 amino acids in length and the eukaryotic examples are about 120 amino acids in length. The C terminus contains the strongest conservation. The entry contains 2 families:  Trm112, which is required for tRNA methylation in Saccharomyces cerevisiae (Baker's yeast) and is found in complexes with 2 tRNA methylases (TRM9 and TRM11) also with putative methyltransferase YDR140W []. The zinc-finger protein Ynr046w is plurifunctional and a component of the eRF1 methyltransferase in yeast []. The crystal structure of Ynr046w has been determined to 1.7 A resolution. It comprises a zinc-binding domain built from both the N- and C-terminal sequences and an inserted domain, absent from bacterial and archaeal orthologs of the protein, composed of three alpha-helices []. UPF0434, which are proteins that are functionally uncharacterised.  ; PDB: 3Q87_A 2KPI_A 2K5R_A 2HF1_A 2JS4_A 2J6A_A 2JR6_A 2PK7_A 2JNY_A.
Probab=32.55  E-value=17  Score=16.07  Aligned_cols=11  Identities=27%  Similarity=0.745  Sum_probs=7.6

Q ss_pred             ccCCCCCcccc
Q psy12019         63 YQCPQCPYRAK   73 (87)
Q Consensus        63 ~~c~~c~~~f~   73 (87)
                      -.|+.|++.|+
T Consensus        54 L~Cp~c~r~YP   64 (68)
T PF03966_consen   54 LICPECGREYP   64 (68)
T ss_dssp             EEETTTTEEEE
T ss_pred             EEcCCCCCEEe
Confidence            66777777664


No 302
>PF03563 Bunya_G2:  Bunyavirus glycoprotein G2;  InterPro: IPR005168 Bunyavirus has three genomic segments: small (S), middle-sized (M), and large (L). The S segment encodes the nucleocapsid and a non-structural protein. The M segment codes for two glycoproteins, G1 and G2, and another non-structural protein (NSm). The L segment codes for an RNA polymerase. This entry represents the polyprotein region forming the G2 glycoprotein, which interacts with the IPR005167 from INTERPRO G1 glycoprotein [].
Probab=32.04  E-value=46  Score=19.48  Aligned_cols=17  Identities=24%  Similarity=0.653  Sum_probs=11.3

Q ss_pred             cccccccchhhHHHHhh
Q psy12019         38 VCGKGYKYKNGIYRHKK   54 (87)
Q Consensus        38 ~c~~~~~~~~~~~~h~~   54 (87)
                      .||..|....++..|+.
T Consensus       255 vCG~~f~~sd~mk~HR~  271 (285)
T PF03563_consen  255 VCGMKFETSDRMKMHRE  271 (285)
T ss_pred             eccccccchHHHHHHHh
Confidence            37777777777666654


No 303
>KOG0823|consensus
Probab=32.03  E-value=43  Score=19.07  Aligned_cols=46  Identities=15%  Similarity=0.313  Sum_probs=27.3

Q ss_pred             CcccccccchhhhccCCcceecCcccccccchhhHHHHhhhhcCCCCCccCCCCC
Q psy12019         15 KHNKCLINWSAVQQNHAGMFMCDVCGKGYKYKNGIYRHKKFECGQEPKYQCPQCP   69 (87)
Q Consensus        15 ~~~~c~~c~~~~~~~~~~~~~c~~c~~~~~~~~~~~~h~~~~~~~~~~~~c~~c~   69 (87)
                      .-|.|.+|...-+.    | .-..||-.|.+.-..+.- .++.  .. -.|++|.
T Consensus        46 ~~FdCNICLd~akd----P-VvTlCGHLFCWpClyqWl-~~~~--~~-~~cPVCK   91 (230)
T KOG0823|consen   46 GFFDCNICLDLAKD----P-VVTLCGHLFCWPCLYQWL-QTRP--NS-KECPVCK   91 (230)
T ss_pred             CceeeeeeccccCC----C-EEeecccceehHHHHHHH-hhcC--CC-eeCCccc
Confidence            45788888776433    3 345688888888754433 3222  22 4667774


No 304
>PF11494 Ta0938:  Ta0938;  InterPro: IPR021585  Ta0938 is a protein of unknown function however the structure has been determined. The protein has a novel fold and a putative Zn-binding motif. The structure has two different parts, one region contains a beta sheet flanked by two alpha helices and the other contains a bundle of loops which contain all cysteines in the protein. ; PDB: 2FQH_A.
Probab=31.40  E-value=35  Score=16.60  Aligned_cols=35  Identities=23%  Similarity=0.405  Sum_probs=14.0

Q ss_pred             CCCCcccccccchhhhcc-----CCc-ceecCcccccccch
Q psy12019         12 REPKHNKCLINWSAVQQN-----HAG-MFMCDVCGKGYKYK   46 (87)
Q Consensus        12 ~~~~~~~c~~c~~~~~~~-----~~~-~~~c~~c~~~~~~~   46 (87)
                      ++.+.-.|..|+.+...-     +.+ -|-|+.|.+-|...
T Consensus        10 ag~ke~~CalCG~tWg~~y~Ev~G~rLfFCCd~ca~EF~nm   50 (105)
T PF11494_consen   10 AGTKEMGCALCGATWGDYYEEVDGERLFFCCDDCAKEFKNM   50 (105)
T ss_dssp             --SGGGS-SS---S---SS-B-TT--BSSS--SSSS-TTS-
T ss_pred             cccccccccccCCcHHHHHHhhcCCEEEEEcHHHHHHHHHH
Confidence            455667888888887643     333 46688888877664


No 305
>KOG2164|consensus
Probab=31.16  E-value=67  Score=20.71  Aligned_cols=50  Identities=16%  Similarity=0.212  Sum_probs=29.8

Q ss_pred             cccccccchhhhccCCcceecCcccccccchhhHHHHhhhhcCCCCCccCCCCCccc
Q psy12019         16 HNKCLINWSAVQQNHAGMFMCDVCGKGYKYKNGIYRHKKFECGQEPKYQCPQCPYRA   72 (87)
Q Consensus        16 ~~~c~~c~~~~~~~~~~~~~c~~c~~~~~~~~~~~~h~~~~~~~~~~~~c~~c~~~f   72 (87)
                      ++.|++|.....-.    - -..||-.|.....|+-.... .-..+ ..|+.|...+
T Consensus       186 ~~~CPICL~~~~~p----~-~t~CGHiFC~~CiLqy~~~s-~~~~~-~~CPiC~s~I  235 (513)
T KOG2164|consen  186 DMQCPICLEPPSVP----V-RTNCGHIFCGPCILQYWNYS-AIKGP-CSCPICRSTI  235 (513)
T ss_pred             CCcCCcccCCCCcc----c-ccccCceeeHHHHHHHHhhh-cccCC-ccCCchhhhc
Confidence            67788887553322    1 12388888887766543332 23344 7888887654


No 306
>PRK01343 zinc-binding protein; Provisional
Probab=31.13  E-value=28  Score=15.14  Aligned_cols=12  Identities=25%  Similarity=0.750  Sum_probs=9.2

Q ss_pred             CccCCCCCcccc
Q psy12019         62 KYQCPQCPYRAK   73 (87)
Q Consensus        62 ~~~c~~c~~~f~   73 (87)
                      ...|+.|++.+.
T Consensus         9 ~~~CP~C~k~~~   20 (57)
T PRK01343          9 TRPCPECGKPST   20 (57)
T ss_pred             CCcCCCCCCcCc
Confidence            367999998764


No 307
>PLN02748 tRNA dimethylallyltransferase
Probab=31.03  E-value=44  Score=21.19  Aligned_cols=23  Identities=17%  Similarity=0.388  Sum_probs=17.9

Q ss_pred             CCCccCCCCCc-ccccchHHHhhhh
Q psy12019         60 EPKYQCPQCPY-RAKQNAHLTTHMA   83 (87)
Q Consensus        60 ~~~~~c~~c~~-~f~~~~~l~~h~~   83 (87)
                      +. |.|..|++ .+........|++
T Consensus       417 ~~-~~Ce~C~~~~~~G~~eW~~Hlk  440 (468)
T PLN02748        417 TQ-YVCEACGNKVLRGAHEWEQHKQ  440 (468)
T ss_pred             cc-ccccCCCCcccCCHHHHHHHhc
Confidence            45 78999997 7888877777764


No 308
>TIGR03844 cysteate_syn cysteate synthase. Members of this family are cysteate synthase, an enzyme of alternate pathway to sulfopyruvate, a precursor of coenzyme M.
Probab=30.55  E-value=28  Score=21.38  Aligned_cols=22  Identities=9%  Similarity=0.082  Sum_probs=14.7

Q ss_pred             ccccccchhhhccCCcceecCccc
Q psy12019         17 NKCLINWSAVQQNHAGMFMCDVCG   40 (87)
Q Consensus        17 ~~c~~c~~~~~~~~~~~~~c~~c~   40 (87)
                      +.|..|++.+. . ...+.|+.|+
T Consensus         3 l~C~~Cg~~~~-~-~~~~~C~~c~   24 (398)
T TIGR03844         3 LRCPGCGEVLP-D-HYTLSCPLDC   24 (398)
T ss_pred             EEeCCCCCccC-C-ccccCCCCCC
Confidence            56888888875 2 2356777665


No 309
>PF14369 zf-RING_3:  zinc-finger
Probab=30.37  E-value=29  Score=13.23  Aligned_cols=10  Identities=30%  Similarity=0.727  Sum_probs=6.8

Q ss_pred             cCCCCCcccc
Q psy12019         64 QCPQCPYRAK   73 (87)
Q Consensus        64 ~c~~c~~~f~   73 (87)
                      .|+.|+..|.
T Consensus        23 ~CP~C~~gFv   32 (35)
T PF14369_consen   23 ACPRCHGGFV   32 (35)
T ss_pred             CCcCCCCcEe
Confidence            4777776664


No 310
>PF09855 DUF2082:  Nucleic-acid-binding protein containing Zn-ribbon domain (DUF2082);  InterPro: IPR018652  This family of proteins contains various hypothetical prokaryotic proteins as well as some Zn-ribbon nucleic-acid-binding proteins.
Probab=30.08  E-value=30  Score=15.37  Aligned_cols=7  Identities=57%  Similarity=1.891  Sum_probs=3.6

Q ss_pred             ccCCCCC
Q psy12019         63 YQCPQCP   69 (87)
Q Consensus        63 ~~c~~c~   69 (87)
                      |.|+.||
T Consensus         1 y~C~KCg    7 (64)
T PF09855_consen    1 YKCPKCG    7 (64)
T ss_pred             CCCCCCC
Confidence            3455555


No 311
>PF09889 DUF2116:  Uncharacterized protein containing a Zn-ribbon (DUF2116);  InterPro: IPR019216 This entry contains various hypothetical prokaryotic proteins whose functions are unknown. They contain a conserved zinc ribbon motif in the N-terminal part and a predicted transmembrane segment in the C-terminal part.
Probab=30.00  E-value=32  Score=15.05  Aligned_cols=6  Identities=17%  Similarity=0.368  Sum_probs=2.6

Q ss_pred             ccccch
Q psy12019         19 CLINWS   24 (87)
Q Consensus        19 c~~c~~   24 (87)
                      |..|+.
T Consensus         6 C~~CG~   11 (59)
T PF09889_consen    6 CPVCGK   11 (59)
T ss_pred             CCcCCC
Confidence            444443


No 312
>PTZ00448 hypothetical protein; Provisional
Probab=30.00  E-value=42  Score=20.61  Aligned_cols=21  Identities=14%  Similarity=0.439  Sum_probs=16.7

Q ss_pred             ccCCCCCcccccchHHHhhhh
Q psy12019         63 YQCPQCPYRAKQNAHLTTHMA   83 (87)
Q Consensus        63 ~~c~~c~~~f~~~~~l~~h~~   83 (87)
                      +.|..|+-.|........|.+
T Consensus       315 ~tC~~C~v~F~~~~~qR~H~K  335 (373)
T PTZ00448        315 LLCRKCNIQLMDHNAFKQHYR  335 (373)
T ss_pred             ccccccccccCCHHHHHHHhh
Confidence            789999999977776677765


No 313
>PF09862 DUF2089:  Protein of unknown function (DUF2089);  InterPro: IPR018658  This family consists of various hypothetical prokaryotic proteins. 
Probab=29.98  E-value=30  Score=17.30  Aligned_cols=8  Identities=38%  Similarity=1.190  Sum_probs=4.0

Q ss_pred             eecCcccc
Q psy12019         34 FMCDVCGK   41 (87)
Q Consensus        34 ~~c~~c~~   41 (87)
                      +.|+.|+-
T Consensus        13 l~C~~C~t   20 (113)
T PF09862_consen   13 LKCPSCGT   20 (113)
T ss_pred             EEcCCCCC
Confidence            44555553


No 314
>KOG1409|consensus
Probab=29.77  E-value=14  Score=22.41  Aligned_cols=41  Identities=12%  Similarity=0.280  Sum_probs=26.4

Q ss_pred             ceecCcccccccchhhHHHHhhhhcCCCCCccCCCCCcccccc
Q psy12019         33 MFMCDVCGKGYKYKNGIYRHKKFECGQEPKYQCPQCPYRAKQN   75 (87)
Q Consensus        33 ~~~c~~c~~~~~~~~~~~~h~~~~~~~~~~~~c~~c~~~f~~~   75 (87)
                      .+.|+.|...|.++.. ..+.+.-.|-+. .-|..||+++...
T Consensus       282 s~~cQ~c~qpffwn~~-~m~~~k~~glr~-h~crkcg~avc~~  322 (404)
T KOG1409|consen  282 SDSCQKCNQPFFWNFR-QMWDRKQLGLRQ-HHCRKCGKAVCGK  322 (404)
T ss_pred             cchhhhhCchHHHHHH-HHHhhhhhhhhh-hhhhhhhhhcCcc
Confidence            3568888888766653 445555556565 7777777776543


No 315
>KOG1088|consensus
Probab=29.27  E-value=26  Score=17.69  Aligned_cols=18  Identities=11%  Similarity=0.135  Sum_probs=12.6

Q ss_pred             hcCCCCCccCCCCCccccc
Q psy12019         56 ECGQEPKYQCPQCPYRAKQ   74 (87)
Q Consensus        56 ~~~~~~~~~c~~c~~~f~~   74 (87)
                      +..+.. -.|++||+.|+=
T Consensus        93 ~v~EG~-l~CpetG~vfpI  110 (124)
T KOG1088|consen   93 DVIEGE-LVCPETGRVFPI  110 (124)
T ss_pred             hhccce-EecCCCCcEeec
Confidence            334444 789999998863


No 316
>COG1439 Predicted nucleic acid-binding protein, consists of a PIN domain and a Zn-ribbon module [General function prediction only]
Probab=29.15  E-value=26  Score=19.07  Aligned_cols=13  Identities=15%  Similarity=0.419  Sum_probs=7.8

Q ss_pred             cceecCccccccc
Q psy12019         32 GMFMCDVCGKGYK   44 (87)
Q Consensus        32 ~~~~c~~c~~~~~   44 (87)
                      +.+.|.-|++.|.
T Consensus       138 w~~rC~GC~~~f~  150 (177)
T COG1439         138 WRLRCHGCKRIFP  150 (177)
T ss_pred             eeEEEecCceecC
Confidence            3456666766664


No 317
>TIGR00319 desulf_FeS4 desulfoferrodoxin FeS4 iron-binding domain. Neelaredoxin, a monomeric blue non-heme iron protein, lacks this domain.
Probab=28.92  E-value=31  Score=12.81  Aligned_cols=11  Identities=36%  Similarity=1.096  Sum_probs=7.4

Q ss_pred             ceecCcccccc
Q psy12019         33 MFMCDVCGKGY   43 (87)
Q Consensus        33 ~~~c~~c~~~~   43 (87)
                      -|.|..||..+
T Consensus         7 ~ykC~~Cgniv   17 (34)
T TIGR00319         7 VYKCEVCGNIV   17 (34)
T ss_pred             EEEcCCCCcEE
Confidence            46777777654


No 318
>cd00974 DSRD Desulforedoxin (DSRD) domain; a small non-heme iron domain present in the desulforedoxin (rubredoxin oxidoreductase) and desulfoferrodoxin proteins of some archeael and bacterial methanogens and sulfate/sulfur reducers. Desulforedoxin is a small, single-domain homodimeric protein; each subunit contains an iron atom bound to four cysteinyl sulfur atoms, Fe(S-Cys)4, in a distorted tetrahedral coordination. Its metal center is similar to that found in rubredoxin type proteins. Desulforedoxin is regarded as a potential redox partner for rubredoxin. Desulfoferrodoxin forms a homodimeric protein, with each protomer comprised of two domains, the N-terminal DSRD domain and C-terminal superoxide reductase-like (SORL) domain. Each domain has a distinct iron center: the DSRD iron center I, Fe(S-Cys)4; and the SORL iron center II, Fe[His4Cys(Glu)].
Probab=28.76  E-value=31  Score=12.83  Aligned_cols=11  Identities=27%  Similarity=1.087  Sum_probs=7.3

Q ss_pred             ceecCcccccc
Q psy12019         33 MFMCDVCGKGY   43 (87)
Q Consensus        33 ~~~c~~c~~~~   43 (87)
                      -|.|..||...
T Consensus         4 ~ykC~~CGniv   14 (34)
T cd00974           4 VYKCEICGNIV   14 (34)
T ss_pred             EEEcCCCCcEE
Confidence            46777777654


No 319
>TIGR03829 YokU_near_AblA uncharacterized protein, YokU family. Members of this protein family occur in various species of the genus Bacillus, always next to the gene (kamA or ablA) for lysine 2,3-aminomutase. Members have a pair of CXXC motifs, and share homology to the amino-terminal region of a family of putative transcription factors for which the C-terminal is modeled by pfam01381, a helix-turn-helix domain model. This family, however, is shorter and lacks the helix-turn-helix region. The function of this protein family is unknown, but a regulatory role in compatible solute biosynthesis is suggested by local genome context.
Probab=28.65  E-value=40  Score=16.12  Aligned_cols=21  Identities=19%  Similarity=0.521  Sum_probs=15.3

Q ss_pred             eecCcccccccchhhHHHHhh
Q psy12019         34 FMCDVCGKGYKYKNGIYRHKK   54 (87)
Q Consensus        34 ~~c~~c~~~~~~~~~~~~h~~   54 (87)
                      ..|+.||..+........-.+
T Consensus        36 ~~C~~CGe~y~~dev~~eIE~   56 (89)
T TIGR03829        36 ISCSHCGMEYQDDTTVKEIED   56 (89)
T ss_pred             ccccCCCcEeecHHHHHHHHh
Confidence            579999999888776554333


No 320
>KOG3352|consensus
Probab=28.60  E-value=36  Score=18.04  Aligned_cols=19  Identities=37%  Similarity=0.625  Sum_probs=12.7

Q ss_pred             hhhhcCCCCCccCCCCCcccc
Q psy12019         53 KKFECGQEPKYQCPQCPYRAK   73 (87)
Q Consensus        53 ~~~~~~~~~~~~c~~c~~~f~   73 (87)
                      +-.+.+ +. ..|++||.-|.
T Consensus       126 mwl~Kg-e~-~rc~eCG~~fk  144 (153)
T KOG3352|consen  126 MWLEKG-ET-QRCPECGHYFK  144 (153)
T ss_pred             EEEEcC-Cc-ccCCcccceEE
Confidence            344555 44 68999998775


No 321
>cd01407 SIR2-fam SIR2 family of proteins includes silent information regulator 2 (Sir2) enzymes which catalyze NAD+-dependent protein/histone deacetylation, where the acetyl group from the lysine epsilon-amino group is transferred to the ADP-ribose moiety of NAD+, producing nicotinamide and the novel metabolite O-acetyl-ADP-ribose. Sir2 proteins, also known as sirtuins, are found in all eukaryotes and many archaea and prokaryotes and have been shown to regulate gene silencing, DNA repair, metabolic enzymes, and life span. The most-studied function, gene silencing, involves the inactivation of chromosome domains containing key regulatory genes by packaging them into a specialized chromatin structure that is inaccessible to DNA-binding proteins. The oligomerization state of Sir2 appears to be organism-dependent, sometimes occurring as a monomer and sometimes as a multimer.
Probab=28.04  E-value=82  Score=17.44  Aligned_cols=34  Identities=26%  Similarity=0.518  Sum_probs=17.7

Q ss_pred             ceecCcccccccchhhHHHHhhhhcCCCCCccCCCCCcc
Q psy12019         33 MFMCDVCGKGYKYKNGIYRHKKFECGQEPKYQCPQCPYR   71 (87)
Q Consensus        33 ~~~c~~c~~~~~~~~~~~~h~~~~~~~~~~~~c~~c~~~   71 (87)
                      ...|..|++.+......   ...... .. -.|+.|+..
T Consensus       109 ~~~C~~C~~~~~~~~~~---~~~~~~-~~-p~C~~Cg~~  142 (218)
T cd01407         109 RVRCTKCGKEYPRDELQ---ADIDRE-EV-PRCPKCGGL  142 (218)
T ss_pred             cceeCCCcCCCcHHHHh---HhhccC-CC-CcCCCCCCc
Confidence            35688888776544321   111112 22 368888754


No 322
>PF10080 DUF2318:  Predicted membrane protein (DUF2318);  InterPro: IPR018758 This domain of unknown function is found in hypothetical bacterial membrane proteins with no known function. 
Probab=27.94  E-value=27  Score=17.08  Aligned_cols=30  Identities=17%  Similarity=0.391  Sum_probs=16.8

Q ss_pred             cccccchhhhccCCcceecCcccccccchh
Q psy12019         18 KCLINWSAVQQNHAGMFMCDVCGKGYKYKN   47 (87)
Q Consensus        18 ~c~~c~~~~~~~~~~~~~c~~c~~~~~~~~   47 (87)
                      .|..|+..--........|..|+..|...+
T Consensus        37 aCeiC~~~GY~q~g~~lvC~~C~~~~~~~~   66 (102)
T PF10080_consen   37 ACEICGPKGYYQEGDQLVCKNCGVRFNLPT   66 (102)
T ss_pred             eccccCCCceEEECCEEEEecCCCEEehhh
Confidence            466674332122333467888888775544


No 323
>PF02148 zf-UBP:  Zn-finger in ubiquitin-hydrolases and other protein;  InterPro: IPR001607 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents UBP-type zinc finger domains, which display some similarity with the Zn-binding domain of the insulinase family. The UBP-type zinc finger domain is found only in a small subfamily of ubiquitin C-terminal hydrolases (deubiquitinases or UBP) [, ], All members of this subfamily are isopeptidase-T, which are known to cleave isopeptide bonds between ubiquitin moieties. Some of the proteins containing an UBP zinc finger include:    Homo sapiens (Human) deubiquitinating enzyme 13 (UBPD) Human deubiquitinating enzyme 5 (UBP5)  Dictyostelium discoideum (Slime mold) deubiquitinating enzyme A (UBPA)  Saccharomyces cerevisiae (Baker's yeast) deubiquitinating enzyme 8 (UBP8) Yeast deubiquitinating enzyme 14 (UBP14)   More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 3GV4_A 3PHD_B 3C5K_A 2UZG_A 3IHP_B 2G43_B 2G45_D 2I50_A 3MHH_A 3MHS_A ....
Probab=27.23  E-value=33  Score=14.80  Aligned_cols=16  Identities=19%  Similarity=0.476  Sum_probs=10.2

Q ss_pred             CcceecCcccccccch
Q psy12019         31 AGMFMCDVCGKGYKYK   46 (87)
Q Consensus        31 ~~~~~c~~c~~~~~~~   46 (87)
                      ...|.|..||..+-..
T Consensus         9 ~~lw~CL~Cg~~~C~~   24 (63)
T PF02148_consen    9 SNLWLCLTCGYVGCGR   24 (63)
T ss_dssp             SSEEEETTTS-EEETT
T ss_pred             CceEEeCCCCcccccC
Confidence            3467888888766554


No 324
>cd01675 RNR_III Class III ribonucleotide reductase. Ribonucleotide reductase (RNR) catalyzes the reductive synthesis of deoxyribonucleotides from their corresponding ribonucleotides. It provides the precursors necessary for DNA synthesis. RNRs are separated into three classes based on their metallocofactor usage. Class I RNRs, found in eukaryotes, bacteria, and bacteriophage, use a diiron-tyrosyl radical. Class II RNRs, found in bacteria, bacteriophage, algae and archaea, use coenzyme B12 (adenosylcobalamin, AdoCbl). Class III RNRs, found in strict or facultative anaerobic bacteria, bacteriophage, and archaea, use an FeS cluster and S-adenosylmethionine to generate a glycyl radical. Many organisms have more than one class of RNR present in their genomes. All three RNRs have a ten-stranded alpha-beta barrel domain that is structurally similar to the domain of PFL (pyruvate formate lyase). The class III enzyme from phage T4 consists of two subunits, this model covers the larger subunit w
Probab=27.19  E-value=43  Score=21.64  Aligned_cols=9  Identities=33%  Similarity=1.316  Sum_probs=6.4

Q ss_pred             ccCCCCCcc
Q psy12019         63 YQCPQCPYR   71 (87)
Q Consensus        63 ~~c~~c~~~   71 (87)
                      +.|+.||..
T Consensus       533 ~~CP~CGs~  541 (555)
T cd01675         533 FKCPKCGSE  541 (555)
T ss_pred             CCCcCCCCc
Confidence            778888743


No 325
>KOG0801|consensus
Probab=26.99  E-value=18  Score=19.42  Aligned_cols=11  Identities=27%  Similarity=0.748  Sum_probs=8.2

Q ss_pred             ccCCCCCcccc
Q psy12019         63 YQCPQCPYRAK   73 (87)
Q Consensus        63 ~~c~~c~~~f~   73 (87)
                      ++|++|.|...
T Consensus       139 ~KCPvC~K~V~  149 (205)
T KOG0801|consen  139 MKCPVCHKVVP  149 (205)
T ss_pred             ccCCccccccC
Confidence            78888887654


No 326
>COG0777 AccD Acetyl-CoA carboxylase beta subunit [Lipid metabolism]
Probab=26.92  E-value=22  Score=20.82  Aligned_cols=31  Identities=16%  Similarity=0.412  Sum_probs=17.8

Q ss_pred             ccccccchhhhcc--CCcceecCcccccccchh
Q psy12019         17 NKCLINWSAVQQN--HAGMFMCDVCGKGYKYKN   47 (87)
Q Consensus        17 ~~c~~c~~~~~~~--~~~~~~c~~c~~~~~~~~   47 (87)
                      .+|+.|+...-..  ....+.|+.|+..+.-..
T Consensus        29 ~KCp~c~~~~y~~eL~~n~~vcp~c~~h~ri~A   61 (294)
T COG0777          29 TKCPSCGEMLYRKELESNLKVCPKCGHHMRISA   61 (294)
T ss_pred             eECCCccceeeHHHHHhhhhcccccCcccccCH
Confidence            3677777664332  334567777776555443


No 327
>COG5533 UBP5 Ubiquitin C-terminal hydrolase [Posttranslational modification, protein turnover, chaperones]
Probab=26.76  E-value=27  Score=21.02  Aligned_cols=10  Identities=10%  Similarity=-0.041  Sum_probs=5.9

Q ss_pred             ccccccchhh
Q psy12019         17 NKCLINWSAV   26 (87)
Q Consensus        17 ~~c~~c~~~~   26 (87)
                      ..|..|+.+.
T Consensus       236 lqC~~C~~TS  245 (415)
T COG5533         236 LQCEACNYTS  245 (415)
T ss_pred             hhhhhcCCce
Confidence            3566666654


No 328
>PLN03238 probable histone acetyltransferase MYST; Provisional
Probab=26.65  E-value=97  Score=18.44  Aligned_cols=27  Identities=22%  Similarity=0.440  Sum_probs=22.1

Q ss_pred             CcceecCcccccccchhhHHHHhhhhc
Q psy12019         31 AGMFMCDVCGKGYKYKNGIYRHKKFEC   57 (87)
Q Consensus        31 ~~~~~c~~c~~~~~~~~~~~~h~~~~~   57 (87)
                      ...|.|..|-+-|.....+..|+..-.
T Consensus        46 ~~lyiCe~Clky~~~~~~l~~H~~~C~   72 (290)
T PLN03238         46 TKLYICEYCLKYMRKKKSLLRHLAKCD   72 (290)
T ss_pred             CeEEEcCCCcchhCCHHHHHHHHHhCC
Confidence            346899999999999999999987433


No 329
>COG1096 Predicted RNA-binding protein (consists of S1 domain and a Zn-ribbon domain) [Translation, ribosomal structure and biogenesis]
Probab=26.56  E-value=43  Score=18.42  Aligned_cols=23  Identities=22%  Similarity=0.629  Sum_probs=10.9

Q ss_pred             cccccchhhhccCCcceecCcccc
Q psy12019         18 KCLINWSAVQQNHAGMFMCDVCGK   41 (87)
Q Consensus        18 ~c~~c~~~~~~~~~~~~~c~~c~~   41 (87)
                      .|+.|+..+.. ......|+.||.
T Consensus       151 ~CsrC~~~L~~-~~~~l~Cp~Cg~  173 (188)
T COG1096         151 RCSRCRAPLVK-KGNMLKCPNCGN  173 (188)
T ss_pred             EccCCCcceEE-cCcEEECCCCCC
Confidence            34455544444 233345566654


No 330
>KOG1818|consensus
Probab=26.30  E-value=19  Score=23.58  Aligned_cols=50  Identities=18%  Similarity=0.321  Sum_probs=27.8

Q ss_pred             cccccchhhhccCCcceecCcccccccchhhHHHHhhhhcCC-CCCccCCCC
Q psy12019         18 KCLINWSAVQQNHAGMFMCDVCGKGYKYKNGIYRHKKFECGQ-EPKYQCPQC   68 (87)
Q Consensus        18 ~c~~c~~~~~~~~~~~~~c~~c~~~~~~~~~~~~h~~~~~~~-~~~~~c~~c   68 (87)
                      .|-.|...|...+. .+.|..||..|...-....-.....|- ++.-.|..|
T Consensus       167 ~C~rCr~~F~~~~r-kHHCr~CG~vFC~qcss~s~~lP~~Gi~~~VRVCd~C  217 (634)
T KOG1818|consen  167 ECLRCRVKFGLTNR-KHHCRNCGQVFCGQCSSKSLTLPKLGIEKPVRVCDSC  217 (634)
T ss_pred             ccceeeeeeeeccc-cccccccchhhccCccccccCcccccccccceehhhh
Confidence            45556666766553 357888888887665444333334442 332345555


No 331
>PF01844 HNH:  HNH endonuclease;  InterPro: IPR002711 HNH endonuclease is found in bacteria and viruses [, , ]. This family includes pyocins, colicins and anaredoxins.; GO: 0003676 nucleic acid binding, 0004519 endonuclease activity; PDB: 2QGP_C.
Probab=26.23  E-value=10  Score=14.91  Aligned_cols=9  Identities=22%  Similarity=0.634  Sum_probs=1.9

Q ss_pred             CCCCCcccc
Q psy12019         65 CPQCPYRAK   73 (87)
Q Consensus        65 c~~c~~~f~   73 (87)
                      |..|++.+.
T Consensus         1 C~~C~~~~~    9 (47)
T PF01844_consen    1 CQYCGKPGS    9 (47)
T ss_dssp             -TTT--B--
T ss_pred             CCCCCCcCc
Confidence            344554443


No 332
>cd02249 ZZ Zinc finger, ZZ type. Zinc finger present in dystrophin, CBP/p300 and many other proteins. The ZZ motif coordinates one or two zinc ions and most likely participates in ligand binding or molecular scaffolding. Many proteins containing ZZ motifs have other zinc-binding motifs as well, and the majority serve as scaffolds in pathways involving acetyltransferase, protein kinase, or ubiqitin-related activity. ZZ proteins can be grouped into the following functional classes: chromatin modifying, cytoskeletal scaffolding, ubiquitin binding or conjugating, and membrane receptor or ion-channel modifying proteins.
Probab=26.23  E-value=60  Score=12.98  Aligned_cols=7  Identities=14%  Similarity=0.036  Sum_probs=3.3

Q ss_pred             cccccch
Q psy12019         18 KCLINWS   24 (87)
Q Consensus        18 ~c~~c~~   24 (87)
                      .|..|+.
T Consensus         2 ~C~~C~~    8 (46)
T cd02249           2 SCDGCLK    8 (46)
T ss_pred             CCcCCCC
Confidence            3444544


No 333
>PF06170 DUF983:  Protein of unknown function (DUF983);  InterPro: IPR009325 This family consists of several bacterial proteins of unknown function.
Probab=25.25  E-value=34  Score=16.16  Aligned_cols=11  Identities=36%  Similarity=0.875  Sum_probs=7.8

Q ss_pred             ecCcccccccc
Q psy12019         35 MCDVCGKGYKY   45 (87)
Q Consensus        35 ~c~~c~~~~~~   45 (87)
                      +|+.||..+..
T Consensus        10 ~C~~CG~d~~~   20 (86)
T PF06170_consen   10 RCPHCGLDYSH   20 (86)
T ss_pred             cccccCCcccc
Confidence            68888876644


No 334
>PRK08270 anaerobic ribonucleoside triphosphate reductase; Provisional
Probab=25.23  E-value=42  Score=22.25  Aligned_cols=9  Identities=33%  Similarity=0.848  Sum_probs=6.8

Q ss_pred             ccCCCCCcc
Q psy12019         63 YQCPQCPYR   71 (87)
Q Consensus        63 ~~c~~c~~~   71 (87)
                      +.|+.||..
T Consensus       640 ~~CP~CG~~  648 (656)
T PRK08270        640 EFCPKCGEE  648 (656)
T ss_pred             CCCcCCcCc
Confidence            788888753


No 335
>PF13639 zf-RING_2:  Ring finger domain; PDB: 2KIZ_A 4EPO_C 1IYM_A 2EP4_A 2ECT_A 2JRJ_A 2ECN_A 2ECM_A 3NG2_A 2EA6_A ....
Probab=25.20  E-value=52  Score=12.77  Aligned_cols=28  Identities=14%  Similarity=0.335  Sum_probs=14.8

Q ss_pred             cccccchhhhccCCcceecCcccccccchh
Q psy12019         18 KCLINWSAVQQNHAGMFMCDVCGKGYKYKN   47 (87)
Q Consensus        18 ~c~~c~~~~~~~~~~~~~c~~c~~~~~~~~   47 (87)
                      .|.+|...+.. +....... ||..|-..-
T Consensus         2 ~C~IC~~~~~~-~~~~~~l~-C~H~fh~~C   29 (44)
T PF13639_consen    2 ECPICLEEFED-GEKVVKLP-CGHVFHRSC   29 (44)
T ss_dssp             CETTTTCBHHT-TSCEEEET-TSEEEEHHH
T ss_pred             CCcCCChhhcC-CCeEEEcc-CCCeeCHHH
Confidence            46667766654 22233333 776664443


No 336
>PF09082 DUF1922:  Domain of unknown function (DUF1922);  InterPro: IPR015166 Members of this family consist of a beta-sheet region followed by an alpha-helix and an unstructured C terminus. The beta-sheet region contains a CXCX...XCXC sequence with Cys residues located in two proximal loops and pointing towards each other. This precise function of this set of bacterial proteins is, as yet, unknown []. ; PDB: 1GH9_A.
Probab=25.07  E-value=30  Score=15.65  Aligned_cols=24  Identities=29%  Similarity=0.412  Sum_probs=9.1

Q ss_pred             ccccccchhhhc-cCCcceecCccccc
Q psy12019         17 NKCLINWSAVQQ-NHAGMFMCDVCGKG   42 (87)
Q Consensus        17 ~~c~~c~~~~~~-~~~~~~~c~~c~~~   42 (87)
                      |.| .|++..-. .+.+.-.| .||+.
T Consensus         4 frC-~Cgr~lya~e~~kTkkC-~CG~~   28 (68)
T PF09082_consen    4 FRC-DCGRYLYAKEGAKTKKC-VCGKT   28 (68)
T ss_dssp             EEE-TTS--EEEETT-SEEEE-TTTEE
T ss_pred             EEe-cCCCEEEecCCcceeEe-cCCCe
Confidence            344 35544322 23334455 56653


No 337
>PF14354 Lar_restr_allev:  Restriction alleviation protein Lar
Probab=25.06  E-value=44  Score=14.13  Aligned_cols=11  Identities=27%  Similarity=0.135  Sum_probs=7.0

Q ss_pred             cccccccchhh
Q psy12019         16 HNKCLINWSAV   26 (87)
Q Consensus        16 ~~~c~~c~~~~   26 (87)
                      ...|+.|+...
T Consensus         3 LkPCPFCG~~~   13 (61)
T PF14354_consen    3 LKPCPFCGSAD   13 (61)
T ss_pred             CcCCCCCCCcc
Confidence            45678876554


No 338
>TIGR01031 rpmF_bact ribosomal protein L32. This protein describes bacterial ribosomal protein L32. The noise cutoff is set low enough to include the equivalent protein from mitochondria and chloroplasts. No related proteins from the Archaea nor from the eukaryotic cytosol are detected by this model. This model is a fragment model; the putative L32 of some species shows similarity only toward the N-terminus.
Probab=24.96  E-value=55  Score=13.96  Aligned_cols=19  Identities=21%  Similarity=0.298  Sum_probs=9.0

Q ss_pred             cccccchhhhccCCcceecCccc
Q psy12019         18 KCLINWSAVQQNHAGMFMCDVCG   40 (87)
Q Consensus        18 ~c~~c~~~~~~~~~~~~~c~~c~   40 (87)
                      .|+.|+....    ....|..||
T Consensus        28 ~C~~cG~~~~----~H~vc~~cG   46 (55)
T TIGR01031        28 VCPNCGEFKL----PHRVCPSCG   46 (55)
T ss_pred             ECCCCCCccc----CeeECCccC
Confidence            4555554321    134555555


No 339
>COG5222 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only]
Probab=24.93  E-value=1.4e+02  Score=18.02  Aligned_cols=46  Identities=15%  Similarity=0.366  Sum_probs=25.0

Q ss_pred             CcccccccchhhhccCCcceecCcccccccchhhHHHHhhhhcCCCCCccCCCCCc
Q psy12019         15 KHNKCLINWSAVQQNHAGMFMCDVCGKGYKYKNGIYRHKKFECGQEPKYQCPQCPY   70 (87)
Q Consensus        15 ~~~~c~~c~~~~~~~~~~~~~c~~c~~~~~~~~~~~~h~~~~~~~~~~~~c~~c~~   70 (87)
                      -+..|+.|.....+.    ..-.-|+..|....     +..-..+.- |+|+.|.+
T Consensus       273 i~LkCplc~~Llrnp----~kT~cC~~~fc~ec-----i~~al~dsD-f~CpnC~r  318 (427)
T COG5222         273 ISLKCPLCHCLLRNP----MKTPCCGHTFCDEC-----IGTALLDSD-FKCPNCSR  318 (427)
T ss_pred             ccccCcchhhhhhCc----ccCccccchHHHHH-----Hhhhhhhcc-ccCCCccc
Confidence            356787777765553    22233555554332     222333455 78888875


No 340
>PRK08329 threonine synthase; Validated
Probab=24.93  E-value=49  Score=19.83  Aligned_cols=24  Identities=17%  Similarity=0.330  Sum_probs=15.5

Q ss_pred             ccccccchhhhccCCcceecCcccccc
Q psy12019         17 NKCLINWSAVQQNHAGMFMCDVCGKGY   43 (87)
Q Consensus        17 ~~c~~c~~~~~~~~~~~~~c~~c~~~~   43 (87)
                      ++|..|+..+...  ..+.| .|+-.+
T Consensus         2 l~C~~Cg~~~~~~--~~~~C-~c~~~l   25 (347)
T PRK08329          2 LRCTKCGRTYEEK--FKLRC-DCGGTL   25 (347)
T ss_pred             cCcCCCCCCcCCC--Cceec-CCCCcE
Confidence            5788888888632  23678 676543


No 341
>PRK00423 tfb transcription initiation factor IIB; Reviewed
Probab=24.85  E-value=59  Score=19.23  Aligned_cols=31  Identities=23%  Similarity=0.284  Sum_probs=18.6

Q ss_pred             CCCcccccccchhhh--ccCCcceecCcccccc
Q psy12019         13 EPKHNKCLINWSAVQ--QNHAGMFMCDVCGKGY   43 (87)
Q Consensus        13 ~~~~~~c~~c~~~~~--~~~~~~~~c~~c~~~~   43 (87)
                      .++...|+.|+..--  ........|..||-..
T Consensus         8 ~~~~~~Cp~Cg~~~iv~d~~~Ge~vC~~CG~Vl   40 (310)
T PRK00423          8 EEEKLVCPECGSDKLIYDYERGEIVCADCGLVI   40 (310)
T ss_pred             cccCCcCcCCCCCCeeEECCCCeEeecccCCcc
Confidence            345678999985211  1134456788888643


No 342
>PRK05638 threonine synthase; Validated
Probab=24.68  E-value=43  Score=20.78  Aligned_cols=24  Identities=21%  Similarity=0.292  Sum_probs=15.3

Q ss_pred             ccccccchhhhccCCcceecCcccccc
Q psy12019         17 NKCLINWSAVQQNHAGMFMCDVCGKGY   43 (87)
Q Consensus        17 ~~c~~c~~~~~~~~~~~~~c~~c~~~~   43 (87)
                      +.|..|+..+...  ..+.| .||..+
T Consensus         2 l~C~~Cg~~~~~~--~~~~C-~c~~~l   25 (442)
T PRK05638          2 MKCPKCGREYNSY--IPPFC-ICGELL   25 (442)
T ss_pred             eEeCCCCCCCCCC--Cceec-CCCCcE
Confidence            4688888887632  23678 687443


No 343
>PF14447 Prok-RING_4:  Prokaryotic RING finger family 4
Probab=24.68  E-value=40  Score=14.55  Aligned_cols=13  Identities=23%  Similarity=0.841  Sum_probs=9.1

Q ss_pred             eecCcccccccch
Q psy12019         34 FMCDVCGKGYKYK   46 (87)
Q Consensus        34 ~~c~~c~~~~~~~   46 (87)
                      .-|+.|++.|...
T Consensus        40 ngCPfC~~~~~~~   52 (55)
T PF14447_consen   40 NGCPFCGTPFEFD   52 (55)
T ss_pred             cCCCCCCCcccCC
Confidence            3588888877544


No 344
>PF03884 DUF329:  Domain of unknown function (DUF329);  InterPro: IPR005584 The biological function of these short proteins is unknown, but they contain four conserved cysteines, suggesting that they all bind zinc. YacG (Q5X8H6 from SWISSPROT) from Escherichia coli has been shown to bind zinc and contains the structural motifs typical of zinc-binding proteins []. The conserved four cysteine motif in these proteins (-C-X(2)-C-X(15)-C-X(3)-C-) is not found in other zinc-binding proteins with known structures.; GO: 0008270 zinc ion binding; PDB: 1LV3_A.
Probab=24.62  E-value=32  Score=14.94  Aligned_cols=12  Identities=25%  Similarity=0.642  Sum_probs=4.9

Q ss_pred             ccCCCCCccccc
Q psy12019         63 YQCPQCPYRAKQ   74 (87)
Q Consensus        63 ~~c~~c~~~f~~   74 (87)
                      ..|++|++.+..
T Consensus         3 v~CP~C~k~~~~   14 (57)
T PF03884_consen    3 VKCPICGKPVEW   14 (57)
T ss_dssp             EE-TTT--EEE-
T ss_pred             ccCCCCCCeecc
Confidence            357777776544


No 345
>PF10367 Vps39_2:  Vacuolar sorting protein 39 domain 2;  InterPro: IPR019453  This entry represents a domain found in the vacuolar sorting protein Vps39 and transforming growth factor beta receptor-associated protein Trap1. Vps39, a component of the C-Vps complex, is thought to be required for the fusion of endosomes and other types of transport intermediates with the vacuole [, ]. In Saccharomyces cerevisiae (Baker's yeast), Vps39 has been shown to stimulate nucleotide exchange []. Trap1 plays a role in the TGF-beta/activin signaling pathway. It associates with inactive heteromeric TGF-beta and activin receptor complexes, mainly through the type II receptor, and is released upon activation of signaling [, ]. The precise function of this domain has not been characterised In Vps39 this domain is involved in localisation and in mediating the interactions with Vps11 []. 
Probab=24.60  E-value=45  Score=15.74  Aligned_cols=12  Identities=17%  Similarity=0.426  Sum_probs=9.0

Q ss_pred             ccCCCCCccccc
Q psy12019         63 YQCPQCPYRAKQ   74 (87)
Q Consensus        63 ~~c~~c~~~f~~   74 (87)
                      -.|..|++.+..
T Consensus        79 ~~C~vC~k~l~~   90 (109)
T PF10367_consen   79 TKCSVCGKPLGN   90 (109)
T ss_pred             CCccCcCCcCCC
Confidence            468889887754


No 346
>TIGR01385 TFSII transcription elongation factor S-II. This model represents eukaryotic transcription elongation factor S-II. This protein allows stalled RNA transcription complexes to perform a cleavage of the nascent RNA and restart at the newly generated 3-prime end.
Probab=24.46  E-value=14  Score=21.69  Aligned_cols=10  Identities=30%  Similarity=0.707  Sum_probs=7.2

Q ss_pred             ccCCCCCccc
Q psy12019         63 YQCPQCPYRA   72 (87)
Q Consensus        63 ~~c~~c~~~f   72 (87)
                      |.|..||..+
T Consensus       287 ~~C~~Cg~~w  296 (299)
T TIGR01385       287 VTCEECGNRW  296 (299)
T ss_pred             EEcCCCCCee
Confidence            6788887654


No 347
>PF14122 YokU:  YokU-like protein
Probab=24.32  E-value=82  Score=15.02  Aligned_cols=16  Identities=31%  Similarity=0.735  Sum_probs=9.7

Q ss_pred             eecCcccccccchhhH
Q psy12019         34 FMCDVCGKGYKYKNGI   49 (87)
Q Consensus        34 ~~c~~c~~~~~~~~~~   49 (87)
                      ..|..||..+.....+
T Consensus        36 i~C~~CgmvYq~d~vi   51 (87)
T PF14122_consen   36 IICSNCGMVYQDDEVI   51 (87)
T ss_pred             eeecCCCcEEehhHHH
Confidence            4577777666555443


No 348
>PF13597 NRDD:  Anaerobic ribonucleoside-triphosphate reductase; PDB: 1HK8_A 1H78_A 1H7A_A 1H79_A 1H7B_A.
Probab=24.30  E-value=41  Score=21.69  Aligned_cols=9  Identities=33%  Similarity=0.663  Sum_probs=3.1

Q ss_pred             ceecCcccc
Q psy12019         33 MFMCDVCGK   41 (87)
Q Consensus        33 ~~~c~~c~~   41 (87)
                      .+.|+.||.
T Consensus       504 ~~~CP~CGs  512 (546)
T PF13597_consen  504 GDKCPKCGS  512 (546)
T ss_dssp             EEE-CCC--
T ss_pred             CCCCCCCCC
Confidence            445555554


No 349
>PRK08359 transcription factor; Validated
Probab=24.29  E-value=24  Score=19.12  Aligned_cols=30  Identities=27%  Similarity=0.513  Sum_probs=20.3

Q ss_pred             Ccccccccchhhhcc-------CCcceecCccccccc
Q psy12019         15 KHNKCLINWSAVQQN-------HAGMFMCDVCGKGYK   44 (87)
Q Consensus        15 ~~~~c~~c~~~~~~~-------~~~~~~c~~c~~~~~   44 (87)
                      ++-.|..|+......       +.....|+.|...|-
T Consensus         5 ~~~~CEiCG~~i~g~~~~v~ieGael~VC~~Ca~k~G   41 (176)
T PRK08359          5 KPRYCEICGAEIRGPGHRIRIEGAELLVCDRCYEKYG   41 (176)
T ss_pred             CcceeecCCCccCCCCeEEEEcCeEEehHHHHHHHhC
Confidence            455699999887654       334567888874443


No 350
>PRK09710 lar restriction alleviation and modification protein; Reviewed
Probab=24.23  E-value=49  Score=14.78  Aligned_cols=25  Identities=12%  Similarity=0.091  Sum_probs=13.4

Q ss_pred             cccccchhhhcc----CCcceecCccccc
Q psy12019         18 KCLINWSAVQQN----HAGMFMCDVCGKG   42 (87)
Q Consensus        18 ~c~~c~~~~~~~----~~~~~~c~~c~~~   42 (87)
                      .|+.|+..-...    +...+.|..|+..
T Consensus         8 PCPFCG~~~~~v~~~~g~~~v~C~~CgA~   36 (64)
T PRK09710          8 PCPFCGCPSVTVKAISGYYRAKCNGCESR   36 (64)
T ss_pred             CCCCCCCceeEEEecCceEEEEcCCCCcC
Confidence            577777654332    1123567777654


No 351
>PRK11032 hypothetical protein; Provisional
Probab=23.95  E-value=68  Score=17.19  Aligned_cols=31  Identities=19%  Similarity=0.560  Sum_probs=17.5

Q ss_pred             CCcceecCcccccccchhhHHHHhhhhcCCCCCccCCCCCcc
Q psy12019         30 HAGMFMCDVCGKGYKYKNGIYRHKKFECGQEPKYQCPQCPYR   71 (87)
Q Consensus        30 ~~~~~~c~~c~~~~~~~~~~~~h~~~~~~~~~~~~c~~c~~~   71 (87)
                      +.+...|..||.....         .+++..  -.|+.||..
T Consensus       121 g~G~LvC~~Cg~~~~~---------~~p~~i--~pCp~C~~~  151 (160)
T PRK11032        121 GLGNLVCEKCHHHLAF---------YTPEVL--PLCPKCGHD  151 (160)
T ss_pred             ecceEEecCCCCEEEe---------cCCCcC--CCCCCCCCC
Confidence            3345788888854211         233433  378888753


No 352
>cd00162 RING RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H)
Probab=23.71  E-value=58  Score=11.96  Aligned_cols=8  Identities=38%  Similarity=1.032  Sum_probs=5.1

Q ss_pred             ccCCCCCc
Q psy12019         63 YQCPQCPY   70 (87)
Q Consensus        63 ~~c~~c~~   70 (87)
                      ..|+.|..
T Consensus        36 ~~Cp~C~~   43 (45)
T cd00162          36 NTCPLCRT   43 (45)
T ss_pred             CCCCCCCC
Confidence            56777754


No 353
>TIGR00155 pqiA_fam integral membrane protein, PqiA family. This family consists of uncharacterized predicted integral membrane proteins found, so far, only in the Proteobacteria. Of two members in E. coli, one is induced by paraquat and is designated PqiA, paraquat-inducible protein A.
Probab=23.62  E-value=80  Score=19.61  Aligned_cols=29  Identities=24%  Similarity=0.278  Sum_probs=14.2

Q ss_pred             CCcccccccchhhhcc---CCcceecCccccc
Q psy12019         14 PKHNKCLINWSAVQQN---HAGMFMCDVCGKG   42 (87)
Q Consensus        14 ~~~~~c~~c~~~~~~~---~~~~~~c~~c~~~   42 (87)
                      ...-.|++|+......   ....-.|+.||..
T Consensus        11 ~~~~~C~~Cd~l~~~~~l~~g~~a~CpRCg~~   42 (403)
T TIGR00155        11 AKHILCSQCDMLVALPRIESGQKAACPRCGTT   42 (403)
T ss_pred             CCeeeCCCCCCcccccCCCCCCeeECCCCCCC
Confidence            3334477776665433   1122356666643


No 354
>PF14255 Cys_rich_CPXG:  Cysteine-rich CPXCG
Probab=23.46  E-value=51  Score=13.98  Aligned_cols=9  Identities=44%  Similarity=0.947  Sum_probs=4.8

Q ss_pred             cCCCCCccc
Q psy12019         64 QCPQCPYRA   72 (87)
Q Consensus        64 ~c~~c~~~f   72 (87)
                      .|+.||..+
T Consensus         2 ~CPyCge~~   10 (52)
T PF14255_consen    2 QCPYCGEPI   10 (52)
T ss_pred             CCCCCCCee
Confidence            456666543


No 355
>PF14375 Cys_rich_CWC:  Cysteine-rich CWC
Probab=23.26  E-value=46  Score=13.72  Aligned_cols=7  Identities=29%  Similarity=0.648  Sum_probs=2.9

Q ss_pred             CCCCccc
Q psy12019         66 PQCPYRA   72 (87)
Q Consensus        66 ~~c~~~f   72 (87)
                      +.||..|
T Consensus         2 P~Cg~~f    8 (50)
T PF14375_consen    2 PRCGAPF    8 (50)
T ss_pred             CCCCCcC
Confidence            3444443


No 356
>PF04438 zf-HIT:  HIT zinc finger;  InterPro: IPR007529 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents the HIT-type zinc finger, which contains 7 conserved cysteines and one histidine that can potentially coordinate two zinc atoms. It has been named after the first protein that originally defined the domain: the yeast HIT1 protein (P46973 from SWISSPROT) []. The HIT-type zinc finger displays some sequence similarities to the MYND-type zinc finger. The function of this domain is unknown but it is mainly found in nuclear proteins involved in gene regulation and chromatin remodeling. This domain is also found in the thyroid receptor interacting protein 3 (TRIP-3) Q15649 from SWISSPROT, that specifically interacts with the ligand binding domain of the thyroid receptor. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 2YQP_A 2YQQ_A 1X4S_A.
Probab=23.13  E-value=36  Score=12.49  Aligned_cols=8  Identities=50%  Similarity=1.564  Sum_probs=2.4

Q ss_pred             ccCCCCCc
Q psy12019         63 YQCPQCPY   70 (87)
Q Consensus        63 ~~c~~c~~   70 (87)
                      |.|+.|+.
T Consensus        14 Y~Cp~C~~   21 (30)
T PF04438_consen   14 YRCPRCGA   21 (30)
T ss_dssp             EE-TTT--
T ss_pred             EECCCcCC
Confidence            44444443


No 357
>PRK02935 hypothetical protein; Provisional
Probab=23.09  E-value=50  Score=16.38  Aligned_cols=27  Identities=11%  Similarity=0.111  Sum_probs=14.3

Q ss_pred             cccccccchhhhccCCcceecCcccccc
Q psy12019         16 HNKCLINWSAVQQNHAGMFMCDVCGKGY   43 (87)
Q Consensus        16 ~~~c~~c~~~~~~~~~~~~~c~~c~~~~   43 (87)
                      +..|+.|++...-.+. ...|-.|+...
T Consensus        70 qV~CP~C~K~TKmLGr-vD~CM~C~~PL   96 (110)
T PRK02935         70 QVICPSCEKPTKMLGR-VDACMHCNQPL   96 (110)
T ss_pred             eeECCCCCchhhhccc-eeecCcCCCcC
Confidence            4466666666544332 33566666543


No 358
>KOG4727|consensus
Probab=23.02  E-value=65  Score=17.57  Aligned_cols=24  Identities=29%  Similarity=0.488  Sum_probs=18.1

Q ss_pred             CcceecCcccccccchhhHHHHhh
Q psy12019         31 AGMFMCDVCGKGYKYKNGIYRHKK   54 (87)
Q Consensus        31 ~~~~~c~~c~~~~~~~~~~~~h~~   54 (87)
                      ...|-|+.|+=.+..+.++.+|+.
T Consensus        73 ~~GyyCdVCdcvvKDSinflDHiN   96 (193)
T KOG4727|consen   73 KGGYYCDVCDCVVKDSINFLDHIN   96 (193)
T ss_pred             cCceeeeecceeehhhHHHHHHhc
Confidence            345788888888888877777765


No 359
>COG1631 RPL42A Ribosomal protein L44E [Translation, ribosomal structure and biogenesis]
Probab=22.55  E-value=26  Score=16.84  Aligned_cols=10  Identities=20%  Similarity=0.707  Sum_probs=7.7

Q ss_pred             ccCCCCCccc
Q psy12019         63 YQCPQCPYRA   72 (87)
Q Consensus        63 ~~c~~c~~~f   72 (87)
                      +.|.+|+++-
T Consensus        69 ~~Ct~Cgkah   78 (94)
T COG1631          69 LRCTECGKAH   78 (94)
T ss_pred             EEehhhcccc
Confidence            7888998753


No 360
>KOG0562|consensus
Probab=22.51  E-value=42  Score=18.18  Aligned_cols=23  Identities=17%  Similarity=0.378  Sum_probs=18.0

Q ss_pred             ccCCCCCcccccchHHHhhhhhc
Q psy12019         63 YQCPQCPYRAKQNAHLTTHMAIK   85 (87)
Q Consensus        63 ~~c~~c~~~f~~~~~l~~h~~~~   85 (87)
                      -.|..|+-..+..+.|..|.+..
T Consensus       154 LrC~~Cq~~~~~~~kLK~Hl~~~  176 (184)
T KOG0562|consen  154 LRCWRCQTFGPHFPKLKAHLREE  176 (184)
T ss_pred             eeehhhhhcccccHHHHHHHHHH
Confidence            68888985556888889998754


No 361
>PRK08197 threonine synthase; Validated
Probab=22.35  E-value=48  Score=20.22  Aligned_cols=26  Identities=23%  Similarity=0.438  Sum_probs=17.2

Q ss_pred             cccccccchhhhccCCcceecCcccccc
Q psy12019         16 HNKCLINWSAVQQNHAGMFMCDVCGKGY   43 (87)
Q Consensus        16 ~~~c~~c~~~~~~~~~~~~~c~~c~~~~   43 (87)
                      -+.|..|++.+.... ..+.| .||..+
T Consensus         7 ~~~C~~Cg~~~~~~~-~~~~C-~cg~~l   32 (394)
T PRK08197          7 HLECSKCGETYDADQ-VHNLC-KCGKPL   32 (394)
T ss_pred             EEEECCCCCCCCCCC-cceec-CCCCee
Confidence            368888998876532 24678 686543


No 362
>smart00391 MBD Methyl-CpG binding domain. Methyl-CpG binding domain, also known as the TAM (TTF-IIP5, ARBP, MeCP1) domain
Probab=22.29  E-value=66  Score=14.75  Aligned_cols=16  Identities=13%  Similarity=0.391  Sum_probs=11.8

Q ss_pred             CCcccccchHHHhhhh
Q psy12019         68 CPYRAKQNAHLTTHMA   83 (87)
Q Consensus        68 c~~~f~~~~~l~~h~~   83 (87)
                      ||+.|++..++..++.
T Consensus        36 ~GkklRs~~ev~~YL~   51 (77)
T smart00391       36 CGKKLRSKSELARYLH   51 (77)
T ss_pred             CCCeeeCHHHHHHHHH
Confidence            7888887777776654


No 363
>cd01410 SIRT7 SIRT7: Eukaryotic and prokaryotic group (class4) which includes human sirtuin SIRT6, SIRT7, and several bacterial homologs; and are members of the SIR2 family of proteins, silent information regulator 2 (Sir2) enzymes which catalyze NAD+-dependent protein/histone deacetylation. Sir2 proteins have been shown to regulate gene silencing, DNA repair, metabolic enzymes, and life span.
Probab=22.26  E-value=1.5e+02  Score=16.38  Aligned_cols=35  Identities=17%  Similarity=0.356  Sum_probs=17.6

Q ss_pred             ceecCcccccccchhhHHHHhhhhcCCCCCccCCCCCcc
Q psy12019         33 MFMCDVCGKGYKYKNGIYRHKKFECGQEPKYQCPQCPYR   71 (87)
Q Consensus        33 ~~~c~~c~~~~~~~~~~~~h~~~~~~~~~~~~c~~c~~~   71 (87)
                      ...|..|+..+.......   .....+.. -.|+.||..
T Consensus        95 ~~~C~~C~~~~~~~~~~~---~~~~~~~~-p~C~~Cgg~  129 (206)
T cd01410          95 IEVCKSCGPEYVRDDVVE---TRGDKETG-RRCHACGGI  129 (206)
T ss_pred             cccCCCCCCccchHHHHH---HhhcCCCC-CcCCCCcCc
Confidence            356888886654433221   11112223 468888743


No 364
>PF04161 Arv1:  Arv1-like family ;  InterPro: IPR007290 Arv1 is a transmembrane protein, with potential zinc-binding motifs, that mediates sterol homeostasis. Its action is important in lipid homeostasis, which prevents free sterol toxicity []. Arv1 contains a homology domain (AHD), which consists of an N-terminal cysteine-rich subdomain with a putative zinc-binding motif, followed by a C-terminal subdomain of 33 amino acids. The C-terminal subdomain of the AHD is critical for the protein's function []. In yeast, Arv1p is important for the delivery of an early glycosylphosphatidylinositol GPI intermediate, GlcN-acylPI, to the first mannosyltransferase of GPI synthesis in the ER lumen []. It is important for the traffic of sterol in yeast and in humans. In eukaryotic cells, it may fuction in the sphingolipid metabolic pathway as a transporter of ceramides between the ER and Golgi []. 
Probab=22.17  E-value=43  Score=18.51  Aligned_cols=8  Identities=50%  Similarity=1.094  Sum_probs=4.4

Q ss_pred             eecCcccc
Q psy12019         34 FMCDVCGK   41 (87)
Q Consensus        34 ~~c~~c~~   41 (87)
                      -.|+.|++
T Consensus        25 t~C~~C~~   32 (208)
T PF04161_consen   25 TKCPNCGK   32 (208)
T ss_pred             eeccccCC
Confidence            34666654


No 365
>cd02337 ZZ_CBP Zinc finger, ZZ type. Zinc finger present in CBP/p300 and related proteins. The ZZ motif coordinates two zinc ions and most likely participates in ligand binding or molecular scaffolding. CREB-binding protein (CBP) is a large multidomain protein that provides binding sites for transcriptional coactivators, the role of the ZZ domain in CBP/p300 is unclear.
Probab=22.08  E-value=74  Score=12.58  Aligned_cols=7  Identities=43%  Similarity=1.284  Sum_probs=3.2

Q ss_pred             ceecCcc
Q psy12019         33 MFMCDVC   39 (87)
Q Consensus        33 ~~~c~~c   39 (87)
                      .|.|..|
T Consensus        13 r~~C~~C   19 (41)
T cd02337          13 RWHCTVC   19 (41)
T ss_pred             ceECCCC
Confidence            3444444


No 366
>COG3024 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=22.01  E-value=49  Score=14.79  Aligned_cols=12  Identities=25%  Similarity=0.567  Sum_probs=8.8

Q ss_pred             ccCCCCCccccc
Q psy12019         63 YQCPQCPYRAKQ   74 (87)
Q Consensus        63 ~~c~~c~~~f~~   74 (87)
                      -.|+.||+....
T Consensus         8 v~CP~Cgkpv~w   19 (65)
T COG3024           8 VPCPTCGKPVVW   19 (65)
T ss_pred             ccCCCCCCcccc
Confidence            578899986543


No 367
>COG5574 PEX10 RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]
Probab=21.95  E-value=61  Score=18.97  Aligned_cols=45  Identities=20%  Similarity=0.454  Sum_probs=29.2

Q ss_pred             CCcccccccchhhhccCCcceecCcccccccchhhHHHHhhhhcCCCCCcc-CCCCC
Q psy12019         14 PKHNKCLINWSAVQQNHAGMFMCDVCGKGYKYKNGIYRHKKFECGQEPKYQ-CPQCP   69 (87)
Q Consensus        14 ~~~~~c~~c~~~~~~~~~~~~~c~~c~~~~~~~~~~~~h~~~~~~~~~~~~-c~~c~   69 (87)
                      +..|+|..|......     ..|..||-.|.+.-.+..    .+. +. ++ |+.|.
T Consensus       213 ~~d~kC~lC~e~~~~-----ps~t~CgHlFC~~Cl~~~----~t~-~k-~~~CplCR  258 (271)
T COG5574         213 LADYKCFLCLEEPEV-----PSCTPCGHLFCLSCLLIS----WTK-KK-YEFCPLCR  258 (271)
T ss_pred             ccccceeeeecccCC-----cccccccchhhHHHHHHH----HHh-hc-cccCchhh
Confidence            456788887765322     367889999988877664    233 33 45 88774


No 368
>COG1655 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=21.85  E-value=18  Score=20.62  Aligned_cols=8  Identities=50%  Similarity=1.281  Sum_probs=5.5

Q ss_pred             ccCCCCCc
Q psy12019         63 YQCPQCPY   70 (87)
Q Consensus        63 ~~c~~c~~   70 (87)
                      +.|+.|+.
T Consensus        63 vvCP~C~y   70 (267)
T COG1655          63 VVCPICYY   70 (267)
T ss_pred             EEcchhhH
Confidence            46777774


No 369
>KOG3268|consensus
Probab=21.78  E-value=1.6e+02  Score=16.30  Aligned_cols=13  Identities=15%  Similarity=0.161  Sum_probs=8.0

Q ss_pred             cccccccchhhhc
Q psy12019         16 HNKCLINWSAVQQ   28 (87)
Q Consensus        16 ~~~c~~c~~~~~~   28 (87)
                      ..+|.+|-..|-.
T Consensus       148 ~lE~df~a~a~Le  160 (234)
T KOG3268|consen  148 QLECDFCAAAFLE  160 (234)
T ss_pred             eeeeCccHHHhcC
Confidence            4567777666643


No 370
>PRK00481 NAD-dependent deacetylase; Provisional
Probab=21.70  E-value=91  Score=17.62  Aligned_cols=29  Identities=28%  Similarity=0.730  Sum_probs=15.9

Q ss_pred             ceecCcccccccchhhHHHHhhhhcCCCCCccCCCCCc
Q psy12019         33 MFMCDVCGKGYKYKNGIYRHKKFECGQEPKYQCPQCPY   70 (87)
Q Consensus        33 ~~~c~~c~~~~~~~~~~~~h~~~~~~~~~~~~c~~c~~   70 (87)
                      ...|..|++.+.....+       ..+.|  .|+.||.
T Consensus       122 ~~~C~~C~~~~~~~~~~-------~~~~p--~C~~Cgg  150 (242)
T PRK00481        122 RARCTKCGQTYDLDEYL-------KPEPP--RCPKCGG  150 (242)
T ss_pred             ceeeCCCCCCcChhhhc-------cCCCC--CCCCCCC
Confidence            35688887766544322       12223  4788864


No 371
>PTZ00409 Sir2 (Silent Information Regulator) protein; Provisional
Probab=21.58  E-value=1.4e+02  Score=17.44  Aligned_cols=15  Identities=20%  Similarity=0.386  Sum_probs=9.7

Q ss_pred             ceecCcccccccchh
Q psy12019         33 MFMCDVCGKGYKYKN   47 (87)
Q Consensus        33 ~~~c~~c~~~~~~~~   47 (87)
                      ...|..|+..+....
T Consensus       137 ~~~C~~C~~~~~~~~  151 (271)
T PTZ00409        137 EARCCTCRKTIQLNK  151 (271)
T ss_pred             cceeCCCCCCcccCH
Confidence            356888887765443


No 372
>PRK07111 anaerobic ribonucleoside triphosphate reductase; Provisional
Probab=21.57  E-value=56  Score=22.07  Aligned_cols=7  Identities=43%  Similarity=1.013  Sum_probs=3.8

Q ss_pred             eecCccc
Q psy12019         34 FMCDVCG   40 (87)
Q Consensus        34 ~~c~~c~   40 (87)
                      +.|+.||
T Consensus       694 ~~CP~CG  700 (735)
T PRK07111        694 DKCPKCG  700 (735)
T ss_pred             ccCcCCC
Confidence            4555555


No 373
>cd00122 MBD MeCP2, MBD1, MBD2, MBD3, MBD4, CLLD8-like, and BAZ2A-like proteins constitute a family of proteins that share the methyl-CpG-binding domain (MBD). The MBD consists of about 70 residues and is defined as the minimal region required for binding to methylated DNA by a methyl-CpG-binding protein which binds specifically to methylated DNA. The MBD can recognize a single symmetrically methylated CpG either as naked DNA or within chromatin.  MeCP2, MBD1 and MBD2 (and likely MBD3) form complexes with histone deacetylase and are involved in histone deacetylase-dependent repression of transcription. MBD4 is an endonuclease that forms a complex with the DNA mismatch-repair protein MLH1. The MBDs present in putative chromatin remodelling subunit, BAZ2A, and putative histone methyltransferase, CLLD8, represent two phylogenetically distinct groups within the MBD protein family.
Probab=21.52  E-value=75  Score=13.69  Aligned_cols=16  Identities=6%  Similarity=0.345  Sum_probs=10.8

Q ss_pred             CCcccccchHHHhhhh
Q psy12019         68 CPYRAKQNAHLTTHMA   83 (87)
Q Consensus        68 c~~~f~~~~~l~~h~~   83 (87)
                      ||+.|.+..++...+.
T Consensus        33 ~Gk~~Rs~~ev~~yL~   48 (62)
T cd00122          33 CGKKLRSKPEVARYLE   48 (62)
T ss_pred             CCceecCHHHHHHHHH
Confidence            6777777777666654


No 374
>COG1579 Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only]
Probab=21.41  E-value=77  Score=18.23  Aligned_cols=35  Identities=17%  Similarity=0.290  Sum_probs=19.6

Q ss_pred             ecCcccccccchhhHHHHhhhhcCCCCCccCCCCCccccc
Q psy12019         35 MCDVCGKGYKYKNGIYRHKKFECGQEPKYQCPQCPYRAKQ   74 (87)
Q Consensus        35 ~c~~c~~~~~~~~~~~~h~~~~~~~~~~~~c~~c~~~f~~   74 (87)
                      .|..|....+...  ..-.+.  ++.. -.|+.||+..-+
T Consensus       199 ~C~GC~m~l~~~~--~~~V~~--~d~i-v~CP~CgRILy~  233 (239)
T COG1579         199 VCGGCHMKLPSQT--LSKVRK--KDEI-VFCPYCGRILYY  233 (239)
T ss_pred             cccCCeeeecHHH--HHHHhc--CCCC-ccCCccchHHHh
Confidence            5666765543332  222232  4454 789999986543


No 375
>COG1885 Uncharacterized protein conserved in archaea [Function unknown]
Probab=20.69  E-value=62  Score=16.03  Aligned_cols=10  Identities=30%  Similarity=0.763  Sum_probs=7.0

Q ss_pred             ccCCCCCccc
Q psy12019         63 YQCPQCPYRA   72 (87)
Q Consensus        63 ~~c~~c~~~f   72 (87)
                      ..|+.||-.|
T Consensus        50 t~CP~Cg~~~   59 (115)
T COG1885          50 TSCPKCGEPF   59 (115)
T ss_pred             ccCCCCCCcc
Confidence            6778887654


No 376
>PF06957 COPI_C:  Coatomer (COPI) alpha subunit C-terminus;  InterPro: IPR010714 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment. This traffic is bidirectional, to ensure that proteins required to form vesicles are recycled. Vesicles have specific coat proteins (such as clathrin or coatomer) that are important for cargo selection and direction of transfer []. While clathrin mediates endocytic protein transport, and transport from ER to Golgi, coatomers primarily mediate intra-Golgi transport, as well as the reverse Golgi to ER transport of dilysine-tagged proteins []. For example, the coatomer COP1 (coat protein complex 1) is responsible for reverse transport of recycled proteins from Golgi and pre-Golgi compartments back to the ER, while COPII buds vesicles from the ER to the Golgi []. Coatomers reversibly associate with Golgi (non-clathrin-coated) vesicles to mediate protein transport and for budding from Golgi membranes []. Activated small guanine triphosphatases (GTPases) attract coat proteins to specific membrane export sites, thereby linking coatomers to export cargos. As coat proteins polymerise, vesicles are formed and budded from membrane-bound organelles. Coatomer complexes also influence Golgi structural integrity, as well as the processing, activity, and endocytic recycling of LDL receptors. In mammals, coatomer complexes can only be recruited by membranes associated to ADP-ribosylation factors (ARFs), which are small GTP-binding proteins. Coatomer complexes are hetero-oligomers composed of at least an alpha, beta, beta', gamma, delta, epsilon and zeta subunits.  This entry represents the C terminus (approximately 500 residues) of the eukaryotic coatomer alpha subunit [, ]. This domain is found along with the IPR006692 from INTERPRO domain. More information about these proteins can be found at Protein of the Month: Clathrin [].; GO: 0005198 structural molecule activity, 0005515 protein binding, 0006886 intracellular protein transport, 0016192 vesicle-mediated transport, 0030126 COPI vesicle coat; PDB: 3MKR_B 3MV2_E 3MKQ_B 3MV3_A.
Probab=20.53  E-value=50  Score=20.70  Aligned_cols=25  Identities=20%  Similarity=0.305  Sum_probs=12.1

Q ss_pred             cccchhhhcc--CCcceecCccccccc
Q psy12019         20 LINWSAVQQN--HAGMFMCDVCGKGYK   44 (87)
Q Consensus        20 ~~c~~~~~~~--~~~~~~c~~c~~~~~   44 (87)
                      .+|..+|...  +.....|+.||-.|.
T Consensus       365 ~ICa~s~tPIY~G~~~v~CP~cgA~y~  391 (422)
T PF06957_consen  365 DICAASYTPIYRGSPSVKCPYCGAKYH  391 (422)
T ss_dssp             EEBTTT--EEETTS-EEE-TTT--EEE
T ss_pred             eeeecccccccCCCCCeeCCCCCCccC
Confidence            3577777765  334456999987664


No 377
>KOG4602|consensus
Probab=20.42  E-value=47  Score=19.36  Aligned_cols=11  Identities=27%  Similarity=1.053  Sum_probs=7.8

Q ss_pred             cceecCccccc
Q psy12019         32 GMFMCDVCGKG   42 (87)
Q Consensus        32 ~~~~c~~c~~~   42 (87)
                      +.|.|+.||-+
T Consensus       267 R~YVCPiCGAT  277 (318)
T KOG4602|consen  267 RSYVCPICGAT  277 (318)
T ss_pred             hhhcCcccccc
Confidence            35788888854


No 378
>smart00647 IBR In Between Ring fingers. the domains occurs between pairs og RING fingers
Probab=20.42  E-value=76  Score=13.21  Aligned_cols=10  Identities=30%  Similarity=1.065  Sum_probs=4.7

Q ss_pred             ccCCCCCccc
Q psy12019         63 YQCPQCPYRA   72 (87)
Q Consensus        63 ~~c~~c~~~f   72 (87)
                      ..|+.|+..|
T Consensus        41 v~C~~C~~~f   50 (64)
T smart00647       41 VTCPKCGFSF   50 (64)
T ss_pred             eECCCCCCeE
Confidence            4444455444


No 379
>PF03833 PolC_DP2:  DNA polymerase II large subunit DP2;  InterPro: IPR016033 DP2 is the large subunit of a two-subunit novel archaebacterial replicative DNA polymerase first characterised for Pyrococcus furiosus. The structure of DP2 appears to be organised as a ~950 residue component separated from a ~300 residue component by a ~150 residue intein. The other subunit, DP1, has sequence similarity to the eukaryotic DNA polymerase delta small subunit. This entry represents the N-terminal ~950 residue component of DP2.; GO: 0003887 DNA-directed DNA polymerase activity; PDB: 3O59_X.
Probab=20.40  E-value=34  Score=23.50  Aligned_cols=9  Identities=11%  Similarity=0.165  Sum_probs=0.0

Q ss_pred             ccccccchh
Q psy12019         17 NKCLINWSA   25 (87)
Q Consensus        17 ~~c~~c~~~   25 (87)
                      ..|+.|+..
T Consensus       656 r~Cp~Cg~~  664 (900)
T PF03833_consen  656 RRCPKCGKE  664 (900)
T ss_dssp             ---------
T ss_pred             ccCcccCCc
Confidence            456666654


No 380
>TIGR00382 clpX endopeptidase Clp ATP-binding regulatory subunit (clpX). A member of the ATP-dependent proteases, ClpX has ATP-dependent chaperone activity and is required for specific ATP-dependent proteolytic activities expressed by ClpPX. The gene is also found to be involved in stress tolerance in Bacillus subtilis and is essential for the efficient acquisition of genes specifying type IA and IB restriction.
Probab=20.12  E-value=62  Score=20.18  Aligned_cols=26  Identities=19%  Similarity=0.448  Sum_probs=17.4

Q ss_pred             cccccchhhhcc-----CCcceecCcccccc
Q psy12019         18 KCLINWSAVQQN-----HAGMFMCDVCGKGY   43 (87)
Q Consensus        18 ~c~~c~~~~~~~-----~~~~~~c~~c~~~~   43 (87)
                      .|+.|++.-...     +...|.|+.|-..+
T Consensus         9 ~c~fc~~~~~~~~~~~~~~~~~ic~~c~~~~   39 (413)
T TIGR00382         9 YCSFCGKSQDEVRKLIAGPGVYICDECIELC   39 (413)
T ss_pred             ecCCCCCChhhcccccCCCCCcCCCchHHHH
Confidence            699999876543     33357888886443


Done!