Query         psy12021
Match_columns 106
No_of_seqs    169 out of 1942
Neff          10.3
Searched_HMMs 46136
Date          Fri Aug 16 16:38:20 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy12021.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/12021hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG2462|consensus               99.8 6.6E-20 1.4E-24  114.8   2.0   95    7-102   165-264 (279)
  2 KOG2462|consensus               99.7   1E-17 2.2E-22  105.0   3.2   58   48-106   183-240 (279)
  3 KOG3623|consensus               99.3 1.9E-13 4.2E-18   95.4   0.7   62   40-102   910-971 (1007)
  4 PHA02768 hypothetical protein;  99.3 7.9E-13 1.7E-17   64.6   1.9   43   53-98      6-48  (55)
  5 KOG3576|consensus               99.3 3.4E-13 7.5E-18   81.9  -0.7   67   39-106   132-198 (267)
  6 PHA00733 hypothetical protein   99.2 4.8E-11   1E-15   68.8   5.0   56   48-106    69-124 (128)
  7 KOG3623|consensus               99.1 4.2E-11   9E-16   84.1   3.0   58   48-106   890-947 (1007)
  8 KOG3576|consensus               99.0 5.7E-11 1.2E-15   72.3   0.6   57   49-106   114-170 (267)
  9 KOG1074|consensus               99.0 9.9E-11 2.1E-15   83.0  -0.2   52   53-105   354-405 (958)
 10 PF13465 zf-H2C2_2:  Zinc-finge  98.9 7.1E-10 1.5E-14   46.7   2.3   26   67-93      1-26  (26)
 11 KOG1074|consensus               98.9   4E-10 8.7E-15   80.0   1.3   62   43-105   624-692 (958)
 12 PHA00732 hypothetical protein   98.8   5E-09 1.1E-13   55.5   2.5   45   52-103     1-46  (79)
 13 PHA00616 hypothetical protein   98.7 8.7E-09 1.9E-13   48.2   1.9   34   52-86      1-34  (44)
 14 PF05605 zf-Di19:  Drought indu  98.7 7.3E-08 1.6E-12   47.5   4.4   52   52-106     2-54  (54)
 15 KOG3608|consensus               98.6   1E-09 2.2E-14   71.8  -3.1  102    3-104   136-260 (467)
 16 KOG3993|consensus               98.6 1.2E-08 2.6E-13   68.1   1.6   55   51-105   294-380 (500)
 17 PHA00616 hypothetical protein   98.6 2.7E-08 5.9E-13   46.5   1.4   26   81-106     1-26  (44)
 18 KOG3608|consensus               98.5 6.9E-09 1.5E-13   68.0  -1.6   52   53-104   264-315 (467)
 19 PF00096 zf-C2H2:  Zinc finger,  98.5 1.3E-07 2.7E-12   38.5   1.9   22   82-103     1-22  (23)
 20 PHA02768 hypothetical protein;  98.4 1.2E-07 2.7E-12   46.4   1.8   24   82-105     6-29  (55)
 21 PF00096 zf-C2H2:  Zinc finger,  98.4 2.8E-07   6E-12   37.4   2.4   23   53-75      1-23  (23)
 22 PF13912 zf-C2H2_6:  C2H2-type   98.3   4E-07 8.7E-12   38.4   1.7   25   81-105     1-25  (27)
 23 PF13894 zf-C2H2_4:  C2H2-type   98.3 6.5E-07 1.4E-11   36.4   2.1   24   82-105     1-24  (24)
 24 PHA00733 hypothetical protein   98.2 6.2E-07 1.3E-11   51.8   2.0   55   49-104    37-96  (128)
 25 PF13465 zf-H2C2_2:  Zinc-finge  98.2 2.5E-07 5.4E-12   38.8  -0.6   23   42-64      4-26  (26)
 26 PF13894 zf-C2H2_4:  C2H2-type   98.1 4.3E-06 9.4E-11   33.8   2.4   24   53-76      1-24  (24)
 27 PF13912 zf-C2H2_6:  C2H2-type   98.1 2.8E-06   6E-11   35.7   1.7   26   52-77      1-26  (27)
 28 PF12756 zf-C2H2_2:  C2H2 type   97.9 9.2E-06   2E-10   44.4   2.4   23   82-104    51-73  (100)
 29 COG5189 SFP1 Putative transcri  97.9 3.3E-06 7.1E-11   55.0   0.3   55   49-103   346-420 (423)
 30 PLN03086 PRLI-interacting fact  97.8 1.8E-05   4E-10   55.6   3.4   38   51-91    477-514 (567)
 31 smart00355 ZnF_C2H2 zinc finge  97.8 1.9E-05 4.1E-10   32.4   2.2   23   82-104     1-23  (26)
 32 PF09237 GAGA:  GAGA factor;  I  97.8 1.2E-05 2.5E-10   38.6   1.3   25   81-105    24-48  (54)
 33 PLN03086 PRLI-interacting fact  97.6 9.2E-05   2E-09   52.2   4.4   51   48-104   449-499 (567)
 34 smart00355 ZnF_C2H2 zinc finge  97.6   6E-05 1.3E-09   30.8   2.2   24   53-76      1-24  (26)
 35 PF12874 zf-met:  Zinc-finger o  97.4 0.00014   3E-09   29.8   1.9   22   53-74      1-22  (25)
 36 PRK04860 hypothetical protein;  97.4 0.00012 2.6E-09   43.9   2.3   38   52-94    119-156 (160)
 37 PF13909 zf-H2C2_5:  C2H2-type   97.4 0.00017 3.7E-09   29.3   1.9   24   82-106     1-24  (24)
 38 PF09237 GAGA:  GAGA factor;  I  97.2 0.00051 1.1E-08   33.0   3.0   33   48-80     20-52  (54)
 39 PF12874 zf-met:  Zinc-finger o  97.2  0.0003 6.6E-09   28.7   1.6   23   82-104     1-23  (25)
 40 KOG3993|consensus               97.1 7.2E-05 1.6E-09   50.6  -0.7   52   52-104   267-318 (500)
 41 COG5189 SFP1 Putative transcri  97.0 0.00016 3.4E-09   47.4   0.1   69    3-73    351-419 (423)
 42 PF12171 zf-C2H2_jaz:  Zinc-fin  96.8 0.00052 1.1E-08   28.7   0.5   22   53-74      2-23  (27)
 43 PF12756 zf-C2H2_2:  C2H2 type   96.7  0.0016 3.5E-08   35.4   2.5   72    3-76      1-74  (100)
 44 PF12171 zf-C2H2_jaz:  Zinc-fin  96.7 0.00076 1.7E-08   28.2   0.7   22   82-103     2-23  (27)
 45 PF13909 zf-H2C2_5:  C2H2-type   96.5  0.0033 7.2E-08   25.3   2.3   24   53-77      1-24  (24)
 46 PF13913 zf-C2HC_2:  zinc-finge  96.4  0.0039 8.4E-08   25.6   2.0   20   82-102     3-22  (25)
 47 smart00451 ZnF_U1 U1-like zinc  95.6    0.01 2.3E-07   26.0   1.8   21   82-102     4-24  (35)
 48 smart00451 ZnF_U1 U1-like zinc  95.6   0.013 2.8E-07   25.7   2.0   23   52-74      3-25  (35)
 49 COG5048 FOG: Zn-finger [Genera  94.6  0.0048   1E-07   41.5  -1.3   55   51-106   288-348 (467)
 50 PF05605 zf-Di19:  Drought indu  94.6   0.044 9.5E-07   26.7   2.4   23   82-105     3-25  (54)
 51 cd00350 rubredoxin_like Rubred  94.2   0.027 5.8E-07   24.7   1.0   24   53-89      2-25  (33)
 52 COG4049 Uncharacterized protei  94.1   0.024 5.2E-07   27.8   0.8   32   46-77     11-42  (65)
 53 cd00729 rubredoxin_SM Rubredox  93.6   0.065 1.4E-06   23.6   1.7   25   52-89      2-26  (34)
 54 KOG2893|consensus               93.3   0.022 4.8E-07   36.3  -0.1   45   50-100     9-53  (341)
 55 COG4049 Uncharacterized protei  93.2   0.063 1.4E-06   26.3   1.3   30   76-106    13-42  (65)
 56 KOG2186|consensus               93.1   0.063 1.4E-06   34.5   1.7   46   53-102     4-49  (276)
 57 PF09538 FYDLN_acid:  Protein o  92.7   0.043 9.2E-07   30.9   0.5   30   53-94     10-39  (108)
 58 KOG1146|consensus               91.4     0.2 4.3E-06   39.1   2.7   57   47-103   460-540 (1406)
 59 PF13719 zinc_ribbon_5:  zinc-r  90.5    0.17 3.6E-06   22.7   1.1   34   53-92      3-36  (37)
 60 PF04959 ARS2:  Arsenite-resist  90.2    0.17 3.8E-06   31.9   1.3   26   51-76     76-101 (214)
 61 COG1592 Rubrerythrin [Energy p  89.7     0.2 4.3E-06   30.4   1.3   24   52-89    134-157 (166)
 62 PF13717 zinc_ribbon_4:  zinc-r  89.5    0.25 5.4E-06   22.0   1.2   34   53-92      3-36  (36)
 63 PF02892 zf-BED:  BED zinc fing  89.4    0.41 8.9E-06   22.1   2.0   21   82-102    17-41  (45)
 64 PF05443 ROS_MUCR:  ROS/MUCR tr  89.1    0.24 5.2E-06   28.9   1.3   22   82-106    73-94  (132)
 65 smart00659 RPOLCX RNA polymera  89.0    0.28 6.1E-06   22.9   1.3   27   52-90      2-28  (44)
 66 TIGR02098 MJ0042_CXXC MJ0042 f  88.9    0.25 5.3E-06   22.1   1.0   34   53-92      3-36  (38)
 67 PF09723 Zn-ribbon_8:  Zinc rib  87.9   0.079 1.7E-06   24.5  -1.0   29   53-89      6-34  (42)
 68 PF12013 DUF3505:  Protein of u  87.5    0.55 1.2E-05   26.2   2.1   25   82-106    81-109 (109)
 69 smart00834 CxxC_CXXC_SSSS Puta  87.5    0.13 2.9E-06   23.2  -0.4   30   53-90      6-35  (41)
 70 TIGR02300 FYDLN_acid conserved  87.5    0.27   6E-06   28.3   0.8   31   53-95     10-40  (129)
 71 TIGR02605 CxxC_CxxC_SSSS putat  87.1    0.15 3.1E-06   24.5  -0.4   29   53-89      6-34  (52)
 72 COG2888 Predicted Zn-ribbon RN  86.5    0.59 1.3E-05   23.3   1.6   32   51-88     26-57  (61)
 73 smart00531 TFIIE Transcription  84.8     1.2 2.7E-05   26.3   2.7   39   48-91     95-133 (147)
 74 TIGR00373 conserved hypothetic  84.5    0.82 1.8E-05   27.4   1.9   34   48-91    105-138 (158)
 75 smart00614 ZnF_BED BED zinc fi  84.4    0.86 1.9E-05   21.7   1.6   12   53-64     19-30  (50)
 76 KOG4167|consensus               83.5    0.33 7.2E-06   35.8  -0.1   28   50-77    790-817 (907)
 77 PF08790 zf-LYAR:  LYAR-type C2  83.2    0.25 5.4E-06   20.8  -0.5   20   53-73      1-20  (28)
 78 PF04959 ARS2:  Arsenite-resist  82.3     1.4 3.1E-05   27.8   2.4   28   77-105    74-101 (214)
 79 PRK06266 transcription initiat  82.2       1 2.2E-05   27.6   1.7   34   49-92    114-147 (178)
 80 COG5048 FOG: Zn-finger [Genera  82.0    0.86 1.9E-05   30.7   1.4   56   49-105    30-87  (467)
 81 COG1997 RPL43A Ribosomal prote  81.9    0.44 9.6E-06   25.6   0.0   33   50-93     33-65  (89)
 82 smart00734 ZnF_Rad18 Rad18-lik  81.5     1.7 3.7E-05   17.8   1.8   20   82-102     2-21  (26)
 83 PRK00398 rpoP DNA-directed RNA  80.6    0.93   2E-05   21.2   0.9   29   52-91      3-31  (46)
 84 PF08274 PhnA_Zn_Ribbon:  PhnA   80.0    0.76 1.6E-05   19.6   0.4   25   54-90      4-28  (30)
 85 PRK00464 nrdR transcriptional   79.0    0.26 5.7E-06   29.5  -1.6   11   82-92     29-39  (154)
 86 PF12013 DUF3505:  Protein of u  77.4     2.7 5.8E-05   23.4   2.3   25   53-77     81-109 (109)
 87 PF13878 zf-C2H2_3:  zinc-finge  77.0     3.4 7.3E-05   18.9   2.2   24   53-76     14-39  (41)
 88 COG4957 Predicted transcriptio  76.9     1.5 3.2E-05   25.7   1.1   20   83-105    78-97  (148)
 89 PF03604 DNA_RNApol_7kD:  DNA d  76.4     2.7 5.9E-05   18.2   1.6   26   53-90      1-26  (32)
 90 COG1996 RPC10 DNA-directed RNA  76.3     1.6 3.6E-05   20.9   1.0   29   51-90      5-33  (49)
 91 KOG2482|consensus               74.8     1.9 4.1E-05   29.3   1.3   23   52-74    195-217 (423)
 92 PF09963 DUF2197:  Uncharacteri  74.7     1.2 2.6E-05   22.0   0.3   37   54-90      4-40  (56)
 93 PF07754 DUF1610:  Domain of un  74.3     1.4 3.1E-05   17.8   0.4    7   82-88     17-23  (24)
 94 PRK14890 putative Zn-ribbon RN  73.7     2.1 4.5E-05   21.4   1.0   31   52-88     25-55  (59)
 95 KOG4173|consensus               72.5     1.8 3.8E-05   27.3   0.8   51   54-105   108-170 (253)
 96 KOG2785|consensus               72.4     5.7 0.00012   27.4   3.1   53   51-103   165-242 (390)
 97 COG4530 Uncharacterized protei  71.2     1.8 3.8E-05   24.5   0.5   28   54-93     11-38  (129)
 98 PF09986 DUF2225:  Uncharacteri  71.1     4.7  0.0001   25.5   2.4   55    3-65      7-61  (214)
 99 PF13451 zf-trcl:  Probable zin  70.6     2.7   6E-05   20.1   1.0   37   51-88      3-40  (49)
100 KOG4167|consensus               70.3    0.95 2.1E-05   33.6  -0.9   23   82-104   793-815 (907)
101 PF05191 ADK_lid:  Adenylate ki  70.1     1.2 2.5E-05   19.9  -0.3   32   53-93      2-33  (36)
102 KOG3408|consensus               69.1       4 8.6E-05   23.5   1.6   27   48-74     53-79  (129)
103 KOG2593|consensus               67.6     4.5 9.7E-05   28.3   1.9   39   48-90    124-162 (436)
104 COG5236 Uncharacterized conser  66.8     8.4 0.00018   26.4   3.0   48   54-103   222-273 (493)
105 KOG2785|consensus               66.7     7.1 0.00015   26.9   2.7   51   53-103     4-90  (390)
106 TIGR01206 lysW lysine biosynth  66.0     1.7 3.7E-05   21.3  -0.2   30   53-91      3-32  (54)
107 PF15269 zf-C2H2_7:  Zinc-finge  65.8     5.1 0.00011   18.8   1.4   21   82-102    21-41  (54)
108 TIGR00280 L37a ribosomal prote  65.4     1.2 2.6E-05   24.2  -0.9   31   51-92     34-64  (91)
109 PRK09678 DNA-binding transcrip  65.4     1.5 3.3E-05   22.8  -0.5   11   82-92     28-40  (72)
110 PHA00626 hypothetical protein   65.4     3.6 7.8E-05   20.3   0.8   15   81-95     23-37  (59)
111 PTZ00255 60S ribosomal protein  64.7     1.5 3.2E-05   23.9  -0.6   32   50-92     34-65  (90)
112 PF10571 UPF0547:  Uncharacteri  64.3     3.8 8.3E-05   16.8   0.7   11   82-92     15-25  (26)
113 PRK03824 hypA hydrogenase nick  63.7     2.5 5.4E-05   24.7   0.2   15   51-65     69-83  (135)
114 COG2331 Uncharacterized protei  62.7     3.2   7E-05   21.8   0.4   32   53-92     13-44  (82)
115 smart00154 ZnF_AN1 AN1-like Zi  61.7     4.1 8.9E-05   18.4   0.7   14   81-94     12-25  (39)
116 KOG1146|consensus               61.5     1.8   4E-05   34.2  -0.8   51   55-105   439-489 (1406)
117 PF07503 zf-HYPF:  HypF finger;  60.3    0.95 2.1E-05   20.1  -1.6   11   82-92     22-32  (35)
118 PF01363 FYVE:  FYVE zinc finge  58.9     4.7  0.0001   20.3   0.7   27   53-92     10-36  (69)
119 KOG2636|consensus               58.3     7.2 0.00016   27.5   1.6   29   45-73    394-423 (497)
120 PF01428 zf-AN1:  AN1-like Zinc  57.7     3.2 6.9E-05   19.1  -0.1   14   81-94     13-26  (43)
121 TIGR00100 hypA hydrogenase nic  57.7     4.5 9.8E-05   22.9   0.5   27   51-90     69-95  (115)
122 COG4306 Uncharacterized protei  57.1       3 6.6E-05   24.1  -0.3   16   79-94     66-81  (160)
123 COG5236 Uncharacterized conser  56.6      20 0.00042   24.8   3.3   24   82-105   221-244 (493)
124 PRK12380 hydrogenase nickel in  56.4     5.6 0.00012   22.5   0.7   26   51-89     69-94  (113)
125 PF01155 HypA:  Hydrogenase exp  56.0     7.6 0.00017   21.9   1.2   26   52-90     70-95  (113)
126 TIGR00686 phnA alkylphosphonat  55.8     5.9 0.00013   22.3   0.7   29   54-94      4-32  (109)
127 cd00065 FYVE FYVE domain; Zinc  55.4     9.9 0.00021   18.2   1.5    9   55-63      5-13  (57)
128 PF01927 Mut7-C:  Mut7-C RNAse   55.1     8.5 0.00018   22.7   1.4   48   53-101    92-144 (147)
129 PF07975 C1_4:  TFIIH C1-like d  54.0     2.7 5.8E-05   20.3  -0.7   17   52-68     21-37  (51)
130 KOG4173|consensus               52.7     9.4  0.0002   24.2   1.3   50   51-104    78-129 (253)
131 PF10013 DUF2256:  Uncharacteri  52.4      10 0.00022   17.5   1.1   13   83-95     10-22  (42)
132 PRK00564 hypA hydrogenase nick  51.8     6.2 0.00013   22.5   0.4   28   51-90     70-97  (117)
133 PF10263 SprT-like:  SprT-like   49.6     4.8  0.0001   23.7  -0.3   32   52-92    123-154 (157)
134 COG3677 Transposase and inacti  49.2     9.1  0.0002   22.2   0.9   16   78-94     51-66  (129)
135 KOG2231|consensus               49.2      21 0.00046   26.7   2.8   11   64-74    126-136 (669)
136 KOG2636|consensus               49.1      14 0.00029   26.3   1.8   29   73-102   394-423 (497)
137 KOG1280|consensus               49.0      21 0.00046   24.5   2.6   42   48-89     75-117 (381)
138 smart00064 FYVE Protein presen  48.8      17 0.00037   18.1   1.8   10   54-63     12-21  (68)
139 PF14311 DUF4379:  Domain of un  47.9      16 0.00036   17.5   1.6   14   53-66     29-42  (55)
140 KOG1842|consensus               47.6      13 0.00029   26.3   1.5   28   51-78     14-41  (505)
141 KOG2071|consensus               47.4      13 0.00029   27.1   1.6   24   81-104   418-441 (579)
142 PRK10220 hypothetical protein;  46.4      11 0.00024   21.3   0.9   13   82-94     21-33  (111)
143 KOG2482|consensus               45.5      14  0.0003   25.4   1.3   52   52-104   144-218 (423)
144 PLN02294 cytochrome c oxidase   45.1      11 0.00025   23.0   0.9   15   50-64    139-153 (174)
145 PF04780 DUF629:  Protein of un  45.0      19 0.00041   25.7   2.0   21   82-102    58-78  (466)
146 cd00924 Cyt_c_Oxidase_Vb Cytoc  44.7     9.8 0.00021   21.0   0.5   20   72-93     72-91  (97)
147 KOG4124|consensus               44.1      11 0.00023   26.0   0.7   26   46-71    392-417 (442)
148 KOG2071|consensus               44.0      17 0.00037   26.6   1.7   28   49-76    415-442 (579)
149 PRK04351 hypothetical protein;  42.6     7.8 0.00017   23.1  -0.1   33   52-93    112-144 (149)
150 KOG2231|consensus               42.4      27 0.00058   26.2   2.5   22   54-75    184-205 (669)
151 PF07295 DUF1451:  Protein of u  42.4     9.9 0.00021   22.6   0.3   35   48-93    108-143 (146)
152 PF07282 OrfB_Zn_ribbon:  Putat  42.0      23 0.00049   17.7   1.6   31   53-94     29-59  (69)
153 KOG0717|consensus               41.2      17 0.00036   26.0   1.3   22   82-103   293-314 (508)
154 COG1773 Rubredoxin [Energy pro  40.8      13 0.00029   18.2   0.6   13   52-64      3-15  (55)
155 PF02176 zf-TRAF:  TRAF-type zi  40.7     8.3 0.00018   18.7  -0.2   42   51-94      8-55  (60)
156 COG4338 Uncharacterized protei  40.4      11 0.00024   17.9   0.3   14   83-96     14-27  (54)
157 COG3091 SprT Zn-dependent meta  40.3      13 0.00029   22.3   0.6   35   50-90    115-149 (156)
158 PRK03681 hypA hydrogenase nick  39.7      18 0.00038   20.5   1.1   27   51-89     69-95  (114)
159 PF04810 zf-Sec23_Sec24:  Sec23  38.4      28 0.00061   15.6   1.5   12   49-60     21-32  (40)
160 PF10537 WAC_Acf1_DNA_bd:  ATP-  38.4      60  0.0013   18.1   3.0   38   51-90      2-39  (102)
161 PF11931 DUF3449:  Domain of un  37.9      11 0.00023   23.7   0.0   27   47-73     96-123 (196)
162 PTZ00448 hypothetical protein;  36.8      29 0.00062   24.1   1.8   23   52-74    314-336 (373)
163 PF01286 XPA_N:  XPA protein N-  36.5      14  0.0003   16.3   0.2   12   82-93      4-15  (34)
164 PRK00762 hypA hydrogenase nick  36.5      13 0.00027   21.4   0.1   32   51-89     69-100 (124)
165 PF10276 zf-CHCC:  Zinc-finger   36.3      12 0.00026   17.1  -0.0    9   53-61     30-38  (40)
166 PF09845 DUF2072:  Zn-ribbon co  36.2      17 0.00038   21.2   0.7   15   52-66      1-15  (131)
167 PF14353 CpXC:  CpXC protein     36.1      16 0.00034   20.9   0.5   19   76-94     33-51  (128)
168 PF13824 zf-Mss51:  Zinc-finger  35.8      30 0.00064   17.0   1.4    9   52-60     14-22  (55)
169 smart00731 SprT SprT homologue  35.6      14 0.00031   21.7   0.3   33   52-92    112-144 (146)
170 COG5188 PRP9 Splicing factor 3  35.5      28  0.0006   24.1   1.6   28   46-73    368-396 (470)
171 COG4640 Predicted membrane pro  35.5      27 0.00059   24.5   1.6   17   53-69     16-32  (465)
172 PLN03238 probable histone acet  35.4      34 0.00073   22.9   1.9   21   82-102    49-69  (290)
173 PF12760 Zn_Tnp_IS1595:  Transp  35.0     7.3 0.00016   18.1  -0.8    8   82-89     38-45  (46)
174 PF11789 zf-Nse:  Zinc-finger o  34.8      32 0.00069   16.9   1.4   33   49-86     21-53  (57)
175 COG1656 Uncharacterized conser  34.6      28  0.0006   21.3   1.4   19   82-100   131-149 (165)
176 PF04780 DUF629:  Protein of un  34.3      40 0.00087   24.2   2.3   30   48-77     53-83  (466)
177 PF03811 Zn_Tnp_IS1:  InsA N-te  34.1     5.7 0.00012   17.7  -1.2   13   74-87     23-35  (36)
178 PHA02998 RNA polymerase subuni  34.1     9.3  0.0002   23.6  -0.7   38   53-94    144-184 (195)
179 PF06397 Desulfoferrod_N:  Desu  34.0      18 0.00039   16.1   0.4   12   51-62      5-16  (36)
180 PLN02748 tRNA dimethylallyltra  33.1      34 0.00074   24.5   1.8   26   49-74    415-441 (468)
181 PF04423 Rad50_zn_hook:  Rad50   32.9      16 0.00035   17.5   0.2   13   83-95     22-34  (54)
182 KOG0717|consensus               32.8      32 0.00069   24.7   1.6   22   53-74    293-314 (508)
183 COG4888 Uncharacterized Zn rib  32.7       8 0.00017   21.5  -1.0   39   49-92     19-57  (104)
184 COG4896 Uncharacterized protei  32.4      27 0.00059   17.6   0.9    9   52-60     31-39  (68)
185 PRK00432 30S ribosomal protein  32.3      20 0.00043   17.2   0.4   12   79-91     36-47  (50)
186 KOG3014|consensus               31.8      28  0.0006   22.8   1.1   10   54-63     39-48  (257)
187 PF00301 Rubredoxin:  Rubredoxi  31.8      21 0.00045   16.9   0.4   36   53-90      2-43  (47)
188 TIGR00622 ssl1 transcription f  31.4      30 0.00066   19.7   1.1   48   54-104    57-104 (112)
189 PF08209 Sgf11:  Sgf11 (transcr  31.1      39 0.00084   14.7   1.2   22   52-74      4-25  (33)
190 cd00730 rubredoxin Rubredoxin;  29.3      24 0.00052   16.9   0.4   35   53-89      2-42  (50)
191 COG3357 Predicted transcriptio  28.6      27 0.00059   19.1   0.6   13   81-93     58-70  (97)
192 PF02891 zf-MIZ:  MIZ/SP-RING z  28.6      28 0.00061   16.5   0.6   23   62-89     27-49  (50)
193 PRK01343 zinc-binding protein;  28.4      38 0.00082   16.8   1.0   12   81-92      9-20  (57)
194 PLN03238 probable histone acet  28.2      78  0.0017   21.3   2.7   25   50-74     46-70  (290)
195 PLN03239 histone acetyltransfe  28.2      40 0.00087   23.2   1.5   22   81-102   106-127 (351)
196 PF01215 COX5B:  Cytochrome c o  28.0      24 0.00053   20.8   0.4   16   50-65    110-125 (136)
197 PF02748 PyrI_C:  Aspartate car  27.8      37 0.00081   16.4   1.0   18   48-65     31-48  (52)
198 KOG0978|consensus               27.8      20 0.00044   26.9   0.0   19   82-100   679-697 (698)
199 COG1326 Uncharacterized archae  27.6      53  0.0011   20.7   1.8   33   53-91      7-40  (201)
200 PLN00104 MYST -like histone ac  27.5      40 0.00086   24.1   1.4   22   81-102   198-219 (450)
201 TIGR00627 tfb4 transcription f  27.2      52  0.0011   21.9   1.8   24   53-91    256-279 (279)
202 PF14787 zf-CCHC_5:  GAG-polypr  27.1      30 0.00064   15.4   0.5   13   83-95      4-16  (36)
203 KOG2807|consensus               27.0      94   0.002   21.4   2.9   54   51-104   289-368 (378)
204 PF06220 zf-U1:  U1 zinc finger  27.0      67  0.0015   14.3   1.7   10   82-91      4-13  (38)
205 KOG2907|consensus               26.9      36 0.00077   19.4   0.9   39   53-93     75-114 (116)
206 COG1675 TFA1 Transcription ini  26.4      66  0.0014   19.9   2.0   33   48-90    109-141 (176)
207 PF08792 A2L_zn_ribbon:  A2L zi  26.2      31 0.00067   14.9   0.5   10   82-91     22-31  (33)
208 COG0846 SIR2 NAD-dependent pro  26.1      43 0.00093   21.9   1.3   38   47-89    117-154 (250)
209 TIGR03831 YgiT_finger YgiT-typ  26.1      29 0.00063   15.5   0.4    8   83-90     34-41  (46)
210 PTZ00064 histone acetyltransfe  26.0      48  0.0011   24.1   1.6   23   81-103   280-302 (552)
211 PF12907 zf-met2:  Zinc-binding  25.8      51  0.0011   15.0   1.2    6   54-59      3-8   (40)
212 KOG2747|consensus               25.4      56  0.0012   22.9   1.8   24   51-74    157-180 (396)
213 COG1571 Predicted DNA-binding   25.4      49  0.0011   23.4   1.5   31   53-95    351-381 (421)
214 COG3364 Zn-ribbon containing p  25.4      36 0.00077   19.1   0.7   14   52-65      2-15  (112)
215 TIGR00319 desulf_FeS4 desulfof  25.3      35 0.00075   14.6   0.5   12   51-62      6-17  (34)
216 PTZ00043 cytochrome c oxidase   25.3      35 0.00076   22.1   0.7   16   49-64    178-193 (268)
217 PF01096 TFIIS_C:  Transcriptio  25.1      30 0.00065   15.4   0.3   10   53-62     29-38  (39)
218 smart00440 ZnF_C2C2 C2C2 Zinc   25.0      33 0.00071   15.4   0.5   10   82-91     29-38  (40)
219 PRK14138 NAD-dependent deacety  24.8   1E+02  0.0022   20.0   2.8   38   47-89    114-151 (244)
220 cd01410 SIRT7 SIRT7: Eukaryoti  24.2 1.2E+02  0.0026   19.0   3.0   40   47-90     90-129 (206)
221 cd00974 DSRD Desulforedoxin (D  24.1      37 0.00081   14.5   0.5   12   51-62      3-14  (34)
222 KOG3507|consensus               23.9      43 0.00094   16.7   0.8   31   49-91     17-47  (62)
223 PF02591 DUF164:  Putative zinc  23.5      96  0.0021   14.8   2.0   32   54-90     24-55  (56)
224 PF08271 TF_Zn_Ribbon:  TFIIB z  23.0      42 0.00091   15.2   0.6    9   82-90      1-9   (43)
225 PRK08222 hydrogenase 4 subunit  23.0      65  0.0014   19.8   1.6   18   81-98    114-131 (181)
226 KOG1842|consensus               22.9      52  0.0011   23.6   1.2   26   79-105    14-39  (505)
227 cd01413 SIR2_Af2 SIR2_Af2: Arc  22.8   1E+02  0.0022   19.5   2.5   39   46-90    107-145 (222)
228 TIGR00244 transcriptional regu  21.6      41 0.00089   20.1   0.5   12   82-93     29-40  (147)
229 PF04438 zf-HIT:  HIT zinc fing  21.5      39 0.00085   14.2   0.3   11   82-92     14-24  (30)
230 PF02146 SIR2:  Sir2 family;  I  21.3      69  0.0015   19.3   1.5   39   47-90    100-138 (178)
231 TIGR00515 accD acetyl-CoA carb  21.2      79  0.0017   21.1   1.8   32   53-94     27-58  (285)
232 PF14369 zf-RING_3:  zinc-finge  21.2      45 0.00098   14.6   0.5   10   83-92     23-32  (35)
233 KOG4727|consensus               21.0      63  0.0014   20.0   1.2   23   51-73     74-96  (193)
234 TIGR01384 TFS_arch transcripti  20.6      39 0.00085   18.5   0.3   12   52-63     16-27  (104)
235 PRK11823 DNA repair protein Ra  20.5      70  0.0015   22.7   1.5   24   52-90      7-30  (446)
236 PF12773 DZR:  Double zinc ribb  20.1      63  0.0014   14.9   0.9   10   82-91     30-39  (50)

No 1  
>KOG2462|consensus
Probab=99.78  E-value=6.6e-20  Score=114.75  Aligned_cols=95  Identities=19%  Similarity=0.279  Sum_probs=76.8

Q ss_pred             ceecccCCceeeeeEeeeeccccCCcC-----cccccCccCcceeccCCCceecccccccccCHHHHHHHHHHHcCCCCC
Q psy12021          7 AICVAKSTSITETCIVIRSLGVDKSLD-----TNVLNFINWPTVRQYNSGMFPCEVCGKKYKYKWGLSRHKRDECGQEPK   81 (106)
Q Consensus         7 ~~c~~~~~~~~~~~~~~~~~~~~~~~~-----~~~~~~~~~~~~~~~~~~~~~C~~C~~~f~~~~~l~~h~~~h~~~~~~   81 (106)
                      .+|++.+.+...+..||+.......-.     ...-=++.-+.++|+|+|||.|..|+|.|.++++|+.||++|.+.++ 
T Consensus       165 ~~C~K~YvSmpALkMHirTH~l~c~C~iCGKaFSRPWLLQGHiRTHTGEKPF~C~hC~kAFADRSNLRAHmQTHS~~K~-  243 (279)
T KOG2462|consen  165 KYCGKVYVSMPALKMHIRTHTLPCECGICGKAFSRPWLLQGHIRTHTGEKPFSCPHCGKAFADRSNLRAHMQTHSDVKK-  243 (279)
T ss_pred             CCCCceeeehHHHhhHhhccCCCcccccccccccchHHhhcccccccCCCCccCCcccchhcchHHHHHHHHhhcCCcc-
Confidence            488888888888888888776432211     22222566788999999999999999999999999999999999887 


Q ss_pred             cccCccccccCChHHHHHHHH
Q psy12021         82 YQCPQCPYRASQKATLKTHMA  102 (106)
Q Consensus        82 ~~C~~C~k~f~~~~~l~~H~~  102 (106)
                      |+|..|+|.|.+.+.|..|..
T Consensus       244 ~qC~~C~KsFsl~SyLnKH~E  264 (279)
T KOG2462|consen  244 HQCPRCGKSFALKSYLNKHSE  264 (279)
T ss_pred             ccCcchhhHHHHHHHHHHhhh
Confidence            999999999999999998865


No 2  
>KOG2462|consensus
Probab=99.70  E-value=1e-17  Score=105.01  Aligned_cols=58  Identities=28%  Similarity=0.709  Sum_probs=53.3

Q ss_pred             cCCCceecccccccccCHHHHHHHHHHHcCCCCCcccCccccccCChHHHHHHHHhhcC
Q psy12021         48 YNSGMFPCEVCGKKYKYKWGLSRHKRDECGQEPKYQCPQCPYRASQKATLKTHMAIKHS  106 (106)
Q Consensus        48 ~~~~~~~C~~C~~~f~~~~~l~~h~~~h~~~~~~~~C~~C~k~f~~~~~l~~H~~~hh~  106 (106)
                      +..-+.+|.+|||.|..+..|+.|+|+|+|++| |.|+.|+|+|..+++|+.|+++|.+
T Consensus       183 TH~l~c~C~iCGKaFSRPWLLQGHiRTHTGEKP-F~C~hC~kAFADRSNLRAHmQTHS~  240 (279)
T KOG2462|consen  183 THTLPCECGICGKAFSRPWLLQGHIRTHTGEKP-FSCPHCGKAFADRSNLRAHMQTHSD  240 (279)
T ss_pred             ccCCCcccccccccccchHHhhcccccccCCCC-ccCCcccchhcchHHHHHHHHhhcC
Confidence            334679999999999999999999999999776 9999999999999999999999853


No 3  
>KOG3623|consensus
Probab=99.34  E-value=1.9e-13  Score=95.37  Aligned_cols=62  Identities=29%  Similarity=0.599  Sum_probs=49.1

Q ss_pred             ccCcceeccCCCceecccccccccCHHHHHHHHHHHcCCCCCcccCccccccCChHHHHHHHH
Q psy12021         40 INWPTVRQYNSGMFPCEVCGKKYKYKWGLSRHKRDECGQEPKYQCPQCPYRASQKATLKTHMA  102 (106)
Q Consensus        40 ~~~~~~~~~~~~~~~C~~C~~~f~~~~~l~~h~~~h~~~~~~~~C~~C~k~f~~~~~l~~H~~  102 (106)
                      +-.|.-.|+|.+||.|.+|.|+|+.+..|..|+|.|.|+++ |+|+.|+|.|+...++..||.
T Consensus       910 LaRHKYEHsGqRPyqC~iCkKAFKHKHHLtEHkRLHSGEKP-fQCdKClKRFSHSGSYSQHMN  971 (1007)
T KOG3623|consen  910 LARHKYEHSGQRPYQCIICKKAFKHKHHLTEHKRLHSGEKP-FQCDKCLKRFSHSGSYSQHMN  971 (1007)
T ss_pred             HHHhhhhhcCCCCcccchhhHhhhhhhhhhhhhhhccCCCc-chhhhhhhhcccccchHhhhc
Confidence            34455667888888888888888888888888888888665 888888888888888887764


No 4  
>PHA02768 hypothetical protein; Provisional
Probab=99.32  E-value=7.9e-13  Score=64.60  Aligned_cols=43  Identities=16%  Similarity=0.414  Sum_probs=39.3

Q ss_pred             eecccccccccCHHHHHHHHHHHcCCCCCcccCccccccCChHHHH
Q psy12021         53 FPCEVCGKKYKYKWGLSRHKRDECGQEPKYQCPQCPYRASQKATLK   98 (106)
Q Consensus        53 ~~C~~C~~~f~~~~~l~~h~~~h~~~~~~~~C~~C~k~f~~~~~l~   98 (106)
                      |+|+.||+.|...+.|..|+++|+  ++ ++|..|++.|.+.+.|.
T Consensus         6 y~C~~CGK~Fs~~~~L~~H~r~H~--k~-~kc~~C~k~f~~~s~l~   48 (55)
T PHA02768          6 YECPICGEIYIKRKSMITHLRKHN--TN-LKLSNCKRISLRTGEYI   48 (55)
T ss_pred             cCcchhCCeeccHHHHHHHHHhcC--Cc-ccCCcccceecccceeE
Confidence            899999999999999999999997  44 99999999999887764


No 5  
>KOG3576|consensus
Probab=99.28  E-value=3.4e-13  Score=81.86  Aligned_cols=67  Identities=27%  Similarity=0.593  Sum_probs=54.3

Q ss_pred             CccCcceeccCCCceecccccccccCHHHHHHHHHHHcCCCCCcccCccccccCChHHHHHHHHhhcC
Q psy12021         39 FINWPTVRQYNSGMFPCEVCGKKYKYKWGLSRHKRDECGQEPKYQCPQCPYRASQKATLKTHMAIKHS  106 (106)
Q Consensus        39 ~~~~~~~~~~~~~~~~C~~C~~~f~~~~~l~~h~~~h~~~~~~~~C~~C~k~f~~~~~l~~H~~~hh~  106 (106)
                      .+..++.-|...+.+.|..||+.|....+|++|+++|+|.+| |+|..|+|+|.++.+|..|.+.-||
T Consensus       132 mlnrh~kch~~vkr~lct~cgkgfndtfdlkrh~rthtgvrp-ykc~~c~kaftqrcsleshl~kvhg  198 (267)
T KOG3576|consen  132 MLNRHLKCHSDVKRHLCTFCGKGFNDTFDLKRHTRTHTGVRP-YKCSLCEKAFTQRCSLESHLKKVHG  198 (267)
T ss_pred             HHHHHhhhccHHHHHHHhhccCcccchhhhhhhhccccCccc-cchhhhhHHHHhhccHHHHHHHHcC
Confidence            334455556667778888899999999999999999999665 9999999999999999998886664


No 6  
>PHA00733 hypothetical protein
Probab=99.19  E-value=4.8e-11  Score=68.77  Aligned_cols=56  Identities=20%  Similarity=0.361  Sum_probs=50.4

Q ss_pred             cCCCceecccccccccCHHHHHHHHHHHcCCCCCcccCccccccCChHHHHHHHHhhcC
Q psy12021         48 YNSGMFPCEVCGKKYKYKWGLSRHKRDECGQEPKYQCPQCPYRASQKATLKTHMAIKHS  106 (106)
Q Consensus        48 ~~~~~~~C~~C~~~f~~~~~l~~h~~~h~~~~~~~~C~~C~k~f~~~~~l~~H~~~hh~  106 (106)
                      .+.++|.|+.|++.|.....|..|++.+.  .+ |.|+.|++.|.....|..|+...|+
T Consensus        69 ~~~kPy~C~~Cgk~Fss~s~L~~H~r~h~--~~-~~C~~CgK~F~~~~sL~~H~~~~h~  124 (128)
T PHA00733         69 KAVSPYVCPLCLMPFSSSVSLKQHIRYTE--HS-KVCPVCGKEFRNTDSTLDHVCKKHN  124 (128)
T ss_pred             CCCCCccCCCCCCcCCCHHHHHHHHhcCC--cC-ccCCCCCCccCCHHHHHHHHHHhcC
Confidence            45789999999999999999999999762  44 9999999999999999999998875


No 7  
>KOG3623|consensus
Probab=99.11  E-value=4.2e-11  Score=84.05  Aligned_cols=58  Identities=33%  Similarity=0.702  Sum_probs=53.8

Q ss_pred             cCCCceecccccccccCHHHHHHHHHHHcCCCCCcccCccccccCChHHHHHHHHhhcC
Q psy12021         48 YNSGMFPCEVCGKKYKYKWGLSRHKRDECGQEPKYQCPQCPYRASQKATLKTHMAIKHS  106 (106)
Q Consensus        48 ~~~~~~~C~~C~~~f~~~~~l~~h~~~h~~~~~~~~C~~C~k~f~~~~~l~~H~~~hh~  106 (106)
                      +....|.|+.|+|+|.-.+.|.+|.--|+|.++ |+|.+|.|+|..+..|..|+|.|.|
T Consensus       890 te~gmyaCDqCDK~FqKqSSLaRHKYEHsGqRP-yqC~iCkKAFKHKHHLtEHkRLHSG  947 (1007)
T KOG3623|consen  890 TEDGMYACDQCDKAFQKQSSLARHKYEHSGQRP-YQCIICKKAFKHKHHLTEHKRLHSG  947 (1007)
T ss_pred             CccccchHHHHHHHHHhhHHHHHhhhhhcCCCC-cccchhhHhhhhhhhhhhhhhhccC
Confidence            556789999999999999999999999999555 9999999999999999999999976


No 8  
>KOG3576|consensus
Probab=99.03  E-value=5.7e-11  Score=72.34  Aligned_cols=57  Identities=26%  Similarity=0.480  Sum_probs=53.5

Q ss_pred             CCCceecccccccccCHHHHHHHHHHHcCCCCCcccCccccccCChHHHHHHHHhhcC
Q psy12021         49 NSGMFPCEVCGKKYKYKWGLSRHKRDECGQEPKYQCPQCPYRASQKATLKTHMAIKHS  106 (106)
Q Consensus        49 ~~~~~~C~~C~~~f~~~~~l~~h~~~h~~~~~~~~C~~C~k~f~~~~~l~~H~~~hh~  106 (106)
                      +...|.|..|+|.|..+..|.+|++-|...++ +.|..|||.|...-.|.+|.|+|+|
T Consensus       114 d~d~ftCrvCgK~F~lQRmlnrh~kch~~vkr-~lct~cgkgfndtfdlkrh~rthtg  170 (267)
T KOG3576|consen  114 DQDSFTCRVCGKKFGLQRMLNRHLKCHSDVKR-HLCTFCGKGFNDTFDLKRHTRTHTG  170 (267)
T ss_pred             CCCeeeeehhhhhhhHHHHHHHHhhhccHHHH-HHHhhccCcccchhhhhhhhccccC
Confidence            45679999999999999999999999998787 9999999999999999999999986


No 9  
>KOG1074|consensus
Probab=98.96  E-value=9.9e-11  Score=83.04  Aligned_cols=52  Identities=33%  Similarity=0.637  Sum_probs=48.3

Q ss_pred             eecccccccccCHHHHHHHHHHHcCCCCCcccCccccccCChHHHHHHHHhhc
Q psy12021         53 FPCEVCGKKYKYKWGLSRHKRDECGQEPKYQCPQCPYRASQKATLKTHMAIKH  105 (106)
Q Consensus        53 ~~C~~C~~~f~~~~~l~~h~~~h~~~~~~~~C~~C~k~f~~~~~l~~H~~~hh  105 (106)
                      .+|.+|.|+|.+.+.|+.|.|+|+|+.+ |+|.+||..|+.+.+|+.|...|+
T Consensus       354 hkCr~CakvfgS~SaLqiHlRSHTGERP-fqCnvCG~~FSTkGNLKvH~~rH~  405 (958)
T KOG1074|consen  354 HKCRFCAKVFGSDSALQIHLRSHTGERP-FQCNVCGNRFSTKGNLKVHFQRHR  405 (958)
T ss_pred             chhhhhHhhcCchhhhhhhhhccCCCCC-eeecccccccccccceeeeeeecc
Confidence            5799999999999999999999999665 999999999999999999987775


No 10 
>PF13465 zf-H2C2_2:  Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A ....
Probab=98.94  E-value=7.1e-10  Score=46.67  Aligned_cols=26  Identities=42%  Similarity=0.898  Sum_probs=22.8

Q ss_pred             HHHHHHHHHcCCCCCcccCccccccCC
Q psy12021         67 GLSRHKRDECGQEPKYQCPQCPYRASQ   93 (106)
Q Consensus        67 ~l~~h~~~h~~~~~~~~C~~C~k~f~~   93 (106)
                      +|..|+++|+|+++ |.|+.|++.|.+
T Consensus         1 ~l~~H~~~H~~~k~-~~C~~C~k~F~~   26 (26)
T PF13465_consen    1 NLRRHMRTHTGEKP-YKCPYCGKSFSN   26 (26)
T ss_dssp             HHHHHHHHHSSSSS-EEESSSSEEESS
T ss_pred             CHHHHhhhcCCCCC-CCCCCCcCeeCc
Confidence            47899999999776 999999999964


No 11 
>KOG1074|consensus
Probab=98.91  E-value=4e-10  Score=80.05  Aligned_cols=62  Identities=24%  Similarity=0.542  Sum_probs=30.2

Q ss_pred             cceeccCCCceecccccccccCHHHHHHHHHHHcCCCC----CcccC---ccccccCChHHHHHHHHhhc
Q psy12021         43 PTVRQYNSGMFPCEVCGKKYKYKWGLSRHKRDECGQEP----KYQCP---QCPYRASQKATLKTHMAIKH  105 (106)
Q Consensus        43 ~~~~~~~~~~~~C~~C~~~f~~~~~l~~h~~~h~~~~~----~~~C~---~C~k~f~~~~~l~~H~~~hh  105 (106)
                      |.++|+|++||.|.+||++|..+.+|+.|+.+|.. ++    ++.|+   +|-+.|...-.|+.|+++|.
T Consensus       624 HyrtHtGERPFkCKiCgRAFtTkGNLkaH~~vHka-~p~~R~q~ScP~~~ic~~kftn~V~lpQhIriH~  692 (958)
T KOG1074|consen  624 HYRTHTGERPFKCKICGRAFTTKGNLKAHMSVHKA-KPPARVQFSCPSTFICQKKFTNAVTLPQHIRIHL  692 (958)
T ss_pred             hhhcccCcCccccccccchhccccchhhccccccc-CccccccccCCchhhhcccccccccccceEEeec
Confidence            44445555555555555555555555555555432 11    14444   45555555555555555543


No 12 
>PHA00732 hypothetical protein
Probab=98.77  E-value=5e-09  Score=55.47  Aligned_cols=45  Identities=29%  Similarity=0.611  Sum_probs=37.6

Q ss_pred             ceecccccccccCHHHHHHHHHH-HcCCCCCcccCccccccCChHHHHHHHHh
Q psy12021         52 MFPCEVCGKKYKYKWGLSRHKRD-ECGQEPKYQCPQCPYRASQKATLKTHMAI  103 (106)
Q Consensus        52 ~~~C~~C~~~f~~~~~l~~h~~~-h~~~~~~~~C~~C~k~f~~~~~l~~H~~~  103 (106)
                      ||.|..|++.|.....|..|++. |.   + +.|+.|++.|.+   +..|.+.
T Consensus         1 py~C~~Cgk~F~s~s~Lk~H~r~~H~---~-~~C~~CgKsF~~---l~~H~~~   46 (79)
T PHA00732          1 MFKCPICGFTTVTLFALKQHARRNHT---L-TKCPVCNKSYRR---LNQHFYS   46 (79)
T ss_pred             CccCCCCCCccCCHHHHHHHhhcccC---C-CccCCCCCEeCC---hhhhhcc
Confidence            58999999999999999999985 53   3 689999999984   6667654


No 13 
>PHA00616 hypothetical protein
Probab=98.71  E-value=8.7e-09  Score=48.16  Aligned_cols=34  Identities=21%  Similarity=0.325  Sum_probs=30.6

Q ss_pred             ceecccccccccCHHHHHHHHHHHcCCCCCcccCc
Q psy12021         52 MFPCEVCGKKYKYKWGLSRHKRDECGQEPKYQCPQ   86 (106)
Q Consensus        52 ~~~C~~C~~~f~~~~~l~~h~~~h~~~~~~~~C~~   86 (106)
                      ||.|..||+.|..++.|..|++.|+|+++ +.|+.
T Consensus         1 pYqC~~CG~~F~~~s~l~~H~r~~hg~~~-~~~~~   34 (44)
T PHA00616          1 MYQCLRCGGIFRKKKEVIEHLLSVHKQNK-LTLEY   34 (44)
T ss_pred             CCccchhhHHHhhHHHHHHHHHHhcCCCc-cceeE
Confidence            68999999999999999999999999776 88765


No 14 
>PF05605 zf-Di19:  Drought induced 19 protein (Di19), zinc-binding;  InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins. Di19 has been found to be strongly expressed in both the roots and leaves of Arabidopsis thaliana during progressive drought [], whilst RING finger proteins are thought to play a role in spermatogenesis. The precise function is unknown.
Probab=98.65  E-value=7.3e-08  Score=47.52  Aligned_cols=52  Identities=31%  Similarity=0.586  Sum_probs=40.9

Q ss_pred             ceecccccccccCHHHHHHHHHHH-cCCCCCcccCccccccCChHHHHHHHHhhcC
Q psy12021         52 MFPCEVCGKKYKYKWGLSRHKRDE-CGQEPKYQCPQCPYRASQKATLKTHMAIKHS  106 (106)
Q Consensus        52 ~~~C~~C~~~f~~~~~l~~h~~~h-~~~~~~~~C~~C~k~f~~~~~l~~H~~~hh~  106 (106)
                      .|.|+.|++. .+...|..|.... ..+...+.|+.|...+.  ..|..|+..+|+
T Consensus         2 ~f~CP~C~~~-~~~~~L~~H~~~~H~~~~~~v~CPiC~~~~~--~~l~~Hl~~~H~   54 (54)
T PF05605_consen    2 SFTCPYCGKG-FSESSLVEHCEDEHRSESKNVVCPICSSRVT--DNLIRHLNSQHR   54 (54)
T ss_pred             CcCCCCCCCc-cCHHHHHHHHHhHCcCCCCCccCCCchhhhh--hHHHHHHHHhcC
Confidence            4899999994 5677899997754 44444599999998655  489999999886


No 15 
>KOG3608|consensus
Probab=98.65  E-value=1e-09  Score=71.80  Aligned_cols=102  Identities=22%  Similarity=0.274  Sum_probs=55.7

Q ss_pred             ccccceecccCCceeeeeEeeeeccccCCcC----------------------cccccCccCcceeccCCCceecccccc
Q psy12021          3 VCSHAICVAKSTSITETCIVIRSLGVDKSLD----------------------TNVLNFINWPTVRQYNSGMFPCEVCGK   60 (106)
Q Consensus         3 ~C~~~~c~~~~~~~~~~~~~~~~~~~~~~~~----------------------~~~~~~~~~~~~~~~~~~~~~C~~C~~   60 (106)
                      .|.|+-|...|.++.+...++...+...+.+                      ...+..+..+.+.|++++...|..||.
T Consensus       136 ~C~WedCe~~F~s~~ef~dHV~~H~l~ceyd~~~~~~D~~pv~~C~W~~Ct~~~~~k~~LreH~r~Hs~eKvvACp~Cg~  215 (467)
T KOG3608|consen  136 RCGWEDCEREFVSIVEFQDHVVKHALFCEYDIQKTPEDERPVTMCNWAMCTKHMGNKYRLREHIRTHSNEKVVACPHCGE  215 (467)
T ss_pred             ccChhhcCCcccCHHHHHHHHHHhhhhhhhhhhhCCCCCCceeeccchhhhhhhccHHHHHHHHHhcCCCeEEecchHHH
Confidence            4777788877777777766555444432221                      112233444555566666666666666


Q ss_pred             cccCHHHHHHHHHHHc-CCCCCcccCccccccCChHHHHHHHHhh
Q psy12021         61 KYKYKWGLSRHKRDEC-GQEPKYQCPQCPYRASQKATLKTHMAIK  104 (106)
Q Consensus        61 ~f~~~~~l~~h~~~h~-~~~~~~~C~~C~k~f~~~~~l~~H~~~h  104 (106)
                      .|..+..|-+|.+..+ ..+.+|+|..|.|.|.....|..|+..|
T Consensus       216 ~F~~~tkl~DH~rRqt~l~~n~fqC~~C~KrFaTeklL~~Hv~rH  260 (467)
T KOG3608|consen  216 LFRTKTKLFDHLRRQTELNTNSFQCAQCFKRFATEKLLKSHVVRH  260 (467)
T ss_pred             HhccccHHHHHHHhhhhhcCCchHHHHHHHHHhHHHHHHHHHHHh
Confidence            6666666666655432 1223355555555555555555554443


No 16 
>KOG3993|consensus
Probab=98.64  E-value=1.2e-08  Score=68.10  Aligned_cols=55  Identities=22%  Similarity=0.457  Sum_probs=47.3

Q ss_pred             CceecccccccccCHHHHHHHHHHHcC--------CCC------------------------CcccCccccccCChHHHH
Q psy12021         51 GMFPCEVCGKKYKYKWGLSRHKRDECG--------QEP------------------------KYQCPQCPYRASQKATLK   98 (106)
Q Consensus        51 ~~~~C~~C~~~f~~~~~l~~h~~~h~~--------~~~------------------------~~~C~~C~k~f~~~~~l~   98 (106)
                      ..|.|.+|+|+|....+|..|+|+|.-        ..+                        .|.|..|+|.|.+..+|.
T Consensus       294 vEYrCPEC~KVFsCPANLASHRRWHKPR~eaa~a~~~P~k~~~~~rae~~ea~rsg~dss~gi~~C~~C~KkFrRqAYLr  373 (500)
T KOG3993|consen  294 VEYRCPECDKVFSCPANLASHRRWHKPRPEAAKAGSPPPKQAVETRAEVQEAERSGDDSSSGIFSCHTCGKKFRRQAYLR  373 (500)
T ss_pred             eeecCCcccccccCchhhhhhhcccCCchhhhhcCCCChhhhhhhhhhhhhccccCCcccCceeecHHhhhhhHHHHHHH
Confidence            459999999999999999999999831        111                        278999999999999999


Q ss_pred             HHHHhhc
Q psy12021         99 THMAIKH  105 (106)
Q Consensus        99 ~H~~~hh  105 (106)
                      .|+..|+
T Consensus       374 KHqlthq  380 (500)
T KOG3993|consen  374 KHQLTHQ  380 (500)
T ss_pred             HhHHhhh
Confidence            9998886


No 17 
>PHA00616 hypothetical protein
Probab=98.57  E-value=2.7e-08  Score=46.49  Aligned_cols=26  Identities=27%  Similarity=0.447  Sum_probs=24.8

Q ss_pred             CcccCccccccCChHHHHHHHHhhcC
Q psy12021         81 KYQCPQCPYRASQKATLKTHMAIKHS  106 (106)
Q Consensus        81 ~~~C~~C~k~f~~~~~l~~H~~~hh~  106 (106)
                      ||+|+.||+.|...+.|..|++.|||
T Consensus         1 pYqC~~CG~~F~~~s~l~~H~r~~hg   26 (44)
T PHA00616          1 MYQCLRCGGIFRKKKEVIEHLLSVHK   26 (44)
T ss_pred             CCccchhhHHHhhHHHHHHHHHHhcC
Confidence            59999999999999999999999986


No 18 
>KOG3608|consensus
Probab=98.53  E-value=6.9e-09  Score=67.99  Aligned_cols=52  Identities=19%  Similarity=0.554  Sum_probs=28.5

Q ss_pred             eecccccccccCHHHHHHHHHHHcCCCCCcccCccccccCChHHHHHHHHhh
Q psy12021         53 FPCEVCGKKYKYKWGLSRHKRDECGQEPKYQCPQCPYRASQKATLKTHMAIK  104 (106)
Q Consensus        53 ~~C~~C~~~f~~~~~l~~h~~~h~~~~~~~~C~~C~k~f~~~~~l~~H~~~h  104 (106)
                      |.|+.|.......+.|.+|++.-+...+||+|+.|.+.|.+.+.|++|...|
T Consensus       264 ykCplCdmtc~~~ssL~~H~r~rHs~dkpfKCd~Cd~~c~~esdL~kH~~~H  315 (467)
T KOG3608|consen  264 YKCPLCDMTCSSASSLTTHIRYRHSKDKPFKCDECDTRCVRESDLAKHVQVH  315 (467)
T ss_pred             ccccccccCCCChHHHHHHHHhhhccCCCccccchhhhhccHHHHHHHHHhc
Confidence            4455555555555555555553333333466666666666666666666554


No 19 
>PF00096 zf-C2H2:  Zinc finger, C2H2 type;  InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger: #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C], where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter []. This entry represents the classical C2H2 zinc finger domain.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0005622 intracellular; PDB: 2D9H_A 2EPC_A 1SP1_A 1VA3_A 2WBT_B 2ELR_A 2YTP_A 2YTT_A 1VA1_A 2ELO_A ....
Probab=98.46  E-value=1.3e-07  Score=38.46  Aligned_cols=22  Identities=45%  Similarity=0.807  Sum_probs=11.9

Q ss_pred             cccCccccccCChHHHHHHHHh
Q psy12021         82 YQCPQCPYRASQKATLKTHMAI  103 (106)
Q Consensus        82 ~~C~~C~k~f~~~~~l~~H~~~  103 (106)
                      |.|+.|++.|.....|..|++.
T Consensus         1 y~C~~C~~~f~~~~~l~~H~~~   22 (23)
T PF00096_consen    1 YKCPICGKSFSSKSNLKRHMRR   22 (23)
T ss_dssp             EEETTTTEEESSHHHHHHHHHH
T ss_pred             CCCCCCCCccCCHHHHHHHHhH
Confidence            3455555555555555555554


No 20 
>PHA02768 hypothetical protein; Provisional
Probab=98.44  E-value=1.2e-07  Score=46.40  Aligned_cols=24  Identities=25%  Similarity=0.610  Sum_probs=23.2

Q ss_pred             cccCccccccCChHHHHHHHHhhc
Q psy12021         82 YQCPQCPYRASQKATLKTHMAIKH  105 (106)
Q Consensus        82 ~~C~~C~k~f~~~~~l~~H~~~hh  105 (106)
                      |.|++||+.|.+.++|..|+++|+
T Consensus         6 y~C~~CGK~Fs~~~~L~~H~r~H~   29 (55)
T PHA02768          6 YECPICGEIYIKRKSMITHLRKHN   29 (55)
T ss_pred             cCcchhCCeeccHHHHHHHHHhcC
Confidence            899999999999999999999986


No 21 
>PF00096 zf-C2H2:  Zinc finger, C2H2 type;  InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger: #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C], where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter []. This entry represents the classical C2H2 zinc finger domain.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0005622 intracellular; PDB: 2D9H_A 2EPC_A 1SP1_A 1VA3_A 2WBT_B 2ELR_A 2YTP_A 2YTT_A 1VA1_A 2ELO_A ....
Probab=98.41  E-value=2.8e-07  Score=37.41  Aligned_cols=23  Identities=39%  Similarity=0.895  Sum_probs=21.5

Q ss_pred             eecccccccccCHHHHHHHHHHH
Q psy12021         53 FPCEVCGKKYKYKWGLSRHKRDE   75 (106)
Q Consensus        53 ~~C~~C~~~f~~~~~l~~h~~~h   75 (106)
                      |.|+.|++.|..+..|..|++.|
T Consensus         1 y~C~~C~~~f~~~~~l~~H~~~H   23 (23)
T PF00096_consen    1 YKCPICGKSFSSKSNLKRHMRRH   23 (23)
T ss_dssp             EEETTTTEEESSHHHHHHHHHHH
T ss_pred             CCCCCCCCccCCHHHHHHHHhHC
Confidence            78999999999999999999875


No 22 
>PF13912 zf-C2H2_6:  C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B.
Probab=98.31  E-value=4e-07  Score=38.39  Aligned_cols=25  Identities=20%  Similarity=0.456  Sum_probs=15.8

Q ss_pred             CcccCccccccCChHHHHHHHHhhc
Q psy12021         81 KYQCPQCPYRASQKATLKTHMAIKH  105 (106)
Q Consensus        81 ~~~C~~C~k~f~~~~~l~~H~~~hh  105 (106)
                      ||.|..|++.|.....|..|++.|+
T Consensus         1 ~~~C~~C~~~F~~~~~l~~H~~~h~   25 (27)
T PF13912_consen    1 PFECDECGKTFSSLSALREHKRSHC   25 (27)
T ss_dssp             SEEETTTTEEESSHHHHHHHHCTTT
T ss_pred             CCCCCccCCccCChhHHHHHhHHhc
Confidence            3566666666666666666666554


No 23 
>PF13894 zf-C2H2_4:  C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A ....
Probab=98.29  E-value=6.5e-07  Score=36.40  Aligned_cols=24  Identities=38%  Similarity=0.790  Sum_probs=13.3

Q ss_pred             cccCccccccCChHHHHHHHHhhc
Q psy12021         82 YQCPQCPYRASQKATLKTHMAIKH  105 (106)
Q Consensus        82 ~~C~~C~k~f~~~~~l~~H~~~hh  105 (106)
                      |.|+.|++.|.....|..|++.+|
T Consensus         1 ~~C~~C~~~~~~~~~l~~H~~~~H   24 (24)
T PF13894_consen    1 FQCPICGKSFRSKSELRQHMRTHH   24 (24)
T ss_dssp             EE-SSTS-EESSHHHHHHHHHHHS
T ss_pred             CCCcCCCCcCCcHHHHHHHHHhhC
Confidence            456666666666666666666554


No 24 
>PHA00733 hypothetical protein
Probab=98.24  E-value=6.2e-07  Score=51.78  Aligned_cols=55  Identities=18%  Similarity=0.179  Sum_probs=43.3

Q ss_pred             CCCceecccccccccCHHHHHHH--HHH---HcCCCCCcccCccccccCChHHHHHHHHhh
Q psy12021         49 NSGMFPCEVCGKKYKYKWGLSRH--KRD---ECGQEPKYQCPQCPYRASQKATLKTHMAIK  104 (106)
Q Consensus        49 ~~~~~~C~~C~~~f~~~~~l~~h--~~~---h~~~~~~~~C~~C~k~f~~~~~l~~H~~~h  104 (106)
                      ..+++.|.+|.+.|..+..|..+  +..   +.+ .+||.|+.||+.|.....|..|++.+
T Consensus        37 ~~~~~~~~~~~~~~~~~~~l~~~~~l~~~~~~~~-~kPy~C~~Cgk~Fss~s~L~~H~r~h   96 (128)
T PHA00733         37 EQKRLIRAVVKTLIYNPQLLDESSYLYKLLTSKA-VSPYVCPLCLMPFSSSVSLKQHIRYT   96 (128)
T ss_pred             hhhhHHHHHHhhhccChhhhcchHHHHhhcccCC-CCCccCCCCCCcCCCHHHHHHHHhcC
Confidence            35678999999999888887766  221   233 34599999999999999999999854


No 25 
>PF13465 zf-H2C2_2:  Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A ....
Probab=98.16  E-value=2.5e-07  Score=38.78  Aligned_cols=23  Identities=17%  Similarity=0.443  Sum_probs=20.0

Q ss_pred             CcceeccCCCceecccccccccC
Q psy12021         42 WPTVRQYNSGMFPCEVCGKKYKY   64 (106)
Q Consensus        42 ~~~~~~~~~~~~~C~~C~~~f~~   64 (106)
                      .+++.|++++||.|+.|++.|..
T Consensus         4 ~H~~~H~~~k~~~C~~C~k~F~~   26 (26)
T PF13465_consen    4 RHMRTHTGEKPYKCPYCGKSFSN   26 (26)
T ss_dssp             HHHHHHSSSSSEEESSSSEEESS
T ss_pred             HHhhhcCCCCCCCCCCCcCeeCc
Confidence            46678999999999999999963


No 26 
>PF13894 zf-C2H2_4:  C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A ....
Probab=98.08  E-value=4.3e-06  Score=33.84  Aligned_cols=24  Identities=38%  Similarity=0.847  Sum_probs=20.2

Q ss_pred             eecccccccccCHHHHHHHHHHHc
Q psy12021         53 FPCEVCGKKYKYKWGLSRHKRDEC   76 (106)
Q Consensus        53 ~~C~~C~~~f~~~~~l~~h~~~h~   76 (106)
                      |.|+.|++.|.+...|..|++.++
T Consensus         1 ~~C~~C~~~~~~~~~l~~H~~~~H   24 (24)
T PF13894_consen    1 FQCPICGKSFRSKSELRQHMRTHH   24 (24)
T ss_dssp             EE-SSTS-EESSHHHHHHHHHHHS
T ss_pred             CCCcCCCCcCCcHHHHHHHHHhhC
Confidence            689999999999999999998874


No 27 
>PF13912 zf-C2H2_6:  C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B.
Probab=98.07  E-value=2.8e-06  Score=35.75  Aligned_cols=26  Identities=38%  Similarity=0.860  Sum_probs=23.5

Q ss_pred             ceecccccccccCHHHHHHHHHHHcC
Q psy12021         52 MFPCEVCGKKYKYKWGLSRHKRDECG   77 (106)
Q Consensus        52 ~~~C~~C~~~f~~~~~l~~h~~~h~~   77 (106)
                      +|.|..|++.|.+...|..|++.|.+
T Consensus         1 ~~~C~~C~~~F~~~~~l~~H~~~h~~   26 (27)
T PF13912_consen    1 PFECDECGKTFSSLSALREHKRSHCS   26 (27)
T ss_dssp             SEEETTTTEEESSHHHHHHHHCTTTT
T ss_pred             CCCCCccCCccCChhHHHHHhHHhcC
Confidence            58999999999999999999988753


No 28 
>PF12756 zf-C2H2_2:  C2H2 type zinc-finger (2 copies); PDB: 2DMI_A.
Probab=97.91  E-value=9.2e-06  Score=44.42  Aligned_cols=23  Identities=30%  Similarity=0.722  Sum_probs=18.5

Q ss_pred             cccCccccccCChHHHHHHHHhh
Q psy12021         82 YQCPQCPYRASQKATLKTHMAIK  104 (106)
Q Consensus        82 ~~C~~C~k~f~~~~~l~~H~~~h  104 (106)
                      +.|..|++.|.....|..|++.+
T Consensus        51 ~~C~~C~~~f~s~~~l~~Hm~~~   73 (100)
T PF12756_consen   51 FRCPYCNKTFRSREALQEHMRSK   73 (100)
T ss_dssp             EEBSSSS-EESSHHHHHHHHHHT
T ss_pred             CCCCccCCCCcCHHHHHHHHcCc
Confidence            78888888888888888888864


No 29 
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning]
Probab=97.87  E-value=3.3e-06  Score=55.03  Aligned_cols=55  Identities=31%  Similarity=0.523  Sum_probs=44.6

Q ss_pred             CCCceeccc--ccccccCHHHHHHHHHHHc---------------C---CCCCcccCccccccCChHHHHHHHHh
Q psy12021         49 NSGMFPCEV--CGKKYKYKWGLSRHKRDEC---------------G---QEPKYQCPQCPYRASQKATLKTHMAI  103 (106)
Q Consensus        49 ~~~~~~C~~--C~~~f~~~~~l~~h~~~h~---------------~---~~~~~~C~~C~k~f~~~~~l~~H~~~  103 (106)
                      +++||.|++  |+|.|+....|+.|+.--+               +   +.+||.|+.|+|.|.....|..|+.-
T Consensus       346 d~KpykCpV~gC~K~YknqnGLKYH~lhGH~~~~~~~~p~p~~~~~F~~~~KPYrCevC~KRYKNlNGLKYHr~H  420 (423)
T COG5189         346 DGKPYKCPVEGCNKKYKNQNGLKYHMLHGHQNQKLHENPSPEKMNIFSAKDKPYRCEVCDKRYKNLNGLKYHRKH  420 (423)
T ss_pred             cCceecCCCCCchhhhccccchhhhhhccccCcccCCCCCccccccccccCCceeccccchhhccCccceecccc
Confidence            459999987  9999999999999987432               0   12459999999999999988887653


No 30 
>PLN03086 PRLI-interacting factor K; Provisional
Probab=97.84  E-value=1.8e-05  Score=55.55  Aligned_cols=38  Identities=21%  Similarity=0.434  Sum_probs=19.3

Q ss_pred             CceecccccccccCHHHHHHHHHHHcCCCCCcccCcccccc
Q psy12021         51 GMFPCEVCGKKYKYKWGLSRHKRDECGQEPKYQCPQCPYRA   91 (106)
Q Consensus        51 ~~~~C~~C~~~f~~~~~l~~h~~~h~~~~~~~~C~~C~k~f   91 (106)
                      +++.|. ||+.+ .+..|..|+..|.+.++ +.|+.|++.|
T Consensus       477 kpv~Cp-Cg~~~-~R~~L~~H~~thCp~Kp-i~C~fC~~~v  514 (567)
T PLN03086        477 EPLQCP-CGVVL-EKEQMVQHQASTCPLRL-ITCRFCGDMV  514 (567)
T ss_pred             CCccCC-CCCCc-chhHHHhhhhccCCCCc-eeCCCCCCcc
Confidence            445555 55433 34555555555554333 5555555555


No 31 
>smart00355 ZnF_C2H2 zinc finger.
Probab=97.83  E-value=1.9e-05  Score=32.35  Aligned_cols=23  Identities=39%  Similarity=0.806  Sum_probs=17.2

Q ss_pred             cccCccccccCChHHHHHHHHhh
Q psy12021         82 YQCPQCPYRASQKATLKTHMAIK  104 (106)
Q Consensus        82 ~~C~~C~k~f~~~~~l~~H~~~h  104 (106)
                      |.|+.|++.|.....|..|++.|
T Consensus         1 ~~C~~C~~~f~~~~~l~~H~~~H   23 (26)
T smart00355        1 YRCPECGKVFKSKSALKEHMRTH   23 (26)
T ss_pred             CCCCCCcchhCCHHHHHHHHHHh
Confidence            46777888888887787777755


No 32 
>PF09237 GAGA:  GAGA factor;  InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  Members of this entry bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 1YUI_A 1YUJ_A.
Probab=97.78  E-value=1.2e-05  Score=38.59  Aligned_cols=25  Identities=32%  Similarity=0.664  Sum_probs=10.6

Q ss_pred             CcccCccccccCChHHHHHHHHhhc
Q psy12021         81 KYQCPQCPYRASQKATLKTHMAIKH  105 (106)
Q Consensus        81 ~~~C~~C~k~f~~~~~l~~H~~~hh  105 (106)
                      |..|++|+..+.+..+|.+|+.++|
T Consensus        24 PatCP~C~a~~~~srnLrRHle~~H   48 (54)
T PF09237_consen   24 PATCPICGAVIRQSRNLRRHLEIRH   48 (54)
T ss_dssp             -EE-TTT--EESSHHHHHHHHHHHT
T ss_pred             CCCCCcchhhccchhhHHHHHHHHh
Confidence            3455555555555555555554444


No 33 
>PLN03086 PRLI-interacting factor K; Provisional
Probab=97.63  E-value=9.2e-05  Score=52.16  Aligned_cols=51  Identities=27%  Similarity=0.565  Sum_probs=41.4

Q ss_pred             cCCCceecccccccccCHHHHHHHHHHHcCCCCCcccCccccccCChHHHHHHHHhh
Q psy12021         48 YNSGMFPCEVCGKKYKYKWGLSRHKRDECGQEPKYQCPQCPYRASQKATLKTHMAIK  104 (106)
Q Consensus        48 ~~~~~~~C~~C~~~f~~~~~l~~h~~~h~~~~~~~~C~~C~k~f~~~~~l~~H~~~h  104 (106)
                      ...+.+.|+.|++.|. ...|..|+..++  ++ +.|+ ||+.+ .+..|..|++.|
T Consensus       449 el~~H~~C~~Cgk~f~-~s~LekH~~~~H--kp-v~Cp-Cg~~~-~R~~L~~H~~th  499 (567)
T PLN03086        449 EAKNHVHCEKCGQAFQ-QGEMEKHMKVFH--EP-LQCP-CGVVL-EKEQMVQHQAST  499 (567)
T ss_pred             ccccCccCCCCCCccc-hHHHHHHHHhcC--CC-ccCC-CCCCc-chhHHHhhhhcc
Confidence            3456689999999996 678999999985  55 9999 99765 568899998765


No 34 
>smart00355 ZnF_C2H2 zinc finger.
Probab=97.63  E-value=6e-05  Score=30.76  Aligned_cols=24  Identities=38%  Similarity=0.746  Sum_probs=21.7

Q ss_pred             eecccccccccCHHHHHHHHHHHc
Q psy12021         53 FPCEVCGKKYKYKWGLSRHKRDEC   76 (106)
Q Consensus        53 ~~C~~C~~~f~~~~~l~~h~~~h~   76 (106)
                      |.|..|++.|.....|..|++.|.
T Consensus         1 ~~C~~C~~~f~~~~~l~~H~~~H~   24 (26)
T smart00355        1 YRCPECGKVFKSKSALKEHMRTHX   24 (26)
T ss_pred             CCCCCCcchhCCHHHHHHHHHHhc
Confidence            579999999999999999999764


No 35 
>PF12874 zf-met:  Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A.
Probab=97.41  E-value=0.00014  Score=29.79  Aligned_cols=22  Identities=32%  Similarity=0.789  Sum_probs=13.5

Q ss_pred             eecccccccccCHHHHHHHHHH
Q psy12021         53 FPCEVCGKKYKYKWGLSRHKRD   74 (106)
Q Consensus        53 ~~C~~C~~~f~~~~~l~~h~~~   74 (106)
                      |.|+.|++.|.+...|..|++.
T Consensus         1 ~~C~~C~~~f~s~~~~~~H~~s   22 (25)
T PF12874_consen    1 FYCDICNKSFSSENSLRQHLRS   22 (25)
T ss_dssp             EEETTTTEEESSHHHHHHHHTT
T ss_pred             CCCCCCCCCcCCHHHHHHHHCc
Confidence            4566666666666666666554


No 36 
>PRK04860 hypothetical protein; Provisional
Probab=97.41  E-value=0.00012  Score=43.86  Aligned_cols=38  Identities=26%  Similarity=0.595  Sum_probs=32.5

Q ss_pred             ceecccccccccCHHHHHHHHHHHcCCCCCcccCccccccCCh
Q psy12021         52 MFPCEVCGKKYKYKWGLSRHKRDECGQEPKYQCPQCPYRASQK   94 (106)
Q Consensus        52 ~~~C~~C~~~f~~~~~l~~h~~~h~~~~~~~~C~~C~k~f~~~   94 (106)
                      +|.|. |++   ....+..|.++|.+.++ |.|..|+..|...
T Consensus       119 ~Y~C~-C~~---~~~~~rrH~ri~~g~~~-YrC~~C~~~l~~~  156 (160)
T PRK04860        119 PYRCK-CQE---HQLTVRRHNRVVRGEAV-YRCRRCGETLVFK  156 (160)
T ss_pred             EEEcC-CCC---eeCHHHHHHHHhcCCcc-EECCCCCceeEEe
Confidence            69998 987   56778999999999776 9999999988654


No 37 
>PF13909 zf-H2C2_5:  C2H2-type zinc-finger domain; PDB: 1X5W_A.
Probab=97.37  E-value=0.00017  Score=29.29  Aligned_cols=24  Identities=46%  Similarity=1.064  Sum_probs=14.3

Q ss_pred             cccCccccccCChHHHHHHHHhhcC
Q psy12021         82 YQCPQCPYRASQKATLKTHMAIKHS  106 (106)
Q Consensus        82 ~~C~~C~k~f~~~~~l~~H~~~hh~  106 (106)
                      |+|+.|+-... ...|.+|++.+|+
T Consensus         1 y~C~~C~y~t~-~~~l~~H~~~~H~   24 (24)
T PF13909_consen    1 YKCPHCSYSTS-KSNLKRHLKRHHP   24 (24)
T ss_dssp             EE-SSSS-EES-HHHHHHHHHHHHS
T ss_pred             CCCCCCCCcCC-HHHHHHHHHhhCc
Confidence            46677766555 6667777776664


No 38 
>PF09237 GAGA:  GAGA factor;  InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  Members of this entry bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 1YUI_A 1YUJ_A.
Probab=97.25  E-value=0.00051  Score=33.03  Aligned_cols=33  Identities=21%  Similarity=0.368  Sum_probs=23.7

Q ss_pred             cCCCceecccccccccCHHHHHHHHHHHcCCCC
Q psy12021         48 YNSGMFPCEVCGKKYKYKWGLSRHKRDECGQEP   80 (106)
Q Consensus        48 ~~~~~~~C~~C~~~f~~~~~l~~h~~~h~~~~~   80 (106)
                      ..+.|-.|++|+..+.+..+|.+|+..+++.++
T Consensus        20 ~S~~PatCP~C~a~~~~srnLrRHle~~H~~k~   52 (54)
T PF09237_consen   20 QSEQPATCPICGAVIRQSRNLRRHLEIRHFKKP   52 (54)
T ss_dssp             TTS--EE-TTT--EESSHHHHHHHHHHHTTTS-
T ss_pred             ccCCCCCCCcchhhccchhhHHHHHHHHhcccC
Confidence            456678999999999999999999998888554


No 39 
>PF12874 zf-met:  Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A.
Probab=97.16  E-value=0.0003  Score=28.73  Aligned_cols=23  Identities=26%  Similarity=0.571  Sum_probs=20.8

Q ss_pred             cccCccccccCChHHHHHHHHhh
Q psy12021         82 YQCPQCPYRASQKATLKTHMAIK  104 (106)
Q Consensus        82 ~~C~~C~k~f~~~~~l~~H~~~h  104 (106)
                      |.|+.|++.|.....|..|++.+
T Consensus         1 ~~C~~C~~~f~s~~~~~~H~~s~   23 (25)
T PF12874_consen    1 FYCDICNKSFSSENSLRQHLRSK   23 (25)
T ss_dssp             EEETTTTEEESSHHHHHHHHTTH
T ss_pred             CCCCCCCCCcCCHHHHHHHHCcC
Confidence            57999999999999999998864


No 40 
>KOG3993|consensus
Probab=97.15  E-value=7.2e-05  Score=50.58  Aligned_cols=52  Identities=27%  Similarity=0.581  Sum_probs=44.6

Q ss_pred             ceecccccccccCHHHHHHHHHHHcCCCCCcccCccccccCChHHHHHHHHhh
Q psy12021         52 MFPCEVCGKKYKYKWGLSRHKRDECGQEPKYQCPQCPYRASQKATLKTHMAIK  104 (106)
Q Consensus        52 ~~~C~~C~~~f~~~~~l~~h~~~h~~~~~~~~C~~C~k~f~~~~~l~~H~~~h  104 (106)
                      .|.|..|-..|.+...|.+|.=.-.-... |+|++|+|.|+-..+|..|.|-|
T Consensus       267 dyiCqLCK~kYeD~F~LAQHrC~RIV~vE-YrCPEC~KVFsCPANLASHRRWH  318 (500)
T KOG3993|consen  267 DYICQLCKEKYEDAFALAQHRCPRIVHVE-YRCPECDKVFSCPANLASHRRWH  318 (500)
T ss_pred             HHHHHHHHHhhhhHHHHhhccCCeeEEee-ecCCcccccccCchhhhhhhccc
Confidence            48899999999999999999654444355 99999999999999999998866


No 41 
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning]
Probab=97.03  E-value=0.00016  Score=47.42  Aligned_cols=69  Identities=19%  Similarity=0.232  Sum_probs=44.1

Q ss_pred             ccccceecccCCceeeeeEeeeeccccCCcCcccccCccCcceeccCCCceecccccccccCHHHHHHHHH
Q psy12021          3 VCSHAICVAKSTSITETCIVIRSLGVDKSLDTNVLNFINWPTVRQYNSGMFPCEVCGKKYKYKWGLSRHKR   73 (106)
Q Consensus         3 ~C~~~~c~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~C~~C~~~f~~~~~l~~h~~   73 (106)
                      .|+..+|.+++.....+.-|+.+=  ..+...............-...+||.|+.|+|.|+....|+.|+.
T Consensus       351 kCpV~gC~K~YknqnGLKYH~lhG--H~~~~~~~~p~p~~~~~F~~~~KPYrCevC~KRYKNlNGLKYHr~  419 (423)
T COG5189         351 KCPVEGCNKKYKNQNGLKYHMLHG--HQNQKLHENPSPEKMNIFSAKDKPYRCEVCDKRYKNLNGLKYHRK  419 (423)
T ss_pred             cCCCCCchhhhccccchhhhhhcc--ccCcccCCCCCccccccccccCCceeccccchhhccCccceeccc
Confidence            588889999988777666554322  222222222222222222345799999999999999999988854


No 42 
>PF12171 zf-C2H2_jaz:  Zinc-finger double-stranded RNA-binding;  InterPro: IPR022755  This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length. The mammalian members of this group occur multiple times along the protein, joined by flexible linkers, and are referred to as JAZ - dsRNA-binding ZF protein - zinc-fingers. The JAZ proteins are expressed in all tissues tested and localise in the nucleus, particularly the nucleolus []. JAZ preferentially binds to double-stranded (ds) RNA or RNA/DNA hybrids rather than DNA. In addition to binding double-stranded RNA, these zinc-fingers are required for nucleolar localisation.   This entry represents the multiple-adjacent-C2H2 zinc finger, JAZ. ; PDB: 4DGW_A 1ZR9_A.
Probab=96.76  E-value=0.00052  Score=28.69  Aligned_cols=22  Identities=27%  Similarity=0.670  Sum_probs=14.5

Q ss_pred             eecccccccccCHHHHHHHHHH
Q psy12021         53 FPCEVCGKKYKYKWGLSRHKRD   74 (106)
Q Consensus        53 ~~C~~C~~~f~~~~~l~~h~~~   74 (106)
                      |-|..|++.|.+...+..|+++
T Consensus         2 ~~C~~C~k~f~~~~~~~~H~~s   23 (27)
T PF12171_consen    2 FYCDACDKYFSSENQLKQHMKS   23 (27)
T ss_dssp             CBBTTTTBBBSSHHHHHCCTTS
T ss_pred             CCcccCCCCcCCHHHHHHHHcc
Confidence            5567777777777766666553


No 43 
>PF12756 zf-C2H2_2:  C2H2 type zinc-finger (2 copies); PDB: 2DMI_A.
Probab=96.72  E-value=0.0016  Score=35.37  Aligned_cols=72  Identities=19%  Similarity=0.266  Sum_probs=22.3

Q ss_pred             ccccceecccCCceeeeeEeeeeccccCCcCcccccCccCc--ceeccCCCceecccccccccCHHHHHHHHHHHc
Q psy12021          3 VCSHAICVAKSTSITETCIVIRSLGVDKSLDTNVLNFINWP--TVRQYNSGMFPCEVCGKKYKYKWGLSRHKRDEC   76 (106)
Q Consensus         3 ~C~~~~c~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~--~~~~~~~~~~~C~~C~~~f~~~~~l~~h~~~h~   76 (106)
                      .|.  .|...+.....+..|+...+.-.-............  .........+.|..|++.|.+...|..|++.+.
T Consensus         1 ~C~--~C~~~f~~~~~l~~H~~~~H~~~~~~~~~l~~~~~~~~~~~~~~~~~~~C~~C~~~f~s~~~l~~Hm~~~~   74 (100)
T PF12756_consen    1 QCL--FCDESFSSVDDLLQHMKKKHGFDIPDQKYLVDPNRLLNYLRKKVKESFRCPYCNKTFRSREALQEHMRSKH   74 (100)
T ss_dssp             --------------------------------------------------SSEEBSSSS-EESSHHHHHHHHHHTT
T ss_pred             Ccc--ccccccccccccccccccccccccccccccccccccccccccccCCCCCCCccCCCCcCHHHHHHHHcCcc
Confidence            364  888888888888888765443221111111100000  011112236999999999999999999999753


No 44 
>PF12171 zf-C2H2_jaz:  Zinc-finger double-stranded RNA-binding;  InterPro: IPR022755  This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length. The mammalian members of this group occur multiple times along the protein, joined by flexible linkers, and are referred to as JAZ - dsRNA-binding ZF protein - zinc-fingers. The JAZ proteins are expressed in all tissues tested and localise in the nucleus, particularly the nucleolus []. JAZ preferentially binds to double-stranded (ds) RNA or RNA/DNA hybrids rather than DNA. In addition to binding double-stranded RNA, these zinc-fingers are required for nucleolar localisation.   This entry represents the multiple-adjacent-C2H2 zinc finger, JAZ. ; PDB: 4DGW_A 1ZR9_A.
Probab=96.66  E-value=0.00076  Score=28.16  Aligned_cols=22  Identities=32%  Similarity=0.564  Sum_probs=20.3

Q ss_pred             cccCccccccCChHHHHHHHHh
Q psy12021         82 YQCPQCPYRASQKATLKTHMAI  103 (106)
Q Consensus        82 ~~C~~C~k~f~~~~~l~~H~~~  103 (106)
                      |.|..|++.|.....|..|++.
T Consensus         2 ~~C~~C~k~f~~~~~~~~H~~s   23 (27)
T PF12171_consen    2 FYCDACDKYFSSENQLKQHMKS   23 (27)
T ss_dssp             CBBTTTTBBBSSHHHHHCCTTS
T ss_pred             CCcccCCCCcCCHHHHHHHHcc
Confidence            7899999999999999999875


No 45 
>PF13909 zf-H2C2_5:  C2H2-type zinc-finger domain; PDB: 1X5W_A.
Probab=96.53  E-value=0.0033  Score=25.32  Aligned_cols=24  Identities=25%  Similarity=0.480  Sum_probs=18.5

Q ss_pred             eecccccccccCHHHHHHHHHHHcC
Q psy12021         53 FPCEVCGKKYKYKWGLSRHKRDECG   77 (106)
Q Consensus        53 ~~C~~C~~~f~~~~~l~~h~~~h~~   77 (106)
                      |.|..|+-... +..|..|++.+++
T Consensus         1 y~C~~C~y~t~-~~~l~~H~~~~H~   24 (24)
T PF13909_consen    1 YKCPHCSYSTS-KSNLKRHLKRHHP   24 (24)
T ss_dssp             EE-SSSS-EES-HHHHHHHHHHHHS
T ss_pred             CCCCCCCCcCC-HHHHHHHHHhhCc
Confidence            68999997777 8899999998753


No 46 
>PF13913 zf-C2HC_2:  zinc-finger of a C2HC-type
Probab=96.37  E-value=0.0039  Score=25.60  Aligned_cols=20  Identities=25%  Similarity=0.549  Sum_probs=10.7

Q ss_pred             cccCccccccCChHHHHHHHH
Q psy12021         82 YQCPQCPYRASQKATLKTHMA  102 (106)
Q Consensus        82 ~~C~~C~k~f~~~~~l~~H~~  102 (106)
                      ..|+.||+.| ..+.|..|++
T Consensus         3 ~~C~~CgR~F-~~~~l~~H~~   22 (25)
T PF13913_consen    3 VPCPICGRKF-NPDRLEKHEK   22 (25)
T ss_pred             CcCCCCCCEE-CHHHHHHHHH
Confidence            3566666666 3334555554


No 47 
>smart00451 ZnF_U1 U1-like zinc finger. Family of C2H2-type zinc fingers, present in matrin, U1 small nuclear ribonucleoprotein C and other RNA-binding proteins.
Probab=95.62  E-value=0.01  Score=25.99  Aligned_cols=21  Identities=14%  Similarity=0.572  Sum_probs=14.1

Q ss_pred             cccCccccccCChHHHHHHHH
Q psy12021         82 YQCPQCPYRASQKATLKTHMA  102 (106)
Q Consensus        82 ~~C~~C~k~f~~~~~l~~H~~  102 (106)
                      |.|+.|++.|.....+..|++
T Consensus         4 ~~C~~C~~~~~~~~~~~~H~~   24 (35)
T smart00451        4 FYCKLCNVTFTDEISVEAHLK   24 (35)
T ss_pred             eEccccCCccCCHHHHHHHHC
Confidence            667777777776666666654


No 48 
>smart00451 ZnF_U1 U1-like zinc finger. Family of C2H2-type zinc fingers, present in matrin, U1 small nuclear ribonucleoprotein C and other RNA-binding proteins.
Probab=95.58  E-value=0.013  Score=25.70  Aligned_cols=23  Identities=17%  Similarity=0.515  Sum_probs=20.2

Q ss_pred             ceecccccccccCHHHHHHHHHH
Q psy12021         52 MFPCEVCGKKYKYKWGLSRHKRD   74 (106)
Q Consensus        52 ~~~C~~C~~~f~~~~~l~~h~~~   74 (106)
                      +|.|+.|++.|.+...+..|+..
T Consensus         3 ~~~C~~C~~~~~~~~~~~~H~~g   25 (35)
T smart00451        3 GFYCKLCNVTFTDEISVEAHLKG   25 (35)
T ss_pred             CeEccccCCccCCHHHHHHHHCh
Confidence            58899999999999999888764


No 49 
>COG5048 FOG: Zn-finger [General function prediction only]
Probab=94.64  E-value=0.0048  Score=41.52  Aligned_cols=55  Identities=27%  Similarity=0.552  Sum_probs=48.2

Q ss_pred             CceecccccccccCHHHHHHHHH--HHcCC--CCCcccC--ccccccCChHHHHHHHHhhcC
Q psy12021         51 GMFPCEVCGKKYKYKWGLSRHKR--DECGQ--EPKYQCP--QCPYRASQKATLKTHMAIKHS  106 (106)
Q Consensus        51 ~~~~C~~C~~~f~~~~~l~~h~~--~h~~~--~~~~~C~--~C~k~f~~~~~l~~H~~~hh~  106 (106)
                      .++.|..|...|.....|.+|.+  .|.++  ++ +.|+  .|++.|.+...+..|..+|.+
T Consensus       288 ~~~~~~~~~~~~s~~~~l~~~~~~~~h~~~~~~~-~~~p~~~~~~~~~~~~~~~~~~~~~~~  348 (467)
T COG5048         288 LPIKSKQCNISFSRSSPLTRHLRSVNHSGESLKP-FSCPYSLCGKLFSRNDALKRHILLHTS  348 (467)
T ss_pred             cCCCCccccCCccccccccccccccccccccCCc-eeeeccCCCccccccccccCCcccccC
Confidence            46889999999999999999999  78886  55 9999  799999999999988887753


No 50 
>PF05605 zf-Di19:  Drought induced 19 protein (Di19), zinc-binding;  InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins. Di19 has been found to be strongly expressed in both the roots and leaves of Arabidopsis thaliana during progressive drought [], whilst RING finger proteins are thought to play a role in spermatogenesis. The precise function is unknown.
Probab=94.61  E-value=0.044  Score=26.70  Aligned_cols=23  Identities=26%  Similarity=0.598  Sum_probs=18.8

Q ss_pred             cccCccccccCChHHHHHHHHhhc
Q psy12021         82 YQCPQCPYRASQKATLKTHMAIKH  105 (106)
Q Consensus        82 ~~C~~C~k~f~~~~~l~~H~~~hh  105 (106)
                      |.|+.|++. .....|..|....|
T Consensus         3 f~CP~C~~~-~~~~~L~~H~~~~H   25 (54)
T PF05605_consen    3 FTCPYCGKG-FSESSLVEHCEDEH   25 (54)
T ss_pred             cCCCCCCCc-cCHHHHHHHHHhHC
Confidence            899999995 55678999988765


No 51 
>cd00350 rubredoxin_like Rubredoxin_like; nonheme iron binding domain containing a [Fe(SCys)4] center. The family includes rubredoxins, a small electron transfer protein, and a slightly smaller modular rubredoxin domain present in rubrerythrin and nigerythrin and detected either N- or C-terminal to such proteins as flavin reductase, NAD(P)H-nitrite reductase, and ferredoxin-thioredoxin reductase. In rubredoxin, the iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), but iron can also be replaced by cobalt, nickel or zinc and believed to be involved in electron transfer.  Rubrerythrins and nigerythrins are small homodimeric proteins, generally consisting of 2 domains: a rubredoxin domain C-terminal to a non-sulfur, oxo-bridged diiron site in the N-terminal rubrerythrin domain.  Rubrerythrins and nigerythrins have putative peroxide activity.
Probab=94.25  E-value=0.027  Score=24.65  Aligned_cols=24  Identities=38%  Similarity=0.948  Sum_probs=17.3

Q ss_pred             eecccccccccCHHHHHHHHHHHcCCCCCcccCcccc
Q psy12021         53 FPCEVCGKKYKYKWGLSRHKRDECGQEPKYQCPQCPY   89 (106)
Q Consensus        53 ~~C~~C~~~f~~~~~l~~h~~~h~~~~~~~~C~~C~k   89 (106)
                      |.|..||..+...             +.++.|+.||.
T Consensus         2 ~~C~~CGy~y~~~-------------~~~~~CP~Cg~   25 (33)
T cd00350           2 YVCPVCGYIYDGE-------------EAPWVCPVCGA   25 (33)
T ss_pred             EECCCCCCEECCC-------------cCCCcCcCCCC
Confidence            7899999776432             24589999985


No 52 
>COG4049 Uncharacterized protein containing archaeal-type C2H2 Zn-finger [General function prediction only]
Probab=94.10  E-value=0.024  Score=27.78  Aligned_cols=32  Identities=19%  Similarity=0.454  Sum_probs=25.6

Q ss_pred             eccCCCceecccccccccCHHHHHHHHHHHcC
Q psy12021         46 RQYNSGMFPCEVCGKKYKYKWGLSRHKRDECG   77 (106)
Q Consensus        46 ~~~~~~~~~C~~C~~~f~~~~~l~~h~~~h~~   77 (106)
                      ...|+.-+.|+.||..|....+..+|....++
T Consensus        11 ~RDGE~~lrCPRC~~~FR~~K~Y~RHVNKaH~   42 (65)
T COG4049          11 DRDGEEFLRCPRCGMVFRRRKDYIRHVNKAHG   42 (65)
T ss_pred             ccCCceeeeCCchhHHHHHhHHHHHHhhHHhh
Confidence            44577778899999999998888888776555


No 53 
>cd00729 rubredoxin_SM Rubredoxin, Small Modular nonheme iron binding domain containing a [Fe(SCys)4] center, present in rubrerythrin and nigerythrin and detected either N- or C-terminal to such proteins as flavin reductase, NAD(P)H-nitrite reductase, and ferredoxin-thioredoxin reductase. In rubredoxin, the iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), and  believed to be involved in electron transfer. Rubrerythrins and nigerythrins are small homodimeric proteins, generally consisting of 2 domains: a rubredoxin domain C-terminal to a non-sulfur, oxo-bridged diiron site in the N-terminal rubrerythrin domain. Rubrerythrins and nigerythrins have putative peroxide activity.
Probab=93.61  E-value=0.065  Score=23.63  Aligned_cols=25  Identities=36%  Similarity=0.879  Sum_probs=18.1

Q ss_pred             ceecccccccccCHHHHHHHHHHHcCCCCCcccCcccc
Q psy12021         52 MFPCEVCGKKYKYKWGLSRHKRDECGQEPKYQCPQCPY   89 (106)
Q Consensus        52 ~~~C~~C~~~f~~~~~l~~h~~~h~~~~~~~~C~~C~k   89 (106)
                      .|.|..||..+.             +.++|..|+.||.
T Consensus         2 ~~~C~~CG~i~~-------------g~~~p~~CP~Cg~   26 (34)
T cd00729           2 VWVCPVCGYIHE-------------GEEAPEKCPICGA   26 (34)
T ss_pred             eEECCCCCCEeE-------------CCcCCCcCcCCCC
Confidence            488999996653             3335589999985


No 54 
>KOG2893|consensus
Probab=93.33  E-value=0.022  Score=36.30  Aligned_cols=45  Identities=18%  Similarity=0.461  Sum_probs=34.8

Q ss_pred             CCceecccccccccCHHHHHHHHHHHcCCCCCcccCccccccCChHHHHHH
Q psy12021         50 SGMFPCEVCGKKYKYKWGLSRHKRDECGQEPKYQCPQCPYRASQKATLKTH  100 (106)
Q Consensus        50 ~~~~~C~~C~~~f~~~~~l~~h~~~h~~~~~~~~C~~C~k~f~~~~~l~~H  100 (106)
                      .++| |..|++.|.....|..|++.    +. |+|-+|-|...+-..|..|
T Consensus         9 ~kpw-cwycnrefddekiliqhqka----kh-fkchichkkl~sgpglsih   53 (341)
T KOG2893|consen    9 DKPW-CWYCNREFDDEKILIQHQKA----KH-FKCHICHKKLFSGPGLSIH   53 (341)
T ss_pred             CCce-eeecccccchhhhhhhhhhh----cc-ceeeeehhhhccCCCceee
Confidence            3455 88999999999999998873    55 9999998876665555544


No 55 
>COG4049 Uncharacterized protein containing archaeal-type C2H2 Zn-finger [General function prediction only]
Probab=93.16  E-value=0.063  Score=26.35  Aligned_cols=30  Identities=23%  Similarity=0.500  Sum_probs=24.4

Q ss_pred             cCCCCCcccCccccccCChHHHHHHHHhhcC
Q psy12021         76 CGQEPKYQCPQCPYRASQKATLKTHMAIKHS  106 (106)
Q Consensus        76 ~~~~~~~~C~~C~k~f~~~~~l~~H~~~hh~  106 (106)
                      .|+.- +.|+-||+.|.....+.+|....|+
T Consensus        13 DGE~~-lrCPRC~~~FR~~K~Y~RHVNKaH~   42 (65)
T COG4049          13 DGEEF-LRCPRCGMVFRRRKDYIRHVNKAHG   42 (65)
T ss_pred             CCcee-eeCCchhHHHHHhHHHHHHhhHHhh
Confidence            45555 8999999999999999999876553


No 56 
>KOG2186|consensus
Probab=93.12  E-value=0.063  Score=34.46  Aligned_cols=46  Identities=24%  Similarity=0.524  Sum_probs=34.0

Q ss_pred             eecccccccccCHHHHHHHHHHHcCCCCCcccCccccccCChHHHHHHHH
Q psy12021         53 FPCEVCGKKYKYKWGLSRHKRDECGQEPKYQCPQCPYRASQKATLKTHMA  102 (106)
Q Consensus        53 ~~C~~C~~~f~~~~~l~~h~~~h~~~~~~~~C~~C~k~f~~~~~l~~H~~  102 (106)
                      |.|+.||....-+ .+-.|+..-++ .. |.|-.|++.|.+. .+..|.+
T Consensus         4 FtCnvCgEsvKKp-~vekH~srCrn-~~-fSCIDC~k~F~~~-sYknH~k   49 (276)
T KOG2186|consen    4 FTCNVCGESVKKP-QVEKHMSRCRN-AY-FSCIDCGKTFERV-SYKNHTK   49 (276)
T ss_pred             Eehhhhhhhcccc-chHHHHHhccC-Ce-eEEeecccccccc-hhhhhhh
Confidence            7899999877644 45568887777 55 8999999999884 4566654


No 57 
>PF09538 FYDLN_acid:  Protein of unknown function (FYDLN_acid);  InterPro: IPR012644 Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues. The function of members of this family is unknown.
Probab=92.70  E-value=0.043  Score=30.86  Aligned_cols=30  Identities=27%  Similarity=0.650  Sum_probs=22.7

Q ss_pred             eecccccccccCHHHHHHHHHHHcCCCCCcccCccccccCCh
Q psy12021         53 FPCEVCGKKYKYKWGLSRHKRDECGQEPKYQCPQCPYRASQK   94 (106)
Q Consensus        53 ~~C~~C~~~f~~~~~l~~h~~~h~~~~~~~~C~~C~k~f~~~   94 (106)
                      ..|..||+.|..   |         .+.|..|+.||..|...
T Consensus        10 R~Cp~CG~kFYD---L---------nk~PivCP~CG~~~~~~   39 (108)
T PF09538_consen   10 RTCPSCGAKFYD---L---------NKDPIVCPKCGTEFPPE   39 (108)
T ss_pred             ccCCCCcchhcc---C---------CCCCccCCCCCCccCcc
Confidence            579999998842   2         24458999999988765


No 58 
>KOG1146|consensus
Probab=91.37  E-value=0.2  Score=39.11  Aligned_cols=57  Identities=23%  Similarity=0.448  Sum_probs=46.3

Q ss_pred             ccCCCceecccccccccCHHHHHHHHHHHc------------------------CCCCCcccCccccccCChHHHHHHHH
Q psy12021         47 QYNSGMFPCEVCGKKYKYKWGLSRHKRDEC------------------------GQEPKYQCPQCPYRASQKATLKTHMA  102 (106)
Q Consensus        47 ~~~~~~~~C~~C~~~f~~~~~l~~h~~~h~------------------------~~~~~~~C~~C~k~f~~~~~l~~H~~  102 (106)
                      +...+.+.|..|+..|+....|..|+|.-+                        ....||.|..|...+.....|..|++
T Consensus       460 ~S~~kt~~cpkc~~~yk~a~~L~vhmRskhp~~~~~~c~~gq~~~~~arg~~~~~~~~p~~C~~C~~stttng~Lsihlq  539 (1406)
T KOG1146|consen  460 HSFFKTLKCPKCNWHYKLAQTLGVHMRSKHPESQSAYCKAGQNHPRLARGEVYRCPGKPYPCRACNYSTTTNGNLSIHLQ  539 (1406)
T ss_pred             ecccccccCCccchhhhhHHHhhhcccccccccchhHhHhccccccccccccccCCCCcccceeeeeeeecchHHHHHHH
Confidence            444588999999999999999999999811                        01234999999999999999999986


Q ss_pred             h
Q psy12021        103 I  103 (106)
Q Consensus       103 ~  103 (106)
                      .
T Consensus       540 S  540 (1406)
T KOG1146|consen  540 S  540 (1406)
T ss_pred             H
Confidence            3


No 59 
>PF13719 zinc_ribbon_5:  zinc-ribbon domain
Probab=90.53  E-value=0.17  Score=22.69  Aligned_cols=34  Identities=18%  Similarity=0.468  Sum_probs=23.8

Q ss_pred             eecccccccccCHHHHHHHHHHHcCCCCCcccCccccccC
Q psy12021         53 FPCEVCGKKYKYKWGLSRHKRDECGQEPKYQCPQCPYRAS   92 (106)
Q Consensus        53 ~~C~~C~~~f~~~~~l~~h~~~h~~~~~~~~C~~C~k~f~   92 (106)
                      ..|+.|+..|.-...-     +..+... .+|+.|+..|.
T Consensus         3 i~CP~C~~~f~v~~~~-----l~~~~~~-vrC~~C~~~f~   36 (37)
T PF13719_consen    3 ITCPNCQTRFRVPDDK-----LPAGGRK-VRCPKCGHVFR   36 (37)
T ss_pred             EECCCCCceEEcCHHH-----cccCCcE-EECCCCCcEee
Confidence            4799999998765532     2233355 89999998874


No 60 
>PF04959 ARS2:  Arsenite-resistance protein 2;  InterPro: IPR007042 This entry represents Arsenite-resistance protein 2 (also known as Serrate RNA effector molecule homolog) which is thought to play a role in arsenite resistance [], although does not directly confer arsenite resistance but rather modulates arsenic sensitivity []. Arsenite is a carcinogenic compound which can act as a comutagen by inhibiting DNA repair. It is also involved in cell cycle progression at S phase. ; PDB: 3AX1_A.
Probab=90.18  E-value=0.17  Score=31.87  Aligned_cols=26  Identities=23%  Similarity=0.446  Sum_probs=13.0

Q ss_pred             CceecccccccccCHHHHHHHHHHHc
Q psy12021         51 GMFPCEVCGKKYKYKWGLSRHKRDEC   76 (106)
Q Consensus        51 ~~~~C~~C~~~f~~~~~l~~h~~~h~   76 (106)
                      ..|.|..|+|.|+-......|+..-+
T Consensus        76 ~K~~C~lc~KlFkg~eFV~KHI~nKH  101 (214)
T PF04959_consen   76 DKWRCPLCGKLFKGPEFVRKHIFNKH  101 (214)
T ss_dssp             EEEEE-SSS-EESSHHHHHHHHHHH-
T ss_pred             CEECCCCCCcccCChHHHHHHHhhcC
Confidence            34566666666666665555555433


No 61 
>COG1592 Rubrerythrin [Energy production and conversion]
Probab=89.72  E-value=0.2  Score=30.36  Aligned_cols=24  Identities=38%  Similarity=0.859  Sum_probs=19.2

Q ss_pred             ceecccccccccCHHHHHHHHHHHcCCCCCcccCcccc
Q psy12021         52 MFPCEVCGKKYKYKWGLSRHKRDECGQEPKYQCPQCPY   89 (106)
Q Consensus        52 ~~~C~~C~~~f~~~~~l~~h~~~h~~~~~~~~C~~C~k   89 (106)
                      .|.|.+||.+             +.| ++|-.||.||.
T Consensus       134 ~~vC~vCGy~-------------~~g-e~P~~CPiCga  157 (166)
T COG1592         134 VWVCPVCGYT-------------HEG-EAPEVCPICGA  157 (166)
T ss_pred             EEEcCCCCCc-------------ccC-CCCCcCCCCCC
Confidence            6999999854             456 67799999983


No 62 
>PF13717 zinc_ribbon_4:  zinc-ribbon domain
Probab=89.45  E-value=0.25  Score=22.01  Aligned_cols=34  Identities=18%  Similarity=0.282  Sum_probs=23.4

Q ss_pred             eecccccccccCHHHHHHHHHHHcCCCCCcccCccccccC
Q psy12021         53 FPCEVCGKKYKYKWGLSRHKRDECGQEPKYQCPQCPYRAS   92 (106)
Q Consensus        53 ~~C~~C~~~f~~~~~l~~h~~~h~~~~~~~~C~~C~k~f~   92 (106)
                      ..|+.|+..|.-....     +-..... .+|+.|+..|.
T Consensus         3 i~Cp~C~~~y~i~d~~-----ip~~g~~-v~C~~C~~~f~   36 (36)
T PF13717_consen    3 ITCPNCQAKYEIDDEK-----IPPKGRK-VRCSKCGHVFF   36 (36)
T ss_pred             EECCCCCCEEeCCHHH-----CCCCCcE-EECCCCCCEeC
Confidence            5789999888766543     2223345 89999998773


No 63 
>PF02892 zf-BED:  BED zinc finger;  InterPro: IPR003656 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents predicted BED-type zinc finger domains. The BED finger which was named after the Drosophila proteins BEAF and DREF, is found in one or more copies in cellular regulatory factors and transposases from plants, animals and fungi. The BED finger is an about 50 to 60 amino acid residues domain that contains a characteristic motif with two highly conserved aromatic positions, as well as a shared pattern of cysteines and histidines that is predicted to form a zinc finger. As diverse BED fingers are able to bind DNA, it has been suggested that DNA-binding is the general function of this domain []. Some proteins known to contain a BED domain include animal, plant and fungi AC1 and Hobo-like transposases; Caenorhabditis elegans Dpy-20 protein, a predicted cuticular gene transcriptional regulator; Drosophila BEAF (boundary element-associated factor), thought to be involved in chromatin insulation; Drosophila DREF, a transcriptional regulator for S-phase genes; and tobacco 3AF1 and tomato E4/E8-BP1, light- and ethylene-regulated DNA binding proteins that contain two BED fingers. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003677 DNA binding; PDB: 2DJR_A 2CT5_A.
Probab=89.41  E-value=0.41  Score=22.08  Aligned_cols=21  Identities=24%  Similarity=0.461  Sum_probs=9.4

Q ss_pred             cccCccccccCCh----HHHHHHHH
Q psy12021         82 YQCPQCPYRASQK----ATLKTHMA  102 (106)
Q Consensus        82 ~~C~~C~k~f~~~----~~l~~H~~  102 (106)
                      ..|..|++.+...    +.|.+|++
T Consensus        17 a~C~~C~~~~~~~~~~ts~l~~HL~   41 (45)
T PF02892_consen   17 AKCKYCGKVIKYSSGGTSNLKRHLK   41 (45)
T ss_dssp             EEETTTTEE-----SSTHHHHHHHH
T ss_pred             EEeCCCCeEEeeCCCcHHHHHHhhh
Confidence            5555555554442    45555553


No 64 
>PF05443 ROS_MUCR:  ROS/MUCR transcriptional regulator protein;  InterPro: IPR008807 This family consists of several ROS/MUCR transcriptional regulator proteins. The ros chromosomal gene is present in octopine and nopaline strains of Agrobacterium tumefaciens as well as in Rhizobium meliloti (Sinorhizobium meliloti). This gene encodes a 15.5 kDa protein that specifically represses the virC and virD operons in the virulence region of the Ti plasmid [] and is necessary for succinoglycan production []. S. meliloti can produce two types of acidic exopolysaccharides, succinoglycan and galactoglucan, that are interchangeable for infection of Medicago sativa (Alfalfa) nodules. MucR from S. meliloti acts as a transcriptional repressor that blocks the expression of the exp genes responsible for galactoglucan production therefore allowing the exclusive production of succinoglycan [].; GO: 0003677 DNA binding, 0008270 zinc ion binding, 0006355 regulation of transcription, DNA-dependent; PDB: 2JSP_A.
Probab=89.12  E-value=0.24  Score=28.88  Aligned_cols=22  Identities=23%  Similarity=0.487  Sum_probs=10.9

Q ss_pred             cccCccccccCChHHHHHHHHhhcC
Q psy12021         82 YQCPQCPYRASQKATLKTHMAIKHS  106 (106)
Q Consensus        82 ~~C~~C~k~f~~~~~l~~H~~~hh~  106 (106)
                      ..|-+||+.|..-   .+|++.|||
T Consensus        73 i~clecGk~~k~L---krHL~~~~g   94 (132)
T PF05443_consen   73 IICLECGKKFKTL---KRHLRTHHG   94 (132)
T ss_dssp             EE-TBT--EESBH---HHHHHHTT-
T ss_pred             eEEccCCcccchH---HHHHHHccC
Confidence            5666677666543   566666654


No 65 
>smart00659 RPOLCX RNA polymerase subunit CX. present in RNA polymerase I, II and III
Probab=88.99  E-value=0.28  Score=22.94  Aligned_cols=27  Identities=30%  Similarity=0.938  Sum_probs=19.3

Q ss_pred             ceecccccccccCHHHHHHHHHHHcCCCCCcccCccccc
Q psy12021         52 MFPCEVCGKKYKYKWGLSRHKRDECGQEPKYQCPQCPYR   90 (106)
Q Consensus        52 ~~~C~~C~~~f~~~~~l~~h~~~h~~~~~~~~C~~C~k~   90 (106)
                      .|.|..||..|...           .... ..|+.||..
T Consensus         2 ~Y~C~~Cg~~~~~~-----------~~~~-irC~~CG~r   28 (44)
T smart00659        2 IYICGECGRENEIK-----------SKDV-VRCRECGYR   28 (44)
T ss_pred             EEECCCCCCEeecC-----------CCCc-eECCCCCce
Confidence            38899999887532           2244 899999854


No 66 
>TIGR02098 MJ0042_CXXC MJ0042 family finger-like domain. This domain contains a CXXCX(19)CXXC motif suggestive of both zinc fingers and thioredoxin, usually found at the N-terminus of prokaryotic proteins. One partially characterized gene, agmX, is among a large set in Myxococcus whose interruption affects adventurous gliding motility.
Probab=88.92  E-value=0.25  Score=22.06  Aligned_cols=34  Identities=12%  Similarity=0.260  Sum_probs=22.8

Q ss_pred             eecccccccccCHHHHHHHHHHHcCCCCCcccCccccccC
Q psy12021         53 FPCEVCGKKYKYKWGLSRHKRDECGQEPKYQCPQCPYRAS   92 (106)
Q Consensus        53 ~~C~~C~~~f~~~~~l~~h~~~h~~~~~~~~C~~C~k~f~   92 (106)
                      +.|+.|+..|.-.....     ...... ..|+.|+..|.
T Consensus         3 ~~CP~C~~~~~v~~~~~-----~~~~~~-v~C~~C~~~~~   36 (38)
T TIGR02098         3 IQCPNCKTSFRVVDSQL-----GANGGK-VRCGKCGHVWY   36 (38)
T ss_pred             EECCCCCCEEEeCHHHc-----CCCCCE-EECCCCCCEEE
Confidence            67999999887655332     112234 88999998774


No 67 
>PF09723 Zn-ribbon_8:  Zinc ribbon domain;  InterPro: IPR013429  This entry represents a region of about 41 amino acids found in a number of small proteins in a wide range of bacteria. The region usually begins with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One protein in this entry has been noted as a putative regulatory protein, designated FmdB []. Most proteins in this entry have a C-terminal region containing highly degenerate sequence.
Probab=87.93  E-value=0.079  Score=24.48  Aligned_cols=29  Identities=28%  Similarity=0.807  Sum_probs=19.6

Q ss_pred             eecccccccccCHHHHHHHHHHHcCCCCCcccCcccc
Q psy12021         53 FPCEVCGKKYKYKWGLSRHKRDECGQEPKYQCPQCPY   89 (106)
Q Consensus        53 ~~C~~C~~~f~~~~~l~~h~~~h~~~~~~~~C~~C~k   89 (106)
                      |.|..||..|.....      ... ... ..|+.||.
T Consensus         6 y~C~~Cg~~fe~~~~------~~~-~~~-~~CP~Cg~   34 (42)
T PF09723_consen    6 YRCEECGHEFEVLQS------ISE-DDP-VPCPECGS   34 (42)
T ss_pred             EEeCCCCCEEEEEEE------cCC-CCC-CcCCCCCC
Confidence            889999988854321      222 234 88999986


No 68 
>PF12013 DUF3505:  Protein of unknown function (DUF3505);  InterPro: IPR022698  This family of proteins is functionally uncharacterised. This protein is found in eukaryotes. Proteins in this family are typically between 247 to 1018 amino acids in length. This region contains two segments that are likely to be C2H2 zinc binding domains. 
Probab=87.55  E-value=0.55  Score=26.21  Aligned_cols=25  Identities=36%  Similarity=0.883  Sum_probs=20.9

Q ss_pred             ccc----CccccccCChHHHHHHHHhhcC
Q psy12021         82 YQC----PQCPYRASQKATLKTHMAIKHS  106 (106)
Q Consensus        82 ~~C----~~C~k~f~~~~~l~~H~~~hh~  106 (106)
                      |.|    ..|+....+...+.+|.+.+||
T Consensus        81 ~~C~~~~~~C~y~~~~~~~m~~H~~~~Hg  109 (109)
T PF12013_consen   81 YRCQCDPPHCGYITRSKKTMRKHWRKEHG  109 (109)
T ss_pred             eeeecCCCCCCcEeccHHHHHHHHHHhcC
Confidence            678    8888888888888888888876


No 69 
>smart00834 CxxC_CXXC_SSSS Putative regulatory protein. CxxC_CXXC_SSSS represents a region of about 41 amino acids found in a number of small proteins in a wide range of bacteria. The region usually begins with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One protein in this entry has been noted as a putative regulatory protein, designated FmdB. Most proteins in this entry have a C-terminal region containing highly degenerate sequence.
Probab=87.52  E-value=0.13  Score=23.22  Aligned_cols=30  Identities=23%  Similarity=0.629  Sum_probs=19.9

Q ss_pred             eecccccccccCHHHHHHHHHHHcCCCCCcccCccccc
Q psy12021         53 FPCEVCGKKYKYKWGLSRHKRDECGQEPKYQCPQCPYR   90 (106)
Q Consensus        53 ~~C~~C~~~f~~~~~l~~h~~~h~~~~~~~~C~~C~k~   90 (106)
                      |.|..||..|......      .. ... ..|+.||..
T Consensus         6 y~C~~Cg~~fe~~~~~------~~-~~~-~~CP~Cg~~   35 (41)
T smart00834        6 YRCEDCGHTFEVLQKI------SD-DPL-ATCPECGGD   35 (41)
T ss_pred             EEcCCCCCEEEEEEec------CC-CCC-CCCCCCCCc
Confidence            7899999988543221      11 244 789999973


No 70 
>TIGR02300 FYDLN_acid conserved hypothetical protein TIGR02300. Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues. The function of members of this family is unknown.
Probab=87.51  E-value=0.27  Score=28.34  Aligned_cols=31  Identities=16%  Similarity=0.156  Sum_probs=22.5

Q ss_pred             eecccccccccCHHHHHHHHHHHcCCCCCcccCccccccCChH
Q psy12021         53 FPCEVCGKKYKYKWGLSRHKRDECGQEPKYQCPQCPYRASQKA   95 (106)
Q Consensus        53 ~~C~~C~~~f~~~~~l~~h~~~h~~~~~~~~C~~C~k~f~~~~   95 (106)
                      ..|..||+.|..   |         .+.|..|+.||..|....
T Consensus        10 r~Cp~cg~kFYD---L---------nk~p~vcP~cg~~~~~~~   40 (129)
T TIGR02300        10 RICPNTGSKFYD---L---------NRRPAVSPYTGEQFPPEE   40 (129)
T ss_pred             ccCCCcCccccc---c---------CCCCccCCCcCCccCcch
Confidence            579999988832   2         245689999998886553


No 71 
>TIGR02605 CxxC_CxxC_SSSS putative regulatory protein, FmdB family. This model represents a region of about 50 amino acids found in a number of small proteins in a wide range of bacteria. The region begins usually with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One member of this family is has been noted as a putative regulatory protein, designated FmdB (PubMed:8841393). Most members of this family have a C-terminal region containing highly degenerate sequence, such as SSTSESTKSSGSSGSSGSSESKASGSTEKSTSSTTAAAAV in Mycobacterium tuberculosis and VAVGGSAPAPSPAPRAGGGGGGCCGGGCCG in Streptomyces avermitilis. These low complexity regions, which are not included in the model, resemble low-complexity C-terminal regions of some heterocycle-containing bacteriocin precursors.
Probab=87.08  E-value=0.15  Score=24.52  Aligned_cols=29  Identities=21%  Similarity=0.610  Sum_probs=19.0

Q ss_pred             eecccccccccCHHHHHHHHHHHcCCCCCcccCcccc
Q psy12021         53 FPCEVCGKKYKYKWGLSRHKRDECGQEPKYQCPQCPY   89 (106)
Q Consensus        53 ~~C~~C~~~f~~~~~l~~h~~~h~~~~~~~~C~~C~k   89 (106)
                      |.|..||..|.....      ... ... ..|+.||.
T Consensus         6 y~C~~Cg~~fe~~~~------~~~-~~~-~~CP~Cg~   34 (52)
T TIGR02605         6 YRCTACGHRFEVLQK------MSD-DPL-ATCPECGG   34 (52)
T ss_pred             EEeCCCCCEeEEEEe------cCC-CCC-CCCCCCCC
Confidence            789999998864321      111 233 67999985


No 72 
>COG2888 Predicted Zn-ribbon RNA-binding protein with a function in translation [Translation, ribosomal structure and biogenesis]
Probab=86.49  E-value=0.59  Score=23.29  Aligned_cols=32  Identities=34%  Similarity=0.848  Sum_probs=19.3

Q ss_pred             CceecccccccccCHHHHHHHHHHHcCCCCCcccCccc
Q psy12021         51 GMFPCEVCGKKYKYKWGLSRHKRDECGQEPKYQCPQCP   88 (106)
Q Consensus        51 ~~~~C~~C~~~f~~~~~l~~h~~~h~~~~~~~~C~~C~   88 (106)
                      -.|.|+.||+.--....     +--....+ |.|+.||
T Consensus        26 v~F~CPnCGe~~I~Rc~-----~CRk~g~~-Y~Cp~CG   57 (61)
T COG2888          26 VKFPCPNCGEVEIYRCA-----KCRKLGNP-YRCPKCG   57 (61)
T ss_pred             eEeeCCCCCceeeehhh-----hHHHcCCc-eECCCcC
Confidence            34899999965433221     11112255 9999998


No 73 
>smart00531 TFIIE Transcription initiation factor IIE.
Probab=84.78  E-value=1.2  Score=26.27  Aligned_cols=39  Identities=21%  Similarity=0.534  Sum_probs=26.3

Q ss_pred             cCCCceecccccccccCHHHHHHHHHHHcCCCCCcccCcccccc
Q psy12021         48 YNSGMFPCEVCGKKYKYKWGLSRHKRDECGQEPKYQCPQCPYRA   91 (106)
Q Consensus        48 ~~~~~~~C~~C~~~f~~~~~l~~h~~~h~~~~~~~~C~~C~k~f   91 (106)
                      ....-|.|+.|+..|.....+..   ... ... |.|+.||...
T Consensus        95 ~~~~~Y~Cp~C~~~y~~~ea~~~---~d~-~~~-f~Cp~Cg~~l  133 (147)
T smart00531       95 TNNAYYKCPNCQSKYTFLEANQL---LDM-DGT-FTCPRCGEEL  133 (147)
T ss_pred             cCCcEEECcCCCCEeeHHHHHHh---cCC-CCc-EECCCCCCEE
Confidence            34556999999999986544322   111 244 9999999864


No 74 
>TIGR00373 conserved hypothetical protein TIGR00373. This family of proteins is, so far, restricted to archaeal genomes. The family appears to be distantly related to the N-terminal region of the eukaryotic transcription initiation factor IIE alpha chain.
Probab=84.50  E-value=0.82  Score=27.44  Aligned_cols=34  Identities=18%  Similarity=0.484  Sum_probs=25.9

Q ss_pred             cCCCceecccccccccCHHHHHHHHHHHcCCCCCcccCcccccc
Q psy12021         48 YNSGMFPCEVCGKKYKYKWGLSRHKRDECGQEPKYQCPQCPYRA   91 (106)
Q Consensus        48 ~~~~~~~C~~C~~~f~~~~~l~~h~~~h~~~~~~~~C~~C~k~f   91 (106)
                      ....-|.|+.|+..|+....+.         .- |.|+.||...
T Consensus       105 ~~~~~Y~Cp~c~~r~tf~eA~~---------~~-F~Cp~Cg~~L  138 (158)
T TIGR00373       105 TNNMFFICPNMCVRFTFNEAME---------LN-FTCPRCGAML  138 (158)
T ss_pred             cCCCeEECCCCCcEeeHHHHHH---------cC-CcCCCCCCEe
Confidence            3455699999999988777664         24 9999999764


No 75 
>smart00614 ZnF_BED BED zinc finger. DNA-binding domain in chromatin-boundary-element-binding proteins and transposases
Probab=84.41  E-value=0.86  Score=21.68  Aligned_cols=12  Identities=42%  Similarity=0.874  Sum_probs=6.1

Q ss_pred             eecccccccccC
Q psy12021         53 FPCEVCGKKYKY   64 (106)
Q Consensus        53 ~~C~~C~~~f~~   64 (106)
                      -.|..|++.+..
T Consensus        19 a~C~~C~~~l~~   30 (50)
T smart00614       19 AKCKYCGKKLSR   30 (50)
T ss_pred             EEecCCCCEeee
Confidence            345555555533


No 76 
>KOG4167|consensus
Probab=83.49  E-value=0.33  Score=35.83  Aligned_cols=28  Identities=29%  Similarity=0.618  Sum_probs=24.7

Q ss_pred             CCceecccccccccCHHHHHHHHHHHcC
Q psy12021         50 SGMFPCEVCGKKYKYKWGLSRHKRDECG   77 (106)
Q Consensus        50 ~~~~~C~~C~~~f~~~~~l~~h~~~h~~   77 (106)
                      ...|.|.+|+|.|-.-..+..||++|..
T Consensus       790 ~giFpCreC~kvF~KiKSrNAHMK~Hr~  817 (907)
T KOG4167|consen  790 TGIFPCRECGKVFFKIKSRNAHMKTHRQ  817 (907)
T ss_pred             CceeehHHHHHHHHHHhhhhHHHHHHHH
Confidence            4569999999999988999999999964


No 77 
>PF08790 zf-LYAR:  LYAR-type C2HC zinc finger ;  InterPro: IPR014898 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This C2HC zinc finger domain is found in LYAR proteins such as Q08288 from SWISSPROT, which are involved in cell growth regulation.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 1WJV_A.
Probab=83.23  E-value=0.25  Score=20.80  Aligned_cols=20  Identities=25%  Similarity=0.574  Sum_probs=9.8

Q ss_pred             eecccccccccCHHHHHHHHH
Q psy12021         53 FPCEVCGKKYKYKWGLSRHKR   73 (106)
Q Consensus        53 ~~C~~C~~~f~~~~~l~~h~~   73 (106)
                      |.|..|++.|. ....+.|..
T Consensus         1 ~sCiDC~~~F~-~~~y~~Ht~   20 (28)
T PF08790_consen    1 FSCIDCSKDFD-GDSYKSHTS   20 (28)
T ss_dssp             EEETTTTEEEE-GGGTTT---
T ss_pred             CeeecCCCCcC-cCCcCCCCc
Confidence            45777777773 333444443


No 78 
>PF04959 ARS2:  Arsenite-resistance protein 2;  InterPro: IPR007042 This entry represents Arsenite-resistance protein 2 (also known as Serrate RNA effector molecule homolog) which is thought to play a role in arsenite resistance [], although does not directly confer arsenite resistance but rather modulates arsenic sensitivity []. Arsenite is a carcinogenic compound which can act as a comutagen by inhibiting DNA repair. It is also involved in cell cycle progression at S phase. ; PDB: 3AX1_A.
Probab=82.33  E-value=1.4  Score=27.83  Aligned_cols=28  Identities=21%  Similarity=0.522  Sum_probs=21.9

Q ss_pred             CCCCCcccCccccccCChHHHHHHHHhhc
Q psy12021         77 GQEPKYQCPQCPYRASQKATLKTHMAIKH  105 (106)
Q Consensus        77 ~~~~~~~C~~C~k~f~~~~~l~~H~~~hh  105 (106)
                      .+.+ |.|+.|+|.|.-...+..|+...|
T Consensus        74 ~~~K-~~C~lc~KlFkg~eFV~KHI~nKH  101 (214)
T PF04959_consen   74 DEDK-WRCPLCGKLFKGPEFVRKHIFNKH  101 (214)
T ss_dssp             SSEE-EEE-SSS-EESSHHHHHHHHHHH-
T ss_pred             cCCE-ECCCCCCcccCChHHHHHHHhhcC
Confidence            3355 999999999999999999998776


No 79 
>PRK06266 transcription initiation factor E subunit alpha; Validated
Probab=82.22  E-value=1  Score=27.59  Aligned_cols=34  Identities=24%  Similarity=0.629  Sum_probs=25.4

Q ss_pred             CCCceecccccccccCHHHHHHHHHHHcCCCCCcccCccccccC
Q psy12021         49 NSGMFPCEVCGKKYKYKWGLSRHKRDECGQEPKYQCPQCPYRAS   92 (106)
Q Consensus        49 ~~~~~~C~~C~~~f~~~~~l~~h~~~h~~~~~~~~C~~C~k~f~   92 (106)
                      ...-|.|+.|+..|+....+.         .- |.|+.||....
T Consensus       114 ~~~~Y~Cp~C~~rytf~eA~~---------~~-F~Cp~Cg~~L~  147 (178)
T PRK06266        114 NNMFFFCPNCHIRFTFDEAME---------YG-FRCPQCGEMLE  147 (178)
T ss_pred             CCCEEECCCCCcEEeHHHHhh---------cC-CcCCCCCCCCe
Confidence            345699999999987766542         34 99999997643


No 80 
>COG5048 FOG: Zn-finger [General function prediction only]
Probab=81.99  E-value=0.86  Score=30.69  Aligned_cols=56  Identities=27%  Similarity=0.485  Sum_probs=46.1

Q ss_pred             CCCceecccccccccCHHHHHHHHHHHcCCCCCcccCc--cccccCChHHHHHHHHhhc
Q psy12021         49 NSGMFPCEVCGKKYKYKWGLSRHKRDECGQEPKYQCPQ--CPYRASQKATLKTHMAIKH  105 (106)
Q Consensus        49 ~~~~~~C~~C~~~f~~~~~l~~h~~~h~~~~~~~~C~~--C~k~f~~~~~l~~H~~~hh  105 (106)
                      ....+.|+.|...|........|.+.+.+.++ +.|..  |...|.....+..|.+.++
T Consensus        30 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~   87 (467)
T COG5048          30 APRPDSCPNCTDSFSRLEHLTRHIRSHTGEKP-SQCSYSGCDKSFSRPLELSRHLRTHH   87 (467)
T ss_pred             CCchhhcccccccccccchhhhhcccccccCC-ccccccccccccCCcchhhhhccccc
Confidence            34568899999999999999999999999776 88876  6677888888888877664


No 81 
>COG1997 RPL43A Ribosomal protein L37AE/L43A [Translation, ribosomal structure and biogenesis]
Probab=81.91  E-value=0.44  Score=25.64  Aligned_cols=33  Identities=24%  Similarity=0.609  Sum_probs=21.6

Q ss_pred             CCceecccccccccCHHHHHHHHHHHcCCCCCcccCccccccCC
Q psy12021         50 SGMFPCEVCGKKYKYKWGLSRHKRDECGQEPKYQCPQCPYRASQ   93 (106)
Q Consensus        50 ~~~~~C~~C~~~f~~~~~l~~h~~~h~~~~~~~~C~~C~k~f~~   93 (106)
                      ...|.|+.|++.        .+.+.-.|  - +.|..||..|.=
T Consensus        33 ~~~~~Cp~C~~~--------~VkR~a~G--I-W~C~kCg~~fAG   65 (89)
T COG1997          33 RAKHVCPFCGRT--------TVKRIATG--I-WKCRKCGAKFAG   65 (89)
T ss_pred             hcCCcCCCCCCc--------ceeeeccC--e-EEcCCCCCeecc
Confidence            345889999865        22333333  4 889999887753


No 82 
>smart00734 ZnF_Rad18 Rad18-like CCHC zinc finger. Yeast Rad18p functions with Rad5p in error-free post-replicative DNA repair. This zinc finger is likely to bind nucleic-acids.
Probab=81.52  E-value=1.7  Score=17.77  Aligned_cols=20  Identities=25%  Similarity=0.644  Sum_probs=11.7

Q ss_pred             cccCccccccCChHHHHHHHH
Q psy12021         82 YQCPQCPYRASQKATLKTHMA  102 (106)
Q Consensus        82 ~~C~~C~k~f~~~~~l~~H~~  102 (106)
                      ..|+.|++.+ ....+..|..
T Consensus         2 v~CPiC~~~v-~~~~in~HLD   21 (26)
T smart00734        2 VQCPVCFREV-PENLINSHLD   21 (26)
T ss_pred             CcCCCCcCcc-cHHHHHHHHH
Confidence            3577777776 4445555654


No 83 
>PRK00398 rpoP DNA-directed RNA polymerase subunit P; Provisional
Probab=80.61  E-value=0.93  Score=21.17  Aligned_cols=29  Identities=28%  Similarity=0.724  Sum_probs=19.4

Q ss_pred             ceecccccccccCHHHHHHHHHHHcCCCCCcccCcccccc
Q psy12021         52 MFPCEVCGKKYKYKWGLSRHKRDECGQEPKYQCPQCPYRA   91 (106)
Q Consensus        52 ~~~C~~C~~~f~~~~~l~~h~~~h~~~~~~~~C~~C~k~f   91 (106)
                      .|.|..||..|....          .... ..|+.||..+
T Consensus         3 ~y~C~~CG~~~~~~~----------~~~~-~~Cp~CG~~~   31 (46)
T PRK00398          3 EYKCARCGREVELDE----------YGTG-VRCPYCGYRI   31 (46)
T ss_pred             EEECCCCCCEEEECC----------CCCc-eECCCCCCeE
Confidence            588999998775421          1124 8899998654


No 84 
>PF08274 PhnA_Zn_Ribbon:  PhnA Zinc-Ribbon ;  InterPro: IPR013987 The PhnA protein family includes the uncharacterised Escherichia coli protein PhnA and its homologues. The E. coli phnA gene is part of a large operon associated with alkylphosphonate uptake and carbon-phosphorus bond cleavage []. The protein is not related to the characterised phosphonoacetate hydrolase designated PhnA []. This entry represents the N-terminal domain of PhnA, which is predicted to form a zinc-ribbon.; PDB: 2AKL_A.
Probab=79.96  E-value=0.76  Score=19.65  Aligned_cols=25  Identities=36%  Similarity=0.960  Sum_probs=11.5

Q ss_pred             ecccccccccCHHHHHHHHHHHcCCCCCcccCccccc
Q psy12021         54 PCEVCGKKYKYKWGLSRHKRDECGQEPKYQCPQCPYR   90 (106)
Q Consensus        54 ~C~~C~~~f~~~~~l~~h~~~h~~~~~~~~C~~C~k~   90 (106)
                      .|+.|+..+..           ..... +.|+.|+..
T Consensus         4 ~Cp~C~se~~y-----------~D~~~-~vCp~C~~e   28 (30)
T PF08274_consen    4 KCPLCGSEYTY-----------EDGEL-LVCPECGHE   28 (30)
T ss_dssp             --TTT-----E-----------E-SSS-EEETTTTEE
T ss_pred             CCCCCCCccee-----------ccCCE-EeCCccccc
Confidence            57777766544           33355 888888754


No 85 
>PRK00464 nrdR transcriptional regulator NrdR; Validated
Probab=79.00  E-value=0.26  Score=29.49  Aligned_cols=11  Identities=27%  Similarity=0.624  Sum_probs=5.3

Q ss_pred             cccCccccccC
Q psy12021         82 YQCPQCPYRAS   92 (106)
Q Consensus        82 ~~C~~C~k~f~   92 (106)
                      ++|+.||+.|.
T Consensus        29 ~~c~~c~~~f~   39 (154)
T PRK00464         29 RECLACGKRFT   39 (154)
T ss_pred             eeccccCCcce
Confidence            44555555443


No 86 
>PF12013 DUF3505:  Protein of unknown function (DUF3505);  InterPro: IPR022698  This family of proteins is functionally uncharacterised. This protein is found in eukaryotes. Proteins in this family are typically between 247 to 1018 amino acids in length. This region contains two segments that are likely to be C2H2 zinc binding domains. 
Probab=77.38  E-value=2.7  Score=23.41  Aligned_cols=25  Identities=32%  Similarity=0.621  Sum_probs=22.5

Q ss_pred             eec----ccccccccCHHHHHHHHHHHcC
Q psy12021         53 FPC----EVCGKKYKYKWGLSRHKRDECG   77 (106)
Q Consensus        53 ~~C----~~C~~~f~~~~~l~~h~~~h~~   77 (106)
                      |.|    ..|+....+...+..|.+.++|
T Consensus        81 ~~C~~~~~~C~y~~~~~~~m~~H~~~~Hg  109 (109)
T PF12013_consen   81 YRCQCDPPHCGYITRSKKTMRKHWRKEHG  109 (109)
T ss_pred             eeeecCCCCCCcEeccHHHHHHHHHHhcC
Confidence            889    9999999999999999988765


No 87 
>PF13878 zf-C2H2_3:  zinc-finger of acetyl-transferase ESCO
Probab=77.00  E-value=3.4  Score=18.88  Aligned_cols=24  Identities=25%  Similarity=0.347  Sum_probs=18.1

Q ss_pred             eecccccccccC--HHHHHHHHHHHc
Q psy12021         53 FPCEVCGKKYKY--KWGLSRHKRDEC   76 (106)
Q Consensus        53 ~~C~~C~~~f~~--~~~l~~h~~~h~   76 (106)
                      -.|..||..|..  ..+-..|.+-|.
T Consensus        14 ~~C~~CgM~Y~~~~~eD~~~H~~yH~   39 (41)
T PF13878_consen   14 TTCPTCGMLYSPGSPEDEKLHKKYHD   39 (41)
T ss_pred             cCCCCCCCEECCCCHHHHHHHHHHHh
Confidence            589999988754  667778877664


No 88 
>COG4957 Predicted transcriptional regulator [Transcription]
Probab=76.93  E-value=1.5  Score=25.67  Aligned_cols=20  Identities=20%  Similarity=0.306  Sum_probs=10.3

Q ss_pred             ccCccccccCChHHHHHHHHhhc
Q psy12021         83 QCPQCPYRASQKATLKTHMAIKH  105 (106)
Q Consensus        83 ~C~~C~k~f~~~~~l~~H~~~hh  105 (106)
                      .|-++||.|.   +|.+|+.+|+
T Consensus        78 icLEDGkkfK---SLKRHL~t~~   97 (148)
T COG4957          78 ICLEDGKKFK---SLKRHLTTHY   97 (148)
T ss_pred             EEeccCcchH---HHHHHHhccc
Confidence            4555555554   3455555554


No 89 
>PF03604 DNA_RNApol_7kD:  DNA directed RNA polymerase, 7 kDa subunit;  InterPro: IPR006591 DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Each class of RNA polymerase is assembled from 9 to 15 different polypeptides. Rbp10 (RNA polymerase CX) is a domain found in RNA polymerase subunit 10; present in RNA polymerase I, II and III.; GO: 0003677 DNA binding, 0003899 DNA-directed RNA polymerase activity, 0006351 transcription, DNA-dependent; PDB: 2PMZ_Z 3HKZ_X 2NVX_L 3S1Q_L 2JA6_L 3S17_L 3HOW_L 3HOV_L 3PO2_L 3HOZ_L ....
Probab=76.37  E-value=2.7  Score=18.19  Aligned_cols=26  Identities=35%  Similarity=0.963  Sum_probs=15.4

Q ss_pred             eecccccccccCHHHHHHHHHHHcCCCCCcccCccccc
Q psy12021         53 FPCEVCGKKYKYKWGLSRHKRDECGQEPKYQCPQCPYR   90 (106)
Q Consensus        53 ~~C~~C~~~f~~~~~l~~h~~~h~~~~~~~~C~~C~k~   90 (106)
                      |.|..||..+..+           ...+ ..|+.||..
T Consensus         1 Y~C~~Cg~~~~~~-----------~~~~-irC~~CG~R   26 (32)
T PF03604_consen    1 YICGECGAEVELK-----------PGDP-IRCPECGHR   26 (32)
T ss_dssp             EBESSSSSSE-BS-----------TSST-SSBSSSS-S
T ss_pred             CCCCcCCCeeEcC-----------CCCc-EECCcCCCe
Confidence            5678888776411           1233 789998854


No 90 
>COG1996 RPC10 DNA-directed RNA polymerase, subunit RPC10 (contains C4-type Zn-finger) [Transcription]
Probab=76.33  E-value=1.6  Score=20.89  Aligned_cols=29  Identities=24%  Similarity=0.611  Sum_probs=19.1

Q ss_pred             CceecccccccccCHHHHHHHHHHHcCCCCCcccCccccc
Q psy12021         51 GMFPCEVCGKKYKYKWGLSRHKRDECGQEPKYQCPQCPYR   90 (106)
Q Consensus        51 ~~~~C~~C~~~f~~~~~l~~h~~~h~~~~~~~~C~~C~k~   90 (106)
                      ..|.|..||+.|..   +       ..... ..|+.||..
T Consensus         5 ~~Y~C~~Cg~~~~~---~-------~~~~~-irCp~Cg~r   33 (49)
T COG1996           5 MEYKCARCGREVEL---D-------QETRG-IRCPYCGSR   33 (49)
T ss_pred             EEEEhhhcCCeeeh---h-------hccCc-eeCCCCCcE
Confidence            45899999999821   1       11133 889999853


No 91 
>KOG2482|consensus
Probab=74.76  E-value=1.9  Score=29.28  Aligned_cols=23  Identities=30%  Similarity=0.531  Sum_probs=21.2

Q ss_pred             ceecccccccccCHHHHHHHHHH
Q psy12021         52 MFPCEVCGKKYKYKWGLSRHKRD   74 (106)
Q Consensus        52 ~~~C~~C~~~f~~~~~l~~h~~~   74 (106)
                      .+.|-.|++.|..+..|..||+.
T Consensus       195 r~~CLyCekifrdkntLkeHMrk  217 (423)
T KOG2482|consen  195 RLRCLYCEKIFRDKNTLKEHMRK  217 (423)
T ss_pred             hheeeeeccccCCcHHHHHHHHh
Confidence            47899999999999999999985


No 92 
>PF09963 DUF2197:  Uncharacterized protein conserved in bacteria (DUF2197);  InterPro: IPR019241  This family represents various hypothetical bacterial proteins with no known function. 
Probab=74.67  E-value=1.2  Score=21.96  Aligned_cols=37  Identities=27%  Similarity=0.457  Sum_probs=18.8

Q ss_pred             ecccccccccCHHHHHHHHHHHcCCCCCcccCccccc
Q psy12021         54 PCEVCGKKYKYKWGLSRHKRDECGQEPKYQCPQCPYR   90 (106)
Q Consensus        54 ~C~~C~~~f~~~~~l~~h~~~h~~~~~~~~C~~C~k~   90 (106)
                      .|..|++.+.-......-.+.-......|.|++|...
T Consensus         4 kC~lCdk~~~Id~~~~~aKrLrnrPi~tYmC~eC~~R   40 (56)
T PF09963_consen    4 KCILCDKKEEIDEDTPEAKRLRNRPIHTYMCDECKER   40 (56)
T ss_pred             EEEecCCEEEeccCCHHHHHhhcCCCcceeChhHHHH
Confidence            5777777654433222222222222334888888543


No 93 
>PF07754 DUF1610:  Domain of unknown function (DUF1610);  InterPro: IPR011668 This domain is found in archaeal species. It is likely to bind zinc via its four well-conserved cysteine residues.
Probab=74.34  E-value=1.4  Score=17.80  Aligned_cols=7  Identities=43%  Similarity=1.644  Sum_probs=4.3

Q ss_pred             cccCccc
Q psy12021         82 YQCPQCP   88 (106)
Q Consensus        82 ~~C~~C~   88 (106)
                      |.|+.||
T Consensus        17 f~CPnCG   23 (24)
T PF07754_consen   17 FPCPNCG   23 (24)
T ss_pred             EeCCCCC
Confidence            6666665


No 94 
>PRK14890 putative Zn-ribbon RNA-binding protein; Provisional
Probab=73.67  E-value=2.1  Score=21.36  Aligned_cols=31  Identities=32%  Similarity=0.846  Sum_probs=17.7

Q ss_pred             ceecccccccccCHHHHHHHHHHHcCCCCCcccCccc
Q psy12021         52 MFPCEVCGKKYKYKWGLSRHKRDECGQEPKYQCPQCP   88 (106)
Q Consensus        52 ~~~C~~C~~~f~~~~~l~~h~~~h~~~~~~~~C~~C~   88 (106)
                      .|.|+.||+.--..-.     +--....+ |.|+.||
T Consensus        25 ~F~CPnCG~~~I~RC~-----~CRk~~~~-Y~CP~CG   55 (59)
T PRK14890         25 KFLCPNCGEVIIYRCE-----KCRKQSNP-YTCPKCG   55 (59)
T ss_pred             EeeCCCCCCeeEeech-----hHHhcCCc-eECCCCC
Confidence            4889999876222111     11111244 9999997


No 95 
>KOG4173|consensus
Probab=72.52  E-value=1.8  Score=27.31  Aligned_cols=51  Identities=25%  Similarity=0.461  Sum_probs=37.4

Q ss_pred             ecccccccccCHHHHHHHHHHHc----------CCCCCcccC--ccccccCChHHHHHHHHhhc
Q psy12021         54 PCEVCGKKYKYKWGLSRHKRDEC----------GQEPKYQCP--QCPYRASQKATLKTHMAIKH  105 (106)
Q Consensus        54 ~C~~C~~~f~~~~~l~~h~~~h~----------~~~~~~~C~--~C~k~f~~~~~l~~H~~~hh  105 (106)
                      .|..|.+.|.+...|..|+.-.+          | +.-|+|-  .|+..|........|+-..|
T Consensus       108 sCs~C~r~~Pt~hLLd~HI~E~HDs~Fqa~veRG-~dMy~ClvEgCt~KFkT~r~RkdH~I~~H  170 (253)
T KOG4173|consen  108 SCSFCKRAFPTGHLLDAHILEWHDSLFQALVERG-QDMYQCLVEGCTEKFKTSRDRKDHMIRMH  170 (253)
T ss_pred             hhHHHHHhCCchhhhhHHHHHHHHHHHHHHHHcC-ccHHHHHHHhhhhhhhhhhhhhhHHHHhc
Confidence            78899999998888888876332          3 3337884  48888888888777876544


No 96 
>KOG2785|consensus
Probab=72.42  E-value=5.7  Score=27.37  Aligned_cols=53  Identities=25%  Similarity=0.220  Sum_probs=42.2

Q ss_pred             CceecccccccccCHHHHHHHHHHHcCCC----------------------CCcccCccc---cccCChHHHHHHHHh
Q psy12021         51 GMFPCEVCGKKYKYKWGLSRHKRDECGQE----------------------PKYQCPQCP---YRASQKATLKTHMAI  103 (106)
Q Consensus        51 ~~~~C~~C~~~f~~~~~l~~h~~~h~~~~----------------------~~~~C~~C~---k~f~~~~~l~~H~~~  103 (106)
                      .|-.|-.|++.+.+-..-..||..++|.-                      .-+.|-.|+   +.|.+....+.||..
T Consensus       165 ~Pt~CLfC~~~~k~~e~~~~HM~~~HgffIPdreYL~D~~GLl~YLgeKV~~~~~CL~CN~~~~~f~sleavr~HM~~  242 (390)
T KOG2785|consen  165 IPTDCLFCDKKSKSLEENLKHMFKEHGFFIPDREYLTDEKGLLKYLGEKVGIGFICLFCNELGRPFSSLEAVRAHMRD  242 (390)
T ss_pred             CCcceeecCCCcccHHHHHHHHhhccCCcCCchHhhhchhHHHHHHHHHhccCceEEEeccccCcccccHHHHHHHhh
Confidence            34679999999999888889999888721                      125777787   899999999999874


No 97 
>COG4530 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=71.15  E-value=1.8  Score=24.46  Aligned_cols=28  Identities=18%  Similarity=0.090  Sum_probs=17.7

Q ss_pred             ecccccccccCHHHHHHHHHHHcCCCCCcccCccccccCC
Q psy12021         54 PCEVCGKKYKYKWGLSRHKRDECGQEPKYQCPQCPYRASQ   93 (106)
Q Consensus        54 ~C~~C~~~f~~~~~l~~h~~~h~~~~~~~~C~~C~k~f~~   93 (106)
                      .|+.||+.|..   |         .+.|..|+.||++|..
T Consensus        11 idPetg~KFYD---L---------NrdPiVsPytG~s~P~   38 (129)
T COG4530          11 IDPETGKKFYD---L---------NRDPIVSPYTGKSYPR   38 (129)
T ss_pred             cCccccchhhc---c---------CCCccccCcccccchH
Confidence            56777777632   2         1334888888888843


No 98 
>PF09986 DUF2225:  Uncharacterized protein conserved in bacteria (DUF2225);  InterPro: IPR018708 This conserved bacterial family has no known function.
Probab=71.08  E-value=4.7  Score=25.45  Aligned_cols=55  Identities=16%  Similarity=0.251  Sum_probs=28.8

Q ss_pred             ccccceecccCCceeeeeEeeeeccccCCcCcccccCccCcceeccCCCceecccccccccCH
Q psy12021          3 VCSHAICVAKSTSITETCIVIRSLGVDKSLDTNVLNFINWPTVRQYNSGMFPCEVCGKKYKYK   65 (106)
Q Consensus         3 ~C~~~~c~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~C~~C~~~f~~~   65 (106)
                      +||  .|...|.+.......++-...+.++.......  .+    .--..+.|+.||-++...
T Consensus         7 ~CP--vC~~~F~~~~vrs~~~r~~~~d~D~~~~Y~~v--nP----~~Y~V~vCP~CgyA~~~~   61 (214)
T PF09986_consen    7 TCP--VCGKEFKTKKVRSGKIRVIRRDSDFCPRYKGV--NP----LFYEVWVCPHCGYAAFEE   61 (214)
T ss_pred             ECC--CCCCeeeeeEEEcCCceEeeecCCCccccCCC--CC----eeeeEEECCCCCCccccc
Confidence            576  88888887665554444433333332211110  00    112236899999776543


No 99 
>PF13451 zf-trcl:  Probable zinc-binding domain
Probab=70.62  E-value=2.7  Score=20.13  Aligned_cols=37  Identities=22%  Similarity=0.640  Sum_probs=21.3

Q ss_pred             CceecccccccccCHHHHHHHHHHHcCC-CCCcccCccc
Q psy12021         51 GMFPCEVCGKKYKYKWGLSRHKRDECGQ-EPKYQCPQCP   88 (106)
Q Consensus        51 ~~~~C~~C~~~f~~~~~l~~h~~~h~~~-~~~~~C~~C~   88 (106)
                      +.+.|..||..|.....-+..-.. .|. ..|-.|+.|.
T Consensus         3 k~l~C~dCg~~FvfTa~EQ~fy~e-Kgf~n~p~RC~~CR   40 (49)
T PF13451_consen    3 KTLTCKDCGAEFVFTAGEQKFYAE-KGFDNEPKRCPSCR   40 (49)
T ss_pred             eeEEcccCCCeEEEehhHHHHHHh-cCCcCCCccCHHHH
Confidence            457899999988665443333222 222 1236777774


No 100
>KOG4167|consensus
Probab=70.26  E-value=0.95  Score=33.63  Aligned_cols=23  Identities=17%  Similarity=0.400  Sum_probs=21.1

Q ss_pred             cccCccccccCChHHHHHHHHhh
Q psy12021         82 YQCPQCPYRASQKATLKTHMAIK  104 (106)
Q Consensus        82 ~~C~~C~k~f~~~~~l~~H~~~h  104 (106)
                      |.|.+|+|.|-.-.++..|++.|
T Consensus       793 FpCreC~kvF~KiKSrNAHMK~H  815 (907)
T KOG4167|consen  793 FPCRECGKVFFKIKSRNAHMKTH  815 (907)
T ss_pred             eehHHHHHHHHHHhhhhHHHHHH
Confidence            89999999998888899999887


No 101
>PF05191 ADK_lid:  Adenylate kinase, active site lid;  InterPro: IPR007862 Adenylate kinases (ADK; 2.7.4.3 from EC) are phosphotransferases that catalyse the Mg-dependent reversible conversion of ATP and AMP to two molecules of ADP, an essential reaction for many processes in living cells. In large variants of adenylate kinase, the AMP and ATP substrates are buried in a domain that undergoes conformational changes from an open to a closed state when bound to substrate; the ligand is then contained within a highly specific environment required for catalysis. Adenylate kinase is a 3-domain protein consisting of a large central CORE domain flanked by a LID domain on one side and the AMP-binding NMPbind domain on the other []. The LID domain binds ATP and covers the phosphates at the active site. The substrates first bind the CORE domain, followed by closure of the active site by the LID and NMPbind domains. Comparisons of adenylate kinases have revealed a particular divergence in the active site lid. In some organisms, particularly the Gram-positive bacteria, residues in the lid domain have been mutated to cysteines and these cysteine residues (two CX(n)C motifs) are responsible for the binding of a zinc ion. The bound zinc ion in the lid domain is clearly structurally homologous to Zinc-finger domains. However, it is unclear whether the adenylate kinase lid is a novel zinc-finger DNA/RNA binding domain, or that the lid bound zinc serves a purely structural function [].; GO: 0004017 adenylate kinase activity; PDB: 3BE4_A 2OSB_B 2ORI_A 2EU8_A 3DL0_A 1P3J_A 2QAJ_A 2OO7_A 2P3S_A 3DKV_A ....
Probab=70.11  E-value=1.2  Score=19.88  Aligned_cols=32  Identities=22%  Similarity=0.462  Sum_probs=18.2

Q ss_pred             eecccccccccCHHHHHHHHHHHcCCCCCcccCccccccCC
Q psy12021         53 FPCEVCGKKYKYKWGLSRHKRDECGQEPKYQCPQCPYRASQ   93 (106)
Q Consensus        53 ~~C~~C~~~f~~~~~l~~h~~~h~~~~~~~~C~~C~k~f~~   93 (106)
                      +.|..||+.|....        ... +..-.|+.||..+.+
T Consensus         2 r~C~~Cg~~Yh~~~--------~pP-~~~~~Cd~cg~~L~q   33 (36)
T PF05191_consen    2 RICPKCGRIYHIEF--------NPP-KVEGVCDNCGGELVQ   33 (36)
T ss_dssp             EEETTTTEEEETTT--------B---SSTTBCTTTTEBEBE
T ss_pred             cCcCCCCCcccccc--------CCC-CCCCccCCCCCeeEe
Confidence            46888888874321        112 222678888865543


No 102
>KOG3408|consensus
Probab=69.08  E-value=4  Score=23.49  Aligned_cols=27  Identities=22%  Similarity=0.406  Sum_probs=23.8

Q ss_pred             cCCCceecccccccccCHHHHHHHHHH
Q psy12021         48 YNSGMFPCEVCGKKYKYKWGLSRHKRD   74 (106)
Q Consensus        48 ~~~~~~~C~~C~~~f~~~~~l~~h~~~   74 (106)
                      .|...|-|-.|.+-|.+...|..|.++
T Consensus        53 PG~GqfyCi~CaRyFi~~~~l~~H~kt   79 (129)
T KOG3408|consen   53 PGGGQFYCIECARYFIDAKALKTHFKT   79 (129)
T ss_pred             CCCceeehhhhhhhhcchHHHHHHHhc
Confidence            566779999999999999999999874


No 103
>KOG2593|consensus
Probab=67.62  E-value=4.5  Score=28.31  Aligned_cols=39  Identities=23%  Similarity=0.412  Sum_probs=25.6

Q ss_pred             cCCCceecccccccccCHHHHHHHHHHHcCCCCCcccCccccc
Q psy12021         48 YNSGMFPCEVCGKKYKYKWGLSRHKRDECGQEPKYQCPQCPYR   90 (106)
Q Consensus        48 ~~~~~~~C~~C~~~f~~~~~l~~h~~~h~~~~~~~~C~~C~k~   90 (106)
                      +...-|.|+.|.+.|..-..++.   .-..... |.|..|+--
T Consensus       124 t~~~~Y~Cp~C~kkyt~Lea~~L---~~~~~~~-F~C~~C~ge  162 (436)
T KOG2593|consen  124 TNVAGYVCPNCQKKYTSLEALQL---LDNETGE-FHCENCGGE  162 (436)
T ss_pred             cccccccCCccccchhhhHHHHh---hcccCce-EEEecCCCc
Confidence            45566999999999877665542   2222234 889888753


No 104
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only]
Probab=66.84  E-value=8.4  Score=26.43  Aligned_cols=48  Identities=19%  Similarity=0.142  Sum_probs=33.2

Q ss_pred             ecccccccccCHHHHHHHHHHHcCCCCCcccCcccc----ccCChHHHHHHHHh
Q psy12021         54 PCEVCGKKYKYKWGLSRHKRDECGQEPKYQCPQCPY----RASQKATLKTHMAI  103 (106)
Q Consensus        54 ~C~~C~~~f~~~~~l~~h~~~h~~~~~~~~C~~C~k----~f~~~~~l~~H~~~  103 (106)
                      .|..|.+.|....-|..|++..+. +- |.|+.-+.    -|..-..|..|.+.
T Consensus       222 ~C~FC~~~FYdDDEL~~HcR~~HE-~C-hICD~v~p~~~QYFK~Y~~Le~HF~~  273 (493)
T COG5236         222 LCIFCKIYFYDDDELRRHCRLRHE-AC-HICDMVGPIRYQYFKSYEDLEAHFRN  273 (493)
T ss_pred             hhhhccceecChHHHHHHHHhhhh-hh-hhhhccCccchhhhhCHHHHHHHhhc
Confidence            588999999999999999886554 33 66655443    36666666666543


No 105
>KOG2785|consensus
Probab=66.70  E-value=7.1  Score=26.91  Aligned_cols=51  Identities=16%  Similarity=0.346  Sum_probs=36.0

Q ss_pred             eecccccccccCHHHHHHHHHH--Hc----------------------------------CCCCCcccCccccccCChHH
Q psy12021         53 FPCEVCGKKYKYKWGLSRHKRD--EC----------------------------------GQEPKYQCPQCPYRASQKAT   96 (106)
Q Consensus        53 ~~C~~C~~~f~~~~~l~~h~~~--h~----------------------------------~~~~~~~C~~C~k~f~~~~~   96 (106)
                      |.|.-|...|.....-+.|.++  |.                                  ....++.|..|.+.|.....
T Consensus         4 ftC~tC~v~F~~ad~Qr~HyKSdWHRYNLKRkVA~lPPItaE~F~~k~~s~~~~~~~~~e~~~~~~~c~~c~k~~~s~~a   83 (390)
T KOG2785|consen    4 FTCNTCNVEFDDADEQRAHYKSDWHRYNLKRKVASLPPITAEEFNEKVLSDDSEKEENLEEAESVVYCEACNKSFASPKA   83 (390)
T ss_pred             ceeeceeeeeccHHHHHHHhhhhHHHhhHHhHhhcCCCcCHHHHhHHHhhhhhhhhhhhhhcccceehHHhhccccChhh
Confidence            6788888888777666666553  21                                  01234889999999999888


Q ss_pred             HHHHHHh
Q psy12021         97 LKTHMAI  103 (106)
Q Consensus        97 l~~H~~~  103 (106)
                      ...|+..
T Consensus        84 ~~~hl~S   90 (390)
T KOG2785|consen   84 HENHLKS   90 (390)
T ss_pred             HHHHHHH
Confidence            8888764


No 106
>TIGR01206 lysW lysine biosynthesis protein LysW. This very small, poorly characterized protein has been shown essential in Thermus thermophilus for an unusual pathway of Lys biosynthesis from aspartate by way of alpha-aminoadipate (AAA) rather than diaminopimelate. It is found also in Deinococcus radiodurans and Pyrococcus horikoshii, which appear to share the AAA pathway.
Probab=66.02  E-value=1.7  Score=21.29  Aligned_cols=30  Identities=30%  Similarity=0.627  Sum_probs=19.7

Q ss_pred             eecccccccccCHHHHHHHHHHHcCCCCCcccCcccccc
Q psy12021         53 FPCEVCGKKYKYKWGLSRHKRDECGQEPKYQCPQCPYRA   91 (106)
Q Consensus        53 ~~C~~C~~~f~~~~~l~~h~~~h~~~~~~~~C~~C~k~f   91 (106)
                      |.|+.||..+.-...       ..| .. ..|+.||..|
T Consensus         3 ~~CP~CG~~iev~~~-------~~G-ei-V~Cp~CGael   32 (54)
T TIGR01206         3 FECPDCGAEIELENP-------ELG-EL-VICDECGAEL   32 (54)
T ss_pred             cCCCCCCCEEecCCC-------ccC-CE-EeCCCCCCEE
Confidence            689999987644322       123 45 7899998765


No 107
>PF15269 zf-C2H2_7:  Zinc-finger
Probab=65.80  E-value=5.1  Score=18.80  Aligned_cols=21  Identities=43%  Similarity=0.982  Sum_probs=11.5

Q ss_pred             cccCccccccCChHHHHHHHH
Q psy12021         82 YQCPQCPYRASQKATLKTHMA  102 (106)
Q Consensus        82 ~~C~~C~k~f~~~~~l~~H~~  102 (106)
                      |+|-+|.-+..-++.|..|++
T Consensus        21 ykcfqcpftc~~kshl~nhmk   41 (54)
T PF15269_consen   21 YKCFQCPFTCNEKSHLFNHMK   41 (54)
T ss_pred             ceeecCCcccchHHHHHHHHH
Confidence            455555555555555555554


No 108
>TIGR00280 L37a ribosomal protein L37a. This model finds eukaryotic ribosomal protein L37a and its archaeal orthologs. The nomeclature is tricky because eukaryotes have proteins called both L37 and L37a.
Probab=65.43  E-value=1.2  Score=24.23  Aligned_cols=31  Identities=32%  Similarity=0.769  Sum_probs=18.7

Q ss_pred             CceecccccccccCHHHHHHHHHHHcCCCCCcccCccccccC
Q psy12021         51 GMFPCEVCGKKYKYKWGLSRHKRDECGQEPKYQCPQCPYRAS   92 (106)
Q Consensus        51 ~~~~C~~C~~~f~~~~~l~~h~~~h~~~~~~~~C~~C~k~f~   92 (106)
                      ..|.|+.|++.-.        .+.-.|  . +.|..|++.|.
T Consensus        34 a~y~CpfCgk~~v--------kR~a~G--I-W~C~~C~~~~A   64 (91)
T TIGR00280        34 AKYVCPFCGKKTV--------KRGSTG--I-WTCRKCGAKFA   64 (91)
T ss_pred             cCccCCCCCCCce--------EEEeeE--E-EEcCCCCCEEe
Confidence            4578888875421        122233  3 78888888764


No 109
>PRK09678 DNA-binding transcriptional regulator; Provisional
Probab=65.40  E-value=1.5  Score=22.81  Aligned_cols=11  Identities=27%  Similarity=0.543  Sum_probs=5.3

Q ss_pred             cccC--ccccccC
Q psy12021         82 YQCP--QCPYRAS   92 (106)
Q Consensus        82 ~~C~--~C~k~f~   92 (106)
                      ++|.  +||..|.
T Consensus        28 ~qC~N~eCg~tF~   40 (72)
T PRK09678         28 HQCQNVNCSATFI   40 (72)
T ss_pred             eecCCCCCCCEEE
Confidence            4454  4555543


No 110
>PHA00626 hypothetical protein
Probab=65.36  E-value=3.6  Score=20.30  Aligned_cols=15  Identities=40%  Similarity=0.897  Sum_probs=11.1

Q ss_pred             CcccCccccccCChH
Q psy12021         81 KYQCPQCPYRASQKA   95 (106)
Q Consensus        81 ~~~C~~C~k~f~~~~   95 (106)
                      .|.|+.||..|+...
T Consensus        23 rYkCkdCGY~ft~~~   37 (59)
T PHA00626         23 DYVCCDCGYNDSKDA   37 (59)
T ss_pred             ceEcCCCCCeechhh
Confidence            388888888776543


No 111
>PTZ00255 60S ribosomal protein L37a; Provisional
Probab=64.71  E-value=1.5  Score=23.88  Aligned_cols=32  Identities=28%  Similarity=0.702  Sum_probs=19.2

Q ss_pred             CCceecccccccccCHHHHHHHHHHHcCCCCCcccCccccccC
Q psy12021         50 SGMFPCEVCGKKYKYKWGLSRHKRDECGQEPKYQCPQCPYRAS   92 (106)
Q Consensus        50 ~~~~~C~~C~~~f~~~~~l~~h~~~h~~~~~~~~C~~C~k~f~   92 (106)
                      ...|.|+.|++.-.        .+.-.|  . +.|..|++.|.
T Consensus        34 ~a~y~CpfCgk~~v--------kR~a~G--I-W~C~~C~~~~A   65 (90)
T PTZ00255         34 HAKYFCPFCGKHAV--------KRQAVG--I-WRCKGCKKTVA   65 (90)
T ss_pred             hCCccCCCCCCCce--------eeeeeE--E-EEcCCCCCEEe
Confidence            34588888875421        122223  3 88888888764


No 112
>PF10571 UPF0547:  Uncharacterised protein family UPF0547;  InterPro: IPR018886  This domain may well be a type of zinc-finger as it carries two pairs of highly conserved cysteine residues though with no accompanying histidines. Several members are annotated as putative helicases. 
Probab=64.30  E-value=3.8  Score=16.79  Aligned_cols=11  Identities=36%  Similarity=0.936  Sum_probs=7.3

Q ss_pred             cccCccccccC
Q psy12021         82 YQCPQCPYRAS   92 (106)
Q Consensus        82 ~~C~~C~k~f~   92 (106)
                      -.|+.||..|.
T Consensus        15 ~~Cp~CG~~F~   25 (26)
T PF10571_consen   15 KFCPHCGYDFE   25 (26)
T ss_pred             CcCCCCCCCCc
Confidence            35777777664


No 113
>PRK03824 hypA hydrogenase nickel incorporation protein; Provisional
Probab=63.72  E-value=2.5  Score=24.71  Aligned_cols=15  Identities=27%  Similarity=0.904  Sum_probs=11.9

Q ss_pred             CceecccccccccCH
Q psy12021         51 GMFPCEVCGKKYKYK   65 (106)
Q Consensus        51 ~~~~C~~C~~~f~~~   65 (106)
                      ..|.|..||..|...
T Consensus        69 ~~~~C~~CG~~~~~~   83 (135)
T PRK03824         69 AVLKCRNCGNEWSLK   83 (135)
T ss_pred             eEEECCCCCCEEecc
Confidence            458999999888654


No 114
>COG2331 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=62.70  E-value=3.2  Score=21.81  Aligned_cols=32  Identities=22%  Similarity=0.754  Sum_probs=20.3

Q ss_pred             eecccccccccCHHHHHHHHHHHcCCCCCcccCccccccC
Q psy12021         53 FPCEVCGKKYKYKWGLSRHKRDECGQEPKYQCPQCPYRAS   92 (106)
Q Consensus        53 ~~C~~C~~~f~~~~~l~~h~~~h~~~~~~~~C~~C~k~f~   92 (106)
                      |+|..||..|.    +..++.    +.+.-.|++|+..+.
T Consensus        13 Y~c~~cg~~~d----vvq~~~----ddplt~ce~c~a~~k   44 (82)
T COG2331          13 YECTECGNRFD----VVQAMT----DDPLTTCEECGARLK   44 (82)
T ss_pred             EeecccchHHH----HHHhcc----cCccccChhhChHHH
Confidence            89999997763    222222    344467999986543


No 115
>smart00154 ZnF_AN1 AN1-like Zinc finger. Zinc finger at the C-terminus of An1, a ubiquitin-like protein in Xenopus laevis.
Probab=61.70  E-value=4.1  Score=18.38  Aligned_cols=14  Identities=14%  Similarity=0.515  Sum_probs=10.6

Q ss_pred             CcccCccccccCCh
Q psy12021         81 KYQCPQCPYRASQK   94 (106)
Q Consensus        81 ~~~C~~C~k~f~~~   94 (106)
                      |+.|..|++.|-..
T Consensus        12 ~f~C~~C~~~FC~~   25 (39)
T smart00154       12 GFKCRHCGNLFCGE   25 (39)
T ss_pred             CeECCccCCccccc
Confidence            38888888887654


No 116
>KOG1146|consensus
Probab=61.49  E-value=1.8  Score=34.24  Aligned_cols=51  Identities=22%  Similarity=0.260  Sum_probs=35.5

Q ss_pred             cccccccccCHHHHHHHHHHHcCCCCCcccCccccccCChHHHHHHHHhhc
Q psy12021         55 CEVCGKKYKYKWGLSRHKRDECGQEPKYQCPQCPYRASQKATLKTHMAIKH  105 (106)
Q Consensus        55 C~~C~~~f~~~~~l~~h~~~h~~~~~~~~C~~C~k~f~~~~~l~~H~~~hh  105 (106)
                      |..++..+.+...+..|+..-....+.+.|+.|+..|.....|..|+|..|
T Consensus       439 ~~~~e~~~~s~r~~~~~t~~L~S~~kt~~cpkc~~~yk~a~~L~vhmRskh  489 (1406)
T KOG1146|consen  439 LTKAEPLLESKRSLEGQTVVLHSFFKTLKCPKCNWHYKLAQTLGVHMRSKH  489 (1406)
T ss_pred             ccchhhhhhhhcccccceeeeecccccccCCccchhhhhHHHhhhcccccc
Confidence            444555565555555555533333344999999999999999999999743


No 117
>PF07503 zf-HYPF:  HypF finger;  InterPro: IPR011125 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  Proteins of the HypF family are involved in the maturation and regulation of hydrogenase []. In the N terminus they appear to have two zinc finger domains that are similar to those found in the DnaJ chaperone []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 3TTD_A 3TSQ_A 3TTC_A 3TSP_A 3TTF_A 3TSU_A.
Probab=60.35  E-value=0.95  Score=20.06  Aligned_cols=11  Identities=36%  Similarity=0.706  Sum_probs=5.9

Q ss_pred             cccCccccccC
Q psy12021         82 YQCPQCPYRAS   92 (106)
Q Consensus        82 ~~C~~C~k~f~   92 (106)
                      ..|..||..|+
T Consensus        22 isC~~CGPr~~   32 (35)
T PF07503_consen   22 ISCTNCGPRYS   32 (35)
T ss_dssp             --BTTCC-SCC
T ss_pred             ccCCCCCCCEE
Confidence            67888887664


No 118
>PF01363 FYVE:  FYVE zinc finger;  InterPro: IPR000306 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The FYVE zinc finger is named after four proteins that it has been found in: Fab1, YOTB/ZK632.12, Vac1, and EEA1. The FYVE finger has been shown to bind two zinc ions []. The FYVE finger has eight potential zinc coordinating cysteine positions. Many members of this family also include two histidines in a motif R+HHC+XCG, where + represents a charged residue and X any residue. FYVE-type domains are divided into two known classes: FYVE domains that specifically bind to phosphatidylinositol 3-phosphate in lipid bilayers and FYVE-related domains of undetermined function []. Those that bind to phosphatidylinositol 3-phosphate are often found in proteins targeted to lipid membranes that are involved in regulating membrane traffic [, , ]. Most FYVE domains target proteins to endosomes by binding specifically to phosphatidylinositol-3-phosphate at the membrane surface. By contrast, the CARP2 FYVE-like domain is not optimized to bind to phosphoinositides or insert into lipid bilayers. FYVE domains are distinguished from other zinc fingers by three signature sequences: an N-terminal WxxD motif, a basic R(R/K)HHCR patch, and a C-terminal RVC motif. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0046872 metal ion binding; PDB: 1HYI_A 1JOC_B 1HYJ_A 1DVP_A 3ZYQ_A 4AVX_A 1VFY_A 3T7L_A 1X4U_A 1WFK_A ....
Probab=58.93  E-value=4.7  Score=20.30  Aligned_cols=27  Identities=26%  Similarity=0.630  Sum_probs=11.2

Q ss_pred             eecccccccccCHHHHHHHHHHHcCCCCCcccCccccccC
Q psy12021         53 FPCEVCGKKYKYKWGLSRHKRDECGQEPKYQCPQCPYRAS   92 (106)
Q Consensus        53 ~~C~~C~~~f~~~~~l~~h~~~h~~~~~~~~C~~C~k~f~   92 (106)
                      -.|..|++.|..            ...+ +.|..||..|-
T Consensus        10 ~~C~~C~~~F~~------------~~rr-hhCr~CG~~vC   36 (69)
T PF01363_consen   10 SNCMICGKKFSL------------FRRR-HHCRNCGRVVC   36 (69)
T ss_dssp             SB-TTT--B-BS------------SS-E-EE-TTT--EEE
T ss_pred             CcCcCcCCcCCC------------ceee-EccCCCCCEEC
Confidence            467888888843            1234 77777777653


No 119
>KOG2636|consensus
Probab=58.32  E-value=7.2  Score=27.54  Aligned_cols=29  Identities=28%  Similarity=0.437  Sum_probs=22.2

Q ss_pred             eeccCCCceeccccc-ccccCHHHHHHHHH
Q psy12021         45 VRQYNSGMFPCEVCG-KKYKYKWGLSRHKR   73 (106)
Q Consensus        45 ~~~~~~~~~~C~~C~-~~f~~~~~l~~h~~   73 (106)
                      .-|.-...|.|++|| .++.-+..+.+|-.
T Consensus       394 KLHGL~~ey~CEICGNy~Y~GrkaF~RHF~  423 (497)
T KOG2636|consen  394 KLHGLDIEYNCEICGNYVYKGRKAFDRHFN  423 (497)
T ss_pred             hhcCCCcccceeeccCccccCcHHHHHHhH
Confidence            334556679999999 77888888888865


No 120
>PF01428 zf-AN1:  AN1-like Zinc finger;  InterPro: IPR000058 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents the AN1-type zinc finger domain, which has a dimetal (zinc)-bound alpha/beta fold. This domain was first identified as a zinc finger at the C terminus of AN1 Q91889 from SWISSPROT, a ubiquitin-like protein in Xenopus laevis []. The AN1-type zinc finger contains six conserved cysteines and two histidines that could potentially coordinate 2 zinc atoms. Certain stress-associated proteins (SAP) contain AN1 domain, often in combination with A20 zinc finger domains (SAP8) or C2H2 domains (SAP16) []. For example, the human protein Znf216 has an A20 zinc-finger at the N terminus and an AN1 zinc-finger at the C terminus, acting to negatively regulate the NFkappaB activation pathway and to interact with components of the immune response like RIP, IKKgamma and TRAF6. The interact of Znf216 with IKK-gamma and RIP is mediated by the A20 zinc-finger domain, while its interaction with TRAF6 is mediated by the AN1 zinc-finger domain; therefore, both zinc-finger domains are involved in regulating the immune response []. The AN1 zinc finger domain is also found in proteins containing a ubiquitin-like domain, which are involved in the ubiquitination pathway []. Proteins containing an AN1-type zinc finger include:   Ascidian posterior end mark 6 (pem-6) protein []. Human AWP1 protein (associated with PRK1), which is expressed during early embryogenesis []. Human immunoglobulin mu binding protein 2 (SMUBP-2), mutations in which cause muscular atrophy with respiratory distress type 1 [].   More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 1WFP_A 1WYS_A 1WG2_A 1WFH_A 1X4W_A 1WFE_A 1WFL_A 1X4V_A.
Probab=57.74  E-value=3.2  Score=19.06  Aligned_cols=14  Identities=21%  Similarity=0.598  Sum_probs=7.8

Q ss_pred             CcccCccccccCCh
Q psy12021         81 KYQCPQCPYRASQK   94 (106)
Q Consensus        81 ~~~C~~C~k~f~~~   94 (106)
                      |+.|+.|++.|-..
T Consensus        13 ~~~C~~C~~~FC~~   26 (43)
T PF01428_consen   13 PFKCKHCGKSFCLK   26 (43)
T ss_dssp             HEE-TTTS-EE-TT
T ss_pred             CeECCCCCcccCcc
Confidence            47888888877554


No 121
>TIGR00100 hypA hydrogenase nickel insertion protein HypA. In Hpylori, hypA mutant abolished hydrogenase activity and decrease in urease activity. Nickel supplementation in media restored urease activity and partial hydrogenase activity. HypA probably involved in inserting Ni in enzymes.
Probab=57.73  E-value=4.5  Score=22.93  Aligned_cols=27  Identities=26%  Similarity=0.612  Sum_probs=18.6

Q ss_pred             CceecccccccccCHHHHHHHHHHHcCCCCCcccCccccc
Q psy12021         51 GMFPCEVCGKKYKYKWGLSRHKRDECGQEPKYQCPQCPYR   90 (106)
Q Consensus        51 ~~~~C~~C~~~f~~~~~l~~h~~~h~~~~~~~~C~~C~k~   90 (106)
                      -...|..|+..|....            .. +.||.||..
T Consensus        69 ~~~~C~~Cg~~~~~~~------------~~-~~CP~Cgs~   95 (115)
T TIGR00100        69 VECECEDCSEEVSPEI------------DL-YRCPKCHGI   95 (115)
T ss_pred             cEEEcccCCCEEecCC------------cC-ccCcCCcCC
Confidence            3478999998875432            13 779999853


No 122
>COG4306 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=57.07  E-value=3  Score=24.13  Aligned_cols=16  Identities=31%  Similarity=0.530  Sum_probs=10.3

Q ss_pred             CCCcccCccccccCCh
Q psy12021         79 EPKYQCPQCPYRASQK   94 (106)
Q Consensus        79 ~~~~~C~~C~k~f~~~   94 (106)
                      ++|--|..||+.|.+.
T Consensus        66 e~psfchncgs~fpwt   81 (160)
T COG4306          66 EPPSFCHNCGSRFPWT   81 (160)
T ss_pred             CCcchhhcCCCCCCcH
Confidence            4555677777777664


No 123
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only]
Probab=56.58  E-value=20  Score=24.75  Aligned_cols=24  Identities=21%  Similarity=0.408  Sum_probs=20.1

Q ss_pred             cccCccccccCChHHHHHHHHhhc
Q psy12021         82 YQCPQCPYRASQKATLKTHMAIKH  105 (106)
Q Consensus        82 ~~C~~C~k~f~~~~~l~~H~~~hh  105 (106)
                      -.|..|...|.....|..|+|..|
T Consensus       221 P~C~FC~~~FYdDDEL~~HcR~~H  244 (493)
T COG5236         221 PLCIFCKIYFYDDDELRRHCRLRH  244 (493)
T ss_pred             chhhhccceecChHHHHHHHHhhh
Confidence            368889999999999999988655


No 124
>PRK12380 hydrogenase nickel incorporation protein HybF; Provisional
Probab=56.36  E-value=5.6  Score=22.49  Aligned_cols=26  Identities=23%  Similarity=0.417  Sum_probs=17.9

Q ss_pred             CceecccccccccCHHHHHHHHHHHcCCCCCcccCcccc
Q psy12021         51 GMFPCEVCGKKYKYKWGLSRHKRDECGQEPKYQCPQCPY   89 (106)
Q Consensus        51 ~~~~C~~C~~~f~~~~~l~~h~~~h~~~~~~~~C~~C~k   89 (106)
                      -.+.|..||..|....            .. +.||.||.
T Consensus        69 ~~~~C~~Cg~~~~~~~------------~~-~~CP~Cgs   94 (113)
T PRK12380         69 AQAWCWDCSQVVEIHQ------------HD-AQCPHCHG   94 (113)
T ss_pred             cEEEcccCCCEEecCC------------cC-ccCcCCCC
Confidence            3478999997774321            23 67999984


No 125
>PF01155 HypA:  Hydrogenase expression/synthesis hypA family;  InterPro: IPR000688 Bacterial membrane-bound nickel-dependent hydrogenases requires a number of accessory proteins which are involved in their maturation. The exact role of these proteins is not yet clear, but some seem to be required for the incorporation of the nickel ions []. One of these proteins is generally known as hypA. It is a protein of about 12 to 14 kDa that contains, in its C-terminal region, four conserved cysteines that form a zinc-finger like motif. Escherichia coli has two proteins that belong to this family, hypA and hybF. A homologue, MJ0214, has also been found in a number of archaeal species, including the genome of Methanocaldococcus jannaschii (Methanococcus jannaschii).; GO: 0016151 nickel ion binding, 0006464 protein modification process; PDB: 2KDX_A 3A44_D 3A43_B.
Probab=55.95  E-value=7.6  Score=21.90  Aligned_cols=26  Identities=23%  Similarity=0.664  Sum_probs=17.1

Q ss_pred             ceecccccccccCHHHHHHHHHHHcCCCCCcccCccccc
Q psy12021         52 MFPCEVCGKKYKYKWGLSRHKRDECGQEPKYQCPQCPYR   90 (106)
Q Consensus        52 ~~~C~~C~~~f~~~~~l~~h~~~h~~~~~~~~C~~C~k~   90 (106)
                      .+.|..||..|....            .. +.||.||..
T Consensus        70 ~~~C~~Cg~~~~~~~------------~~-~~CP~Cgs~   95 (113)
T PF01155_consen   70 RARCRDCGHEFEPDE------------FD-FSCPRCGSP   95 (113)
T ss_dssp             EEEETTTS-EEECHH------------CC-HH-SSSSSS
T ss_pred             cEECCCCCCEEecCC------------CC-CCCcCCcCC
Confidence            478999999986432            23 679999864


No 126
>TIGR00686 phnA alkylphosphonate utilization operon protein PhnA. The protein family includes an uncharacterized member designated phnA in Escherichia coli, part of a large operon associated with alkylphosphonate uptake and carbon-phosphorus bond cleavage. This protein is not related to the characterized phosphonoacetate hydrolase designated PhnA by Kulakova, et al. (2001, 1997).
Probab=55.79  E-value=5.9  Score=22.32  Aligned_cols=29  Identities=31%  Similarity=0.917  Sum_probs=16.5

Q ss_pred             ecccccccccCHHHHHHHHHHHcCCCCCcccCccccccCCh
Q psy12021         54 PCEVCGKKYKYKWGLSRHKRDECGQEPKYQCPQCPYRASQK   94 (106)
Q Consensus        54 ~C~~C~~~f~~~~~l~~h~~~h~~~~~~~~C~~C~k~f~~~   94 (106)
                      .|+.|+..|...           ...- |.|++|+..+...
T Consensus         4 ~CP~C~seytY~-----------dg~~-~iCpeC~~EW~~~   32 (109)
T TIGR00686         4 PCPKCNSEYTYH-----------DGTQ-LICPSCLYEWNEN   32 (109)
T ss_pred             cCCcCCCcceEe-----------cCCe-eECcccccccccc
Confidence            466666655432           2244 7777777666443


No 127
>cd00065 FYVE FYVE domain; Zinc-binding domain; targets proteins to membrane lipids via interaction with phosphatidylinositol-3-phosphate, PI3P; present in Fab1, YOTB, Vac1, and EEA1;
Probab=55.39  E-value=9.9  Score=18.18  Aligned_cols=9  Identities=44%  Similarity=1.187  Sum_probs=4.1

Q ss_pred             ccccccccc
Q psy12021         55 CEVCGKKYK   63 (106)
Q Consensus        55 C~~C~~~f~   63 (106)
                      |..|++.|.
T Consensus         5 C~~C~~~F~   13 (57)
T cd00065           5 CMGCGKPFT   13 (57)
T ss_pred             CcccCcccc
Confidence            444444443


No 128
>PF01927 Mut7-C:  Mut7-C RNAse domain;  InterPro: IPR002782 This prokaryotic family of proteins have no known function. The proteins contain four conserved cysteines that may be involved in metal binding or disulphide bridges.
Probab=55.06  E-value=8.5  Score=22.71  Aligned_cols=48  Identities=15%  Similarity=0.170  Sum_probs=27.3

Q ss_pred             eecccccccccCHHHHHHHHHHHc-----CCCCCcccCccccccCChHHHHHHH
Q psy12021         53 FPCEVCGKKYKYKWGLSRHKRDEC-----GQEPKYQCPQCPYRASQKATLKTHM  101 (106)
Q Consensus        53 ~~C~~C~~~f~~~~~l~~h~~~h~-----~~~~~~~C~~C~k~f~~~~~l~~H~  101 (106)
                      -.|..|+..+..-+.-..--.+..     ..+- +.|+.||+.|..-+.+.+-.
T Consensus        92 sRC~~CN~~L~~v~~~~v~~~vp~~v~~~~~~f-~~C~~C~kiyW~GsH~~~~~  144 (147)
T PF01927_consen   92 SRCPKCNGPLRPVSKEEVKDRVPPYVYETYDEF-WRCPGCGKIYWEGSHWRRME  144 (147)
T ss_pred             CccCCCCcEeeechhhccccccCccccccCCeE-EECCCCCCEecccccHHHHH
Confidence            479999876533221111001111     1133 78999999998888776543


No 129
>PF07975 C1_4:  TFIIH C1-like domain;  InterPro: IPR004595 All proteins in this domain for which functions are known are components of the TFIIH complex which is involved in the initiation of transcription and nucleotide excision repair. It includes the yeast transcription factor Ssl1 (Suppressor of stem-loop protein 1) that is essential for translation initiation and affects UV resistance. The C-terminal region is essential for transcription activity. This regions binds three zinc atoms through two independent domain. The first contains a C4 zinc finger motif, whereas the second is characterised by a CX(2)CX(2-4)FCADCD motif. The solution structure of the second C-terminal domain revealed homology with the regulatory domain of protein kinase C [].; GO: 0006281 DNA repair, 0005634 nucleus; PDB: 1Z60_A.
Probab=53.99  E-value=2.7  Score=20.35  Aligned_cols=17  Identities=12%  Similarity=0.522  Sum_probs=6.5

Q ss_pred             ceecccccccccCHHHH
Q psy12021         52 MFPCEVCGKKYKYKWGL   68 (106)
Q Consensus        52 ~~~C~~C~~~f~~~~~l   68 (106)
                      .|.|+.|...|-..-+.
T Consensus        21 ~y~C~~C~~~FC~dCD~   37 (51)
T PF07975_consen   21 RYRCPKCKNHFCIDCDV   37 (51)
T ss_dssp             EE--TTTT--B-HHHHH
T ss_pred             eEECCCCCCccccCcCh
Confidence            46666666666544443


No 130
>KOG4173|consensus
Probab=52.67  E-value=9.4  Score=24.22  Aligned_cols=50  Identities=20%  Similarity=0.352  Sum_probs=35.7

Q ss_pred             Cceeccc--ccccccCHHHHHHHHHHHcCCCCCcccCccccccCChHHHHHHHHhh
Q psy12021         51 GMFPCEV--CGKKYKYKWGLSRHKRDECGQEPKYQCPQCPYRASQKATLKTHMAIK  104 (106)
Q Consensus        51 ~~~~C~~--C~~~f~~~~~l~~h~~~h~~~~~~~~C~~C~k~f~~~~~l~~H~~~h  104 (106)
                      ..|.|..  |-..|.....+..|-.+-++    -.|.+|.+.|.+..-|..|+.--
T Consensus        78 ~~~~cqvagc~~~~d~lD~~E~hY~~~h~----~sCs~C~r~~Pt~hLLd~HI~E~  129 (253)
T KOG4173|consen   78 PAFACQVAGCCQVFDALDDYEHHYHTLHG----NSCSFCKRAFPTGHLLDAHILEW  129 (253)
T ss_pred             ccccccccchHHHHhhhhhHHHhhhhccc----chhHHHHHhCCchhhhhHHHHHH
Confidence            3477876  66777776666655433333    47999999999999999887643


No 131
>PF10013 DUF2256:  Uncharacterized protein conserved in bacteria (DUF2256);  InterPro: IPR017136 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function.
Probab=52.42  E-value=10  Score=17.53  Aligned_cols=13  Identities=23%  Similarity=0.557  Sum_probs=7.7

Q ss_pred             ccCccccccCChH
Q psy12021         83 QCPQCPYRASQKA   95 (106)
Q Consensus        83 ~C~~C~k~f~~~~   95 (106)
                      .|..||+.|+.+.
T Consensus        10 ~C~~C~rpf~WRK   22 (42)
T PF10013_consen   10 ICPVCGRPFTWRK   22 (42)
T ss_pred             cCcccCCcchHHH
Confidence            4666666665544


No 132
>PRK00564 hypA hydrogenase nickel incorporation protein; Provisional
Probab=51.83  E-value=6.2  Score=22.46  Aligned_cols=28  Identities=18%  Similarity=0.380  Sum_probs=17.7

Q ss_pred             CceecccccccccCHHHHHHHHHHHcCCCCCcccCccccc
Q psy12021         51 GMFPCEVCGKKYKYKWGLSRHKRDECGQEPKYQCPQCPYR   90 (106)
Q Consensus        51 ~~~~C~~C~~~f~~~~~l~~h~~~h~~~~~~~~C~~C~k~   90 (106)
                      -.+.|..||..|....            ..-+.|+.||..
T Consensus        70 ~~~~C~~Cg~~~~~~~------------~~~~~CP~Cgs~   97 (117)
T PRK00564         70 VELECKDCSHVFKPNA------------LDYGVCEKCHSK   97 (117)
T ss_pred             CEEEhhhCCCccccCC------------ccCCcCcCCCCC
Confidence            3478999997774321            121349999853


No 133
>PF10263 SprT-like:  SprT-like family;  InterPro: IPR006640 This is a family of uncharacterised bacterial proteins which includes Escherichia coli SprT (P39902 from SWISSPROT). SprT is described as a regulator of bolA gene in stationary phase []. The majority of members contain the metallopeptidase zinc binding signature which has a HExxH motif, however there is no evidence for them being metallopeptidases. 
Probab=49.64  E-value=4.8  Score=23.71  Aligned_cols=32  Identities=34%  Similarity=0.953  Sum_probs=21.2

Q ss_pred             ceecccccccccCHHHHHHHHHHHcCCCCCcccCccccccC
Q psy12021         52 MFPCEVCGKKYKYKWGLSRHKRDECGQEPKYQCPQCPYRAS   92 (106)
Q Consensus        52 ~~~C~~C~~~f~~~~~l~~h~~~h~~~~~~~~C~~C~k~f~   92 (106)
                      .|.|..|+..+.      .+.++  .... |.|..|+..|.
T Consensus       123 ~~~C~~C~~~~~------r~~~~--~~~~-~~C~~C~~~l~  154 (157)
T PF10263_consen  123 VYRCPSCGREYK------RHRRS--KRKR-YRCGRCGGPLV  154 (157)
T ss_pred             EEEcCCCCCEee------eeccc--chhh-EECCCCCCEEE
Confidence            488999997763      33333  2244 89999987654


No 134
>COG3677 Transposase and inactivated derivatives [DNA replication, recombination, and repair]
Probab=49.20  E-value=9.1  Score=22.24  Aligned_cols=16  Identities=19%  Similarity=0.607  Sum_probs=12.3

Q ss_pred             CCCCcccCccccccCCh
Q psy12021         78 QEPKYQCPQCPYRASQK   94 (106)
Q Consensus        78 ~~~~~~C~~C~k~f~~~   94 (106)
                      ..+ |.|+.|++.|...
T Consensus        51 ~qR-yrC~~C~~tf~~~   66 (129)
T COG3677          51 HQR-YKCKSCGSTFTVE   66 (129)
T ss_pred             ccc-cccCCcCcceeee
Confidence            355 9999999988643


No 135
>KOG2231|consensus
Probab=49.19  E-value=21  Score=26.69  Aligned_cols=11  Identities=36%  Similarity=0.332  Sum_probs=7.7

Q ss_pred             CHHHHHHHHHH
Q psy12021         64 YKWGLSRHKRD   74 (106)
Q Consensus        64 ~~~~l~~h~~~   74 (106)
                      ....|+.|++.
T Consensus       126 s~~~Lk~H~~~  136 (669)
T KOG2231|consen  126 SVENLKNHMRD  136 (669)
T ss_pred             HHHHHHHHHHH
Confidence            66777888753


No 136
>KOG2636|consensus
Probab=49.12  E-value=14  Score=26.26  Aligned_cols=29  Identities=17%  Similarity=0.382  Sum_probs=21.5

Q ss_pred             HHHcCCCCCcccCccc-cccCChHHHHHHHH
Q psy12021         73 RDECGQEPKYQCPQCP-YRASQKATLKTHMA  102 (106)
Q Consensus        73 ~~h~~~~~~~~C~~C~-k~f~~~~~l~~H~~  102 (106)
                      +.|-.+.. |.|.+|| .++.=+..+++|-.
T Consensus       394 KLHGL~~e-y~CEICGNy~Y~GrkaF~RHF~  423 (497)
T KOG2636|consen  394 KLHGLDIE-YNCEICGNYVYKGRKAFDRHFN  423 (497)
T ss_pred             hhcCCCcc-cceeeccCccccCcHHHHHHhH
Confidence            34555565 9999999 77887888888743


No 137
>KOG1280|consensus
Probab=48.97  E-value=21  Score=24.48  Aligned_cols=42  Identities=21%  Similarity=0.468  Sum_probs=29.6

Q ss_pred             cCCCceecccccccccCHHHHHHHHHHHcCC-CCCcccCcccc
Q psy12021         48 YNSGMFPCEVCGKKYKYKWGLSRHKRDECGQ-EPKYQCPQCPY   89 (106)
Q Consensus        48 ~~~~~~~C~~C~~~f~~~~~l~~h~~~h~~~-~~~~~C~~C~k   89 (106)
                      .....|.|..|++.-.+...|..|....+-+ ..-..|+.|+.
T Consensus        75 y~~qSftCPyC~~~Gfte~~f~~Hv~s~Hpda~~~~icp~c~~  117 (381)
T KOG1280|consen   75 YDPQSFTCPYCGIMGFTERQFGTHVLSQHPEASTSVICPLCAA  117 (381)
T ss_pred             cccccccCCcccccccchhHHHHHhhhcCcccCcceeeecccc
Confidence            3445799999999877888899997754432 22256777763


No 138
>smart00064 FYVE Protein present in Fab1, YOTB, Vac1, and EEA1. The FYVE zinc finger is named after four proteins where it was first found: Fab1, YOTB/ZK632.12, Vac1, and EEA1. The FYVE finger has been shown to bind two Zn2+ ions. The FYVE finger has eight potential zinc coordinating cysteine positions. The FYVE finger is structurally related to the PF14311 DUF4379:  Domain of unknown function (DUF4379)
Probab=47.87  E-value=16  Score=17.52  Aligned_cols=14  Identities=29%  Similarity=0.828  Sum_probs=10.7

Q ss_pred             eecccccccccCHH
Q psy12021         53 FPCEVCGKKYKYKW   66 (106)
Q Consensus        53 ~~C~~C~~~f~~~~   66 (106)
                      |.|..||..|...-
T Consensus        29 W~C~~Cgh~w~~~v   42 (55)
T PF14311_consen   29 WKCPKCGHEWKASV   42 (55)
T ss_pred             EECCCCCCeeEccH
Confidence            88999988776543


No 140
>KOG1842|consensus
Probab=47.64  E-value=13  Score=26.32  Aligned_cols=28  Identities=21%  Similarity=0.206  Sum_probs=24.0

Q ss_pred             CceecccccccccCHHHHHHHHHHHcCC
Q psy12021         51 GMFPCEVCGKKYKYKWGLSRHKRDECGQ   78 (106)
Q Consensus        51 ~~~~C~~C~~~f~~~~~l~~h~~~h~~~   78 (106)
                      +-|.|++|.+.|.+-+.|..|...-+++
T Consensus        14 egflCPiC~~dl~~~~~L~~H~d~eH~~   41 (505)
T KOG1842|consen   14 EGFLCPICLLDLPNLSALNDHLDVEHFE   41 (505)
T ss_pred             hcccCchHhhhhhhHHHHHHHHhhhccc
Confidence            4489999999999999999998876553


No 141
>KOG2071|consensus
Probab=47.37  E-value=13  Score=27.13  Aligned_cols=24  Identities=29%  Similarity=0.530  Sum_probs=20.5

Q ss_pred             CcccCccccccCChHHHHHHHHhh
Q psy12021         81 KYQCPQCPYRASQKATLKTHMAIK  104 (106)
Q Consensus        81 ~~~C~~C~k~f~~~~~l~~H~~~h  104 (106)
                      |-+|..||..|........|+.+|
T Consensus       418 pnqC~~CG~R~~~~ee~sk~md~H  441 (579)
T KOG2071|consen  418 PNQCKSCGLRFDDSEERSKHMDIH  441 (579)
T ss_pred             cchhcccccccccchhhhhHhhhh
Confidence            478999999999988888887776


No 142
>PRK10220 hypothetical protein; Provisional
Probab=46.37  E-value=11  Score=21.28  Aligned_cols=13  Identities=31%  Similarity=0.884  Sum_probs=8.4

Q ss_pred             cccCccccccCCh
Q psy12021         82 YQCPQCPYRASQK   94 (106)
Q Consensus        82 ~~C~~C~k~f~~~   94 (106)
                      |.|++|+.-|...
T Consensus        21 ~vCpeC~hEW~~~   33 (111)
T PRK10220         21 YICPECAHEWNDA   33 (111)
T ss_pred             EECCcccCcCCcc
Confidence            7777777665443


No 143
>KOG2482|consensus
Probab=45.53  E-value=14  Score=25.38  Aligned_cols=52  Identities=27%  Similarity=0.390  Sum_probs=36.4

Q ss_pred             ceecccccccc-cCHHHHHHHHHH-Hc---C------------------CCCCcccCccccccCChHHHHHHHHhh
Q psy12021         52 MFPCEVCGKKY-KYKWGLSRHKRD-EC---G------------------QEPKYQCPQCPYRASQKATLKTHMAIK  104 (106)
Q Consensus        52 ~~~C~~C~~~f-~~~~~l~~h~~~-h~---~------------------~~~~~~C~~C~k~f~~~~~l~~H~~~h  104 (106)
                      .-.|-.|...+ ..++....|+-. |.   |                  -.+ +.|-.|.+.|..+..|..||+..
T Consensus       144 slqClFCn~e~lgnRs~~l~Hlf~~H~lniGlpDniVyvnelLehLkekL~r-~~CLyCekifrdkntLkeHMrkK  218 (423)
T KOG2482|consen  144 SLQCLFCNNEGLGNRSEILEHLFHVHGLNIGLPDNIVYVNELLEHLKEKLER-LRCLYCEKIFRDKNTLKEHMRKK  218 (423)
T ss_pred             eeEEEEecchhcccHHHHHHHHHHHhhhccCCCcceeeHHHHHHHHHHHHhh-heeeeeccccCCcHHHHHHHHhc
Confidence            35788888654 445555566543 32   1                  124 78999999999999999999853


No 144
>PLN02294 cytochrome c oxidase subunit Vb
Probab=45.12  E-value=11  Score=23.01  Aligned_cols=15  Identities=27%  Similarity=0.775  Sum_probs=11.1

Q ss_pred             CCceecccccccccC
Q psy12021         50 SGMFPCEVCGKKYKY   64 (106)
Q Consensus        50 ~~~~~C~~C~~~f~~   64 (106)
                      .+++.|.+||..|..
T Consensus       139 Gkp~RCpeCG~~fkL  153 (174)
T PLN02294        139 GKSFECPVCTQYFEL  153 (174)
T ss_pred             CCceeCCCCCCEEEE
Confidence            467788888887754


No 145
>PF04780 DUF629:  Protein of unknown function (DUF629);  InterPro: IPR006865 This domain represents a region of several plant proteins of unknown function. A C2H2 zinc finger is predicted in this region in some family members, but the spacing between the cysteine residues is not conserved throughout the family.
Probab=44.99  E-value=19  Score=25.71  Aligned_cols=21  Identities=29%  Similarity=0.721  Sum_probs=12.8

Q ss_pred             cccCccccccCChHHHHHHHH
Q psy12021         82 YQCPQCPYRASQKATLKTHMA  102 (106)
Q Consensus        82 ~~C~~C~k~f~~~~~l~~H~~  102 (106)
                      +.|+.|.+.|.....+..|+.
T Consensus        58 WiCp~CskkF~d~~~~~~H~~   78 (466)
T PF04780_consen   58 WICPRCSKKFSDAESCLSHME   78 (466)
T ss_pred             eeCCcccceeCCHHHHHHHHH
Confidence            456666666666666666654


No 146
>cd00924 Cyt_c_Oxidase_Vb Cytochrome c oxidase subunit Vb.  Cytochrome c oxidase (CcO), the terminal oxidase in the respiratory chains of eukaryotes and most bacteria, is a multi-chain transmembrane protein located in the inner membrane of mitochondria and the cell membrane of prokaryotes.  It catalyzes the reduction of O2 and simultaneously pumps protons across the membrane.  The number of subunits varies from three to five in bacteria and up to 13 in mammalian mitochondria. Subunits I, II, and III of mammalian CcO are encoded within the mitochondrial genome and the remaining 10 subunits are encoded within the nuclear genome.  Found only in eukaryotes, subunit Vb is one of three mammalian subunits that lacks a transmembrane region.  Subunit Vb is located on the matrix side of the membrane and binds the regulatory subunit of protein kinase A.  The abnormally extended conformation is stable only in the CcO assembly.
Probab=44.70  E-value=9.8  Score=21.02  Aligned_cols=20  Identities=30%  Similarity=0.522  Sum_probs=14.2

Q ss_pred             HHHHcCCCCCcccCccccccCC
Q psy12021         72 KRDECGQEPKYQCPQCPYRASQ   93 (106)
Q Consensus        72 ~~~h~~~~~~~~C~~C~k~f~~   93 (106)
                      +..+.| ++ +.|++||..|.-
T Consensus        72 ~~l~~g-~~-~rC~eCG~~fkL   91 (97)
T cd00924          72 MWLEKG-KP-KRCPECGHVFKL   91 (97)
T ss_pred             EEEeCC-Cc-eeCCCCCcEEEE
Confidence            344555 54 999999988854


No 147
>KOG4124|consensus
Probab=44.05  E-value=11  Score=25.97  Aligned_cols=26  Identities=38%  Similarity=0.664  Sum_probs=18.3

Q ss_pred             eccCCCceecccccccccCHHHHHHH
Q psy12021         46 RQYNSGMFPCEVCGKKYKYKWGLSRH   71 (106)
Q Consensus        46 ~~~~~~~~~C~~C~~~f~~~~~l~~h   71 (106)
                      .-...++|.|++|.+.++....|..|
T Consensus       392 ~~~~nk~~r~~i~~~~~k~~~~l~~~  417 (442)
T KOG4124|consen  392 FVVENKPYRCEVCSKRYKNLNGLKYH  417 (442)
T ss_pred             eeeccCcccChhhhhhhccCCCCCce
Confidence            33457888999988887776655544


No 148
>KOG2071|consensus
Probab=43.98  E-value=17  Score=26.63  Aligned_cols=28  Identities=18%  Similarity=0.294  Sum_probs=23.2

Q ss_pred             CCCceecccccccccCHHHHHHHHHHHc
Q psy12021         49 NSGMFPCEVCGKKYKYKWGLSRHKRDEC   76 (106)
Q Consensus        49 ~~~~~~C~~C~~~f~~~~~l~~h~~~h~   76 (106)
                      ...+-.|..||..|........||..|.
T Consensus       415 ~~~pnqC~~CG~R~~~~ee~sk~md~H~  442 (579)
T KOG2071|consen  415 KDSPNQCKSCGLRFDDSEERSKHMDIHD  442 (579)
T ss_pred             cCCcchhcccccccccchhhhhHhhhhh
Confidence            3556789999999999988888888774


No 149
>PRK04351 hypothetical protein; Provisional
Probab=42.57  E-value=7.8  Score=23.11  Aligned_cols=33  Identities=24%  Similarity=0.734  Sum_probs=21.8

Q ss_pred             ceecccccccccCHHHHHHHHHHHcCCCCCcccCccccccCC
Q psy12021         52 MFPCEVCGKKYKYKWGLSRHKRDECGQEPKYQCPQCPYRASQ   93 (106)
Q Consensus        52 ~~~C~~C~~~f~~~~~l~~h~~~h~~~~~~~~C~~C~k~f~~   93 (106)
                      .|.|..||..+..      + +.+. ..+ |.|..|+..+..
T Consensus       112 ~Y~C~~Cg~~~~r------~-Rr~n-~~~-yrCg~C~g~L~~  144 (149)
T PRK04351        112 LYECQSCGQQYLR------K-RRIN-TKR-YRCGKCRGKLKL  144 (149)
T ss_pred             EEECCCCCCEeee------e-eecC-CCc-EEeCCCCcEeee
Confidence            3889889977643      2 2222 256 999999876543


No 150
>KOG2231|consensus
Probab=42.44  E-value=27  Score=26.20  Aligned_cols=22  Identities=27%  Similarity=0.498  Sum_probs=12.5

Q ss_pred             ecccccccccCHHHHHHHHHHH
Q psy12021         54 PCEVCGKKYKYKWGLSRHKRDE   75 (106)
Q Consensus        54 ~C~~C~~~f~~~~~l~~h~~~h   75 (106)
                      .|..|...|.....|..|++.+
T Consensus       184 ~C~~C~~~fld~~el~rH~~~~  205 (669)
T KOG2231|consen  184 LCKFCHERFLDDDELYRHLRFD  205 (669)
T ss_pred             cchhhhhhhccHHHHHHhhccc
Confidence            4555666666666666555543


No 151
>PF07295 DUF1451:  Protein of unknown function (DUF1451);  InterPro: IPR009912 This family consists of several hypothetical bacterial proteins of around 160 residues in length. Members of this family contain four highly conserved cysteine resides toward the C-terminal region of the protein. The function of this family is unknown.
Probab=42.41  E-value=9.9  Score=22.63  Aligned_cols=35  Identities=23%  Similarity=0.561  Sum_probs=21.9

Q ss_pred             cCCCceecccccccccCHHHHHHHHHHHcCCCCCcccCccccc-cCC
Q psy12021         48 YNSGMFPCEVCGKKYKYKWGLSRHKRDECGQEPKYQCPQCPYR-ASQ   93 (106)
Q Consensus        48 ~~~~~~~C~~C~~~f~~~~~l~~h~~~h~~~~~~~~C~~C~k~-f~~   93 (106)
                      .|...|.|..||.....         .+.+ .- -.|+.||.. |.+
T Consensus       108 ~g~G~l~C~~Cg~~~~~---------~~~~-~l-~~Cp~C~~~~F~R  143 (146)
T PF07295_consen  108 VGPGTLVCENCGHEVEL---------THPE-RL-PPCPKCGHTEFTR  143 (146)
T ss_pred             ecCceEecccCCCEEEe---------cCCC-cC-CCCCCCCCCeeee
Confidence            34566999999965321         2333 33 589999864 443


No 152
>PF07282 OrfB_Zn_ribbon:  Putative transposase DNA-binding domain;  InterPro: IPR010095 This entry represents a region of a sequence similarity between a family of putative transposases of Thermoanaerobacter tengcongensis, smaller related proteins from Bacillus anthracis, putative transposes described by IPR001959 from INTERPRO, and other proteins. More information about these proteins can be found at Protein of the Month: Transposase [].
Probab=42.03  E-value=23  Score=17.74  Aligned_cols=31  Identities=23%  Similarity=0.709  Sum_probs=17.5

Q ss_pred             eecccccccccCHHHHHHHHHHHcCCCCCcccCccccccCCh
Q psy12021         53 FPCEVCGKKYKYKWGLSRHKRDECGQEPKYQCPQCPYRASQK   94 (106)
Q Consensus        53 ~~C~~C~~~f~~~~~l~~h~~~h~~~~~~~~C~~C~k~f~~~   94 (106)
                      -.|..||..-..          ...... |.|+.||..+.+.
T Consensus        29 q~C~~CG~~~~~----------~~~~r~-~~C~~Cg~~~~rD   59 (69)
T PF07282_consen   29 QTCPRCGHRNKK----------RRSGRV-FTCPNCGFEMDRD   59 (69)
T ss_pred             cCccCccccccc----------ccccce-EEcCCCCCEECcH
Confidence            357777755432          112233 8888888765543


No 153
>KOG0717|consensus
Probab=41.18  E-value=17  Score=26.01  Aligned_cols=22  Identities=23%  Similarity=0.353  Sum_probs=16.6

Q ss_pred             cccCccccccCChHHHHHHHHh
Q psy12021         82 YQCPQCPYRASQKATLKTHMAI  103 (106)
Q Consensus        82 ~~C~~C~k~f~~~~~l~~H~~~  103 (106)
                      +-|..|.|.|.+...|..|...
T Consensus       293 lyC~vCnKsFKseKq~kNHEnS  314 (508)
T KOG0717|consen  293 LYCVVCNKSFKSEKQLKNHENS  314 (508)
T ss_pred             eEEeeccccccchHHHHhhHHH
Confidence            6688888888888888777653


No 154
>COG1773 Rubredoxin [Energy production and conversion]
Probab=40.78  E-value=13  Score=18.25  Aligned_cols=13  Identities=38%  Similarity=0.912  Sum_probs=10.6

Q ss_pred             ceecccccccccC
Q psy12021         52 MFPCEVCGKKYKY   64 (106)
Q Consensus        52 ~~~C~~C~~~f~~   64 (106)
                      .|.|..||-.|.-
T Consensus         3 ~~~C~~CG~vYd~   15 (55)
T COG1773           3 RWRCSVCGYVYDP   15 (55)
T ss_pred             ceEecCCceEecc
Confidence            5899999988854


No 155
>PF02176 zf-TRAF:  TRAF-type zinc finger; PDB: 2EOD_A 2YUC_A 3HCU_A 3HCS_B 3HCT_A.
Probab=40.68  E-value=8.3  Score=18.66  Aligned_cols=42  Identities=29%  Similarity=0.697  Sum_probs=22.3

Q ss_pred             Cceeccc--ccccccCHHHHHHHHHHHcCCCCCcccCc----cccccCCh
Q psy12021         51 GMFPCEV--CGKKYKYKWGLSRHKRDECGQEPKYQCPQ----CPYRASQK   94 (106)
Q Consensus        51 ~~~~C~~--C~~~f~~~~~l~~h~~~h~~~~~~~~C~~----C~k~f~~~   94 (106)
                      .+..|+.  |...+. +..|..|....=...+ ..|+.    |+..+...
T Consensus         8 ~~v~C~~~cc~~~i~-r~~l~~H~~~~C~~~~-v~C~~~~~GC~~~~~~~   55 (60)
T PF02176_consen    8 RPVPCPNGCCNEMIP-RKELDDHLENECPKRP-VPCPYSPYGCKERVPRE   55 (60)
T ss_dssp             SEEE-TT--S-BEEE-CCCHHHHHHTTSTTSE-EE-SS----S--EEEHH
T ss_pred             CEeeCCCCCccccee-HHHHHHHHHccCCCCc-EECCCCCCCCCCccchh
Confidence            3457876  545444 4567888774433343 78888    88776554


No 156
>COG4338 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=40.45  E-value=11  Score=17.95  Aligned_cols=14  Identities=29%  Similarity=0.570  Sum_probs=8.7

Q ss_pred             ccCccccccCChHH
Q psy12021         83 QCPQCPYRASQKAT   96 (106)
Q Consensus        83 ~C~~C~k~f~~~~~   96 (106)
                      .|+.|++-|+.+..
T Consensus        14 ICpvCqRPFsWRkK   27 (54)
T COG4338          14 ICPVCQRPFSWRKK   27 (54)
T ss_pred             hhhhhcCchHHHHH
Confidence            56777776665543


No 157
>COG3091 SprT Zn-dependent metalloprotease, SprT family [General function prediction only]
Probab=40.30  E-value=13  Score=22.29  Aligned_cols=35  Identities=29%  Similarity=0.676  Sum_probs=23.5

Q ss_pred             CCceecccccccccCHHHHHHHHHHHcCCCCCcccCccccc
Q psy12021         50 SGMFPCEVCGKKYKYKWGLSRHKRDECGQEPKYQCPQCPYR   90 (106)
Q Consensus        50 ~~~~~C~~C~~~f~~~~~l~~h~~~h~~~~~~~~C~~C~k~   90 (106)
                      .-+|.|. |+..|.+.   ++|-.+-.| +. |.|..|+..
T Consensus       115 ~~~Y~C~-C~q~~l~~---RRhn~~~~g-~~-YrC~~C~gk  149 (156)
T COG3091         115 TYPYRCQ-CQQHYLRI---RRHNTVRRG-EV-YRCGKCGGK  149 (156)
T ss_pred             ceeEEee-cCCccchh---hhccccccc-ce-EEeccCCce
Confidence            4469998 99887543   344444445 45 999999854


No 158
>PRK03681 hypA hydrogenase nickel incorporation protein; Validated
Probab=39.70  E-value=18  Score=20.50  Aligned_cols=27  Identities=30%  Similarity=0.528  Sum_probs=17.2

Q ss_pred             CceecccccccccCHHHHHHHHHHHcCCCCCcccCcccc
Q psy12021         51 GMFPCEVCGKKYKYKWGLSRHKRDECGQEPKYQCPQCPY   89 (106)
Q Consensus        51 ~~~~C~~C~~~f~~~~~l~~h~~~h~~~~~~~~C~~C~k   89 (106)
                      ..+.|..||..|...           .... +.||.||.
T Consensus        69 ~~~~C~~Cg~~~~~~-----------~~~~-~~CP~Cgs   95 (114)
T PRK03681         69 AECWCETCQQYVTLL-----------TQRV-RRCPQCHG   95 (114)
T ss_pred             cEEEcccCCCeeecC-----------CccC-CcCcCcCC
Confidence            347899999766321           1112 67999984


No 159
>PF04810 zf-Sec23_Sec24:  Sec23/Sec24 zinc finger;  InterPro: IPR006895 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  COPII (coat protein complex II)-coated vesicles carry proteins from the endoplasmic reticulum (ER) to the Golgi complex []. COPII-coated vesicles form on the ER by the stepwise recruitment of three cytosolic components: Sar1-GTP to initiate coat formation, Sec23/24 heterodimer to select SNARE and cargo molecules, and Sec13/31 to induce coat polymerisation and membrane deformation [].  Sec23 p and Sec24p are structurally related, folding into five distinct domains: a beta-barrel, a zinc-finger, an alpha/beta trunk domain (IPR006896 from INTERPRO), an all-helical region (IPR006900 from INTERPRO), and a C-terminal gelsolin-like domain (IPR007123 from INTERPRO). This entry describes an approximately 55-residue Sec23/24 zinc-binding domain, which lies against the beta-barrel at the periphery of the complex. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0006886 intracellular protein transport, 0006888 ER to Golgi vesicle-mediated transport, 0030127 COPII vesicle coat; PDB: 3EFO_B 3EG9_B 3EGD_A 2YRC_A 2NUP_A 2YRD_A 3EGX_A 2NUT_A 3EH1_A 1PD0_A ....
Probab=38.41  E-value=28  Score=15.60  Aligned_cols=12  Identities=25%  Similarity=0.855  Sum_probs=5.2

Q ss_pred             CCCceecccccc
Q psy12021         49 NSGMFPCEVCGK   60 (106)
Q Consensus        49 ~~~~~~C~~C~~   60 (106)
                      +.+.|.|..|+.
T Consensus        21 ~~~~w~C~~C~~   32 (40)
T PF04810_consen   21 GGKTWICNFCGT   32 (40)
T ss_dssp             TTTEEEETTT--
T ss_pred             CCCEEECcCCCC
Confidence            334455555554


No 160
>PF10537 WAC_Acf1_DNA_bd:  ATP-utilising chromatin assembly and remodelling N-terminal;  InterPro: IPR013136 ACF (for ATP-utilising chromatin assembly and remodeling factor) is a chromatin-remodeling complex that catalyzes the ATP-dependent assembly of periodic nucleosome arrays. This reaction utilises the energy of ATP hydrolysis by ISWI, the smaller of the two subunits of ACF. Acf1, the large subunit of ACF, is essential for the full activity of the complex. The WAC (WSTF/Acf1/cbp146) domain is an ~110-residue module present at the N-termini of Acf1-related proteins in a variety of organisms. It is found in association with other domains such as the bromodomain, the PHD-type zinc finger, DDT or WAKS. The DNA-binding region of Acf1 includes the WAC domain, which is necessary for the efficient binding of ACF complex to DNA. It seems probable that the WAC domain will be involved in DNA binding in other related factors [, ].   Some proteins known to contain a WAC domain are the Drosophila melanogaster (Fruit fly) ATP-dependent chromatin assembly factor large subunit Acf1, human WSTF (Williams syndrome transcription factor), mouse cbp146, yeast imitation switch two complex protein 1 (ITC1 or YGL133w), and yeast protein YPL216w. 
Probab=38.38  E-value=60  Score=18.09  Aligned_cols=38  Identities=8%  Similarity=0.016  Sum_probs=22.9

Q ss_pred             CceecccccccccCHHHHHHHHHHHcCCCCCcccCccccc
Q psy12021         51 GMFPCEVCGKKYKYKWGLSRHKRDECGQEPKYQCPQCPYR   90 (106)
Q Consensus        51 ~~~~C~~C~~~f~~~~~l~~h~~~h~~~~~~~~C~~C~k~   90 (106)
                      +.|.|..-|..|.+-......+..... .. +.|...|+.
T Consensus         2 eVf~i~~T~EiF~dYe~Y~~R~~~y~~-~v-wtC~~TGk~   39 (102)
T PF10537_consen    2 EVFYIPFTGEIFRDYEEYLKRMILYNQ-RV-WTCEITGKS   39 (102)
T ss_pred             ceEEeCCCCcccCCHHHHHHHHHHHhC-Ce-eEEecCCCC
Confidence            346677777777776655555444432 33 777777763


No 161
>PF11931 DUF3449:  Domain of unknown function (DUF3449);  InterPro: IPR024598 This presumed domain is functionally uncharacterised. It has two conserved sequence motifs: PIP and CEICG and contains a zinc-finger of the C2H2-type.; PDB: 4DGW_A.
Probab=37.93  E-value=11  Score=23.68  Aligned_cols=27  Identities=26%  Similarity=0.596  Sum_probs=0.0

Q ss_pred             ccCCCceeccccccc-ccCHHHHHHHHH
Q psy12021         47 QYNSGMFPCEVCGKK-YKYKWGLSRHKR   73 (106)
Q Consensus        47 ~~~~~~~~C~~C~~~-f~~~~~l~~h~~   73 (106)
                      |.-...|.|++||.. |.-+..+..|-.
T Consensus        96 hGL~~ey~CEICGN~~Y~GrkaFekHF~  123 (196)
T PF11931_consen   96 HGLGVEYKCEICGNQSYKGRKAFEKHFQ  123 (196)
T ss_dssp             ----------------------------
T ss_pred             hCCCCeeeeEeCCCcceecHHHHHHhcC
Confidence            334566899999853 555666666644


No 162
>PTZ00448 hypothetical protein; Provisional
Probab=36.79  E-value=29  Score=24.07  Aligned_cols=23  Identities=22%  Similarity=0.457  Sum_probs=19.9

Q ss_pred             ceecccccccccCHHHHHHHHHH
Q psy12021         52 MFPCEVCGKKYKYKWGLSRHKRD   74 (106)
Q Consensus        52 ~~~C~~C~~~f~~~~~l~~h~~~   74 (106)
                      .|.|..|+-.|.+....+.|.++
T Consensus       314 ~~tC~~C~v~F~~~~~qR~H~KS  336 (373)
T PTZ00448        314 MLLCRKCNIQLMDHNAFKQHYRS  336 (373)
T ss_pred             CccccccccccCCHHHHHHHhhh
Confidence            58899999999888888888875


No 163
>PF01286 XPA_N:  XPA protein N-terminal;  InterPro: IPR022652 Xeroderma pigmentosum (XP) [] is a human autosomal recessive disease, characterised by a high incidence of sunlight-induced skin cancer. Skin cells of individual's with this condition are hypersensitive to ultraviolet light, due to defects in the incision step of DNA excision repair. There are a minimum of seven genetic complementation groups involved in this pathway: XP-A to XP-G. XP-A is the most severe form of the disease and is due to defects in a 30 kDa nuclear protein called XPA (or XPAC) []. The sequence of the XPA protein is conserved from higher eukaryotes [] to yeast (gene RAD14) []. XPA is a hydrophilic protein of 247 to 296 amino-acid residues which has a C4-type zinc finger motif in its central section. This entry contains the zinc-finger containing region in the XPA protein. It is found N-terminal to PF05181 from PFAM ; PDB: 1D4U_A 1XPA_A.
Probab=36.52  E-value=14  Score=16.27  Aligned_cols=12  Identities=17%  Similarity=0.418  Sum_probs=4.9

Q ss_pred             cccCccccccCC
Q psy12021         82 YQCPQCPYRASQ   93 (106)
Q Consensus        82 ~~C~~C~k~f~~   93 (106)
                      -.|.+|++.|..
T Consensus         4 ~~C~eC~~~f~d   15 (34)
T PF01286_consen    4 PKCDECGKPFMD   15 (34)
T ss_dssp             EE-TTT--EES-
T ss_pred             chHhHhCCHHHH
Confidence            356777776643


No 164
>PRK00762 hypA hydrogenase nickel incorporation protein; Provisional
Probab=36.48  E-value=13  Score=21.43  Aligned_cols=32  Identities=19%  Similarity=0.337  Sum_probs=18.4

Q ss_pred             CceecccccccccCHHHHHHHHHHHcCCCCCcccCcccc
Q psy12021         51 GMFPCEVCGKKYKYKWGLSRHKRDECGQEPKYQCPQCPY   89 (106)
Q Consensus        51 ~~~~C~~C~~~f~~~~~l~~h~~~h~~~~~~~~C~~C~k   89 (106)
                      -.+.| .||..|.....-..    +.  .+.+.||.||.
T Consensus        69 ~~~~C-~Cg~~~~~~~~~~~----~~--~~~~~CP~Cgs  100 (124)
T PRK00762         69 VEIEC-ECGYEGVVDEDEID----HY--AAVIECPVCGN  100 (124)
T ss_pred             eeEEe-eCcCcccccccchh----cc--ccCCcCcCCCC
Confidence            34789 99988754321000    10  12268999984


No 165
>PF10276 zf-CHCC:  Zinc-finger domain;  InterPro: IPR019401 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.   This entry represents a short conserved zinc-finger domain. It contains the sequence motif Cx8Hx14Cx2C. ; PDB: 2JVM_A 2JRR_A 2JZ8_A.
Probab=36.32  E-value=12  Score=17.10  Aligned_cols=9  Identities=33%  Similarity=1.077  Sum_probs=4.3

Q ss_pred             eeccccccc
Q psy12021         53 FPCEVCGKK   61 (106)
Q Consensus        53 ~~C~~C~~~   61 (106)
                      -.|..|+..
T Consensus        30 ~~CpYCg~~   38 (40)
T PF10276_consen   30 VVCPYCGTR   38 (40)
T ss_dssp             EEETTTTEE
T ss_pred             EECCCCCCE
Confidence            445555543


No 166
>PF09845 DUF2072:  Zn-ribbon containing protein (DUF2072);  InterPro: IPR018645  This archaeal Zinc-ribbon containing proteins have no known function. 
Probab=36.16  E-value=17  Score=21.23  Aligned_cols=15  Identities=20%  Similarity=0.560  Sum_probs=12.0

Q ss_pred             ceecccccccccCHH
Q psy12021         52 MFPCEVCGKKYKYKW   66 (106)
Q Consensus        52 ~~~C~~C~~~f~~~~   66 (106)
                      |..|..||+.|...+
T Consensus         1 PH~Ct~Cg~~f~dgs   15 (131)
T PF09845_consen    1 PHQCTKCGRVFEDGS   15 (131)
T ss_pred             CcccCcCCCCcCCCc
Confidence            468999999997654


No 167
>PF14353 CpXC:  CpXC protein
Probab=36.13  E-value=16  Score=20.90  Aligned_cols=19  Identities=21%  Similarity=0.509  Sum_probs=11.6

Q ss_pred             cCCCCCcccCccccccCCh
Q psy12021         76 CGQEPKYQCPQCPYRASQK   94 (106)
Q Consensus        76 ~~~~~~~~C~~C~k~f~~~   94 (106)
                      .|.--.+.|+.||..|.-.
T Consensus        33 ~g~l~~~~CP~Cg~~~~~~   51 (128)
T PF14353_consen   33 DGSLFSFTCPSCGHKFRLE   51 (128)
T ss_pred             cCCcCEEECCCCCCceecC
Confidence            3433337888888876543


No 168
>PF13824 zf-Mss51:  Zinc-finger of mitochondrial splicing suppressor 51
Probab=35.82  E-value=30  Score=17.04  Aligned_cols=9  Identities=44%  Similarity=1.051  Sum_probs=4.8

Q ss_pred             ceecccccc
Q psy12021         52 MFPCEVCGK   60 (106)
Q Consensus        52 ~~~C~~C~~   60 (106)
                      .|+|+.||-
T Consensus        14 ~~~Cp~cGi   22 (55)
T PF13824_consen   14 NFECPDCGI   22 (55)
T ss_pred             CCcCCCCCC
Confidence            355555554


No 169
>smart00731 SprT SprT homologues. Predicted to have roles in transcription elongation. Contains a conserved HExxH motif, indicating a metalloprotease function.
Probab=35.57  E-value=14  Score=21.66  Aligned_cols=33  Identities=27%  Similarity=0.746  Sum_probs=20.3

Q ss_pred             ceecccccccccCHHHHHHHHHHHcCCCCCcccCccccccC
Q psy12021         52 MFPCEVCGKKYKYKWGLSRHKRDECGQEPKYQCPQCPYRAS   92 (106)
Q Consensus        52 ~~~C~~C~~~f~~~~~l~~h~~~h~~~~~~~~C~~C~k~f~   92 (106)
                      .|.|..|+..+.      ++.+.. .... |.|..|+..|.
T Consensus       112 ~y~C~~C~~~~~------~~rr~~-~~~~-y~C~~C~g~l~  144 (146)
T smart00731      112 PYRCTGCGQRYL------RVRRSN-NVSR-YRCGKCGGKLI  144 (146)
T ss_pred             EEECCCCCCCCc------eEcccc-Ccce-EEcCCCCCEEE
Confidence            588988887763      222222 1145 88988886553


No 170
>COG5188 PRP9 Splicing factor 3a, subunit 3 [RNA processing and modification]
Probab=35.51  E-value=28  Score=24.11  Aligned_cols=28  Identities=29%  Similarity=0.400  Sum_probs=19.8

Q ss_pred             eccCCCceeccccc-ccccCHHHHHHHHH
Q psy12021         46 RQYNSGMFPCEVCG-KKYKYKWGLSRHKR   73 (106)
Q Consensus        46 ~~~~~~~~~C~~C~-~~f~~~~~l~~h~~   73 (106)
                      .|.-.+.|+|++|| .++.-...+.+|-.
T Consensus       368 lhgLd~ef~CEICgNyvy~GR~~FdrHF~  396 (470)
T COG5188         368 LHGLDIEFECEICGNYVYYGRDRFDRHFE  396 (470)
T ss_pred             hcCCCcceeeeecccccccchHHHHhhhh
Confidence            34456679999999 66766777777644


No 171
>COG4640 Predicted membrane protein [Function unknown]
Probab=35.48  E-value=27  Score=24.50  Aligned_cols=17  Identities=24%  Similarity=0.685  Sum_probs=9.7

Q ss_pred             eecccccccccCHHHHH
Q psy12021         53 FPCEVCGKKYKYKWGLS   69 (106)
Q Consensus        53 ~~C~~C~~~f~~~~~l~   69 (106)
                      +.|..||..|.......
T Consensus        16 ~qC~qCG~~~t~~~sqa   32 (465)
T COG4640          16 VQCTQCGHKFTSRQSQA   32 (465)
T ss_pred             ccccccCCcCCchhhhh
Confidence            34666666666555443


No 172
>PLN03238 probable histone acetyltransferase MYST; Provisional
Probab=35.39  E-value=34  Score=22.91  Aligned_cols=21  Identities=33%  Similarity=0.608  Sum_probs=15.0

Q ss_pred             cccCccccccCChHHHHHHHH
Q psy12021         82 YQCPQCPYRASQKATLKTHMA  102 (106)
Q Consensus        82 ~~C~~C~k~f~~~~~l~~H~~  102 (106)
                      |.|+.|-+-|.....|.+|+.
T Consensus        49 yiCe~Clky~~~~~~l~~H~~   69 (290)
T PLN03238         49 YICEYCLKYMRKKKSLLRHLA   69 (290)
T ss_pred             EEcCCCcchhCCHHHHHHHHH
Confidence            777777777777777777755


No 173
>PF12760 Zn_Tnp_IS1595:  Transposase zinc-ribbon domain;  InterPro: IPR024442 This zinc binding domain is found in a range of transposase proteins such as ISSPO8, ISSOD11, ISRSSP2 etc. It may be a zinc-binding beta ribbon domain that could bind DNA.
Probab=35.00  E-value=7.3  Score=18.08  Aligned_cols=8  Identities=38%  Similarity=1.186  Sum_probs=6.0

Q ss_pred             cccCcccc
Q psy12021         82 YQCPQCPY   89 (106)
Q Consensus        82 ~~C~~C~k   89 (106)
                      |.|..|++
T Consensus        38 ~~C~~C~~   45 (46)
T PF12760_consen   38 YRCKACRK   45 (46)
T ss_pred             EECCCCCC
Confidence            88888764


No 174
>PF11789 zf-Nse:  Zinc-finger of the MIZ type in Nse subunit; PDB: 2YU4_A 3HTK_C.
Probab=34.81  E-value=32  Score=16.87  Aligned_cols=33  Identities=15%  Similarity=0.242  Sum_probs=16.5

Q ss_pred             CCCceecccccccccCHHHHHHHHHHHcCCCCCcccCc
Q psy12021         49 NSGMFPCEVCGKKYKYKWGLSRHKRDECGQEPKYQCPQ   86 (106)
Q Consensus        49 ~~~~~~C~~C~~~f~~~~~l~~h~~~h~~~~~~~~C~~   86 (106)
                      -..|.....|+-.|.....+. ++   ..... .+|+.
T Consensus        21 ~~~PV~s~~C~H~fek~aI~~-~i---~~~~~-~~CPv   53 (57)
T PF11789_consen   21 FEDPVKSKKCGHTFEKEAILQ-YI---QRNGS-KRCPV   53 (57)
T ss_dssp             -SSEEEESSS--EEEHHHHHH-HC---TTTS--EE-SC
T ss_pred             hhCCcCcCCCCCeecHHHHHH-HH---HhcCC-CCCCC
Confidence            345677778888887555443 32   12233 78887


No 175
>COG1656 Uncharacterized conserved protein [Function unknown]
Probab=34.63  E-value=28  Score=21.25  Aligned_cols=19  Identities=21%  Similarity=0.553  Sum_probs=15.7

Q ss_pred             cccCccccccCChHHHHHH
Q psy12021         82 YQCPQCPYRASQKATLKTH  100 (106)
Q Consensus        82 ~~C~~C~k~f~~~~~l~~H  100 (106)
                      +.|+.||+.|..-+++.+-
T Consensus       131 ~~C~~CgkiYW~GsHw~~m  149 (165)
T COG1656         131 YRCPKCGKIYWKGSHWRRM  149 (165)
T ss_pred             eECCCCcccccCchHHHHH
Confidence            7799999999888877643


No 176
>PF04780 DUF629:  Protein of unknown function (DUF629);  InterPro: IPR006865 This domain represents a region of several plant proteins of unknown function. A C2H2 zinc finger is predicted in this region in some family members, but the spacing between the cysteine residues is not conserved throughout the family.
Probab=34.30  E-value=40  Score=24.19  Aligned_cols=30  Identities=17%  Similarity=0.270  Sum_probs=24.4

Q ss_pred             cCCCceecccccccccCHHHHHHHHH-HHcC
Q psy12021         48 YNSGMFPCEVCGKKYKYKWGLSRHKR-DECG   77 (106)
Q Consensus        48 ~~~~~~~C~~C~~~f~~~~~l~~h~~-~h~~   77 (106)
                      ...+-|.|..|.+.|.....+..|+. .|.+
T Consensus        53 ~sWrFWiCp~CskkF~d~~~~~~H~~~eH~~   83 (466)
T PF04780_consen   53 KSWRFWICPRCSKKFSDAESCLSHMEQEHPA   83 (466)
T ss_pred             CceeEeeCCcccceeCCHHHHHHHHHHhhhh
Confidence            34556889999999999999999988 4544


No 177
>PF03811 Zn_Tnp_IS1:  InsA N-terminal domain;  InterPro: IPR003220 Insertion elements are mobile elements in DNA, usually encoding proteins required for transposition, for example transposases. Protein InsA is absolutely required for transposition of insertion element 1. This entry represents a short zinc binding domain found in IS1 InsA family protein. It is found at the N terminus of the protein and may be a DNA-binding domain.; GO: 0006313 transposition, DNA-mediated
Probab=34.07  E-value=5.7  Score=17.65  Aligned_cols=13  Identities=31%  Similarity=1.058  Sum_probs=7.3

Q ss_pred             HHcCCCCCcccCcc
Q psy12021         74 DECGQEPKYQCPQC   87 (106)
Q Consensus        74 ~h~~~~~~~~C~~C   87 (106)
                      ...|..+ |.|..|
T Consensus        23 ~~~G~qr-yrC~~C   35 (36)
T PF03811_consen   23 SPSGHQR-YRCKDC   35 (36)
T ss_pred             CCCCCEe-EecCcC
Confidence            3344455 777766


No 178
>PHA02998 RNA polymerase subunit; Provisional
Probab=34.06  E-value=9.3  Score=23.60  Aligned_cols=38  Identities=24%  Similarity=0.468  Sum_probs=21.7

Q ss_pred             eecccccccccCHHHHHHHHHHHcCCCCC---cccCccccccCCh
Q psy12021         53 FPCEVCGKKYKYKWGLSRHKRDECGQEPK---YQCPQCPYRASQK   94 (106)
Q Consensus        53 ~~C~~C~~~f~~~~~l~~h~~~h~~~~~~---~~C~~C~k~f~~~   94 (106)
                      -.|+.|+..=....  +.+.|  ..++|+   |.|..||+.|...
T Consensus       144 v~CPkCg~~~A~f~--qlQTR--SADEPmT~FYkC~~CG~~wkpp  184 (195)
T PHA02998        144 TPCPNCKSKNTTPM--MIQTR--AADEPPLVRHACRDCKKHFKPP  184 (195)
T ss_pred             CCCCCCCCCceEEE--EEeec--cCCCCceEEEEcCCCCCccCCc
Confidence            57888884322111  22222  334443   7999999988654


No 179
>PF06397 Desulfoferrod_N:  Desulfoferrodoxin, N-terminal domain;  InterPro: IPR004462 This domain is found as essentially the full length of desulforedoxin, a 37-residue homodimeric non-haem iron protein. It is also found as the N-terminal domain of desulfoferrodoxin (rbo), a homodimeric non-haem iron protein with 2 Fe atoms per monomer in different oxidation states. This domain binds the ferric rather than the ferrous Fe of desulfoferrodoxin. Neelaredoxin, a monomeric blue non-haem iron protein, lacks this domain.; GO: 0005506 iron ion binding; PDB: 1DFX_A 1VZI_B 2JI2_D 1VZH_B 2JI3_C 2JI1_C 1VZG_A 1CFW_A 2LK5_B 1DHG_B ....
Probab=33.96  E-value=18  Score=16.10  Aligned_cols=12  Identities=33%  Similarity=0.946  Sum_probs=6.6

Q ss_pred             Cceecccccccc
Q psy12021         51 GMFPCEVCGKKY   62 (106)
Q Consensus        51 ~~~~C~~C~~~f   62 (106)
                      +-|.|+.||...
T Consensus         5 ~~YkC~~CGniV   16 (36)
T PF06397_consen    5 EFYKCEHCGNIV   16 (36)
T ss_dssp             EEEE-TTT--EE
T ss_pred             cEEEccCCCCEE
Confidence            358999998764


No 180
>PLN02748 tRNA dimethylallyltransferase
Probab=33.05  E-value=34  Score=24.52  Aligned_cols=26  Identities=23%  Similarity=0.460  Sum_probs=20.3

Q ss_pred             CCCceecccccc-cccCHHHHHHHHHH
Q psy12021         49 NSGMFPCEVCGK-KYKYKWGLSRHKRD   74 (106)
Q Consensus        49 ~~~~~~C~~C~~-~f~~~~~l~~h~~~   74 (106)
                      ..+.|.|+.|++ ++........|++.
T Consensus       415 ~~~~~~Ce~C~~~~~~G~~eW~~Hlks  441 (468)
T PLN02748        415 LWTQYVCEACGNKVLRGAHEWEQHKQG  441 (468)
T ss_pred             ccccccccCCCCcccCCHHHHHHHhcc
Confidence            356789999997 78888878877764


No 181
>PF04423 Rad50_zn_hook:  Rad50 zinc hook motif;  InterPro: IPR007517 The Mre11 complex (Mre11 Rad50 Nbs1) is central to chromosomal maintenance and functions in homologous recombination, telomere maintenance and sister chromatid association. The Rad50 coiled-coil region contains a dimer interface at the apex of the coiled coils in which pairs of conserved Cys-X-X-Cys motifs form interlocking hooks that bind one Zn ion. This alignment includes the zinc hook motif and a short stretch of coiled-coil on either side.; GO: 0004518 nuclease activity, 0005524 ATP binding, 0008270 zinc ion binding, 0006281 DNA repair; PDB: 1L8D_B.
Probab=32.93  E-value=16  Score=17.47  Aligned_cols=13  Identities=23%  Similarity=0.608  Sum_probs=6.8

Q ss_pred             ccCccccccCChH
Q psy12021         83 QCPQCPYRASQKA   95 (106)
Q Consensus        83 ~C~~C~k~f~~~~   95 (106)
                      .||.|+..|....
T Consensus        22 ~CPlC~r~l~~e~   34 (54)
T PF04423_consen   22 CCPLCGRPLDEEH   34 (54)
T ss_dssp             E-TTT--EE-HHH
T ss_pred             cCCCCCCCCCHHH
Confidence            8999998886543


No 182
>KOG0717|consensus
Probab=32.80  E-value=32  Score=24.68  Aligned_cols=22  Identities=32%  Similarity=0.646  Sum_probs=19.5

Q ss_pred             eecccccccccCHHHHHHHHHH
Q psy12021         53 FPCEVCGKKYKYKWGLSRHKRD   74 (106)
Q Consensus        53 ~~C~~C~~~f~~~~~l~~h~~~   74 (106)
                      +-|..|.+.|.+...+..|..+
T Consensus       293 lyC~vCnKsFKseKq~kNHEnS  314 (508)
T KOG0717|consen  293 LYCVVCNKSFKSEKQLKNHENS  314 (508)
T ss_pred             eEEeeccccccchHHHHhhHHH
Confidence            7799999999999999888764


No 183
>COG4888 Uncharacterized Zn ribbon-containing protein [General function prediction only]
Probab=32.67  E-value=8  Score=21.49  Aligned_cols=39  Identities=15%  Similarity=0.331  Sum_probs=22.5

Q ss_pred             CCCceecccccccccCHHHHHHHHHHHcCCCCCcccCccccccC
Q psy12021         49 NSGMFPCEVCGKKYKYKWGLSRHKRDECGQEPKYQCPQCPYRAS   92 (106)
Q Consensus        49 ~~~~~~C~~C~~~f~~~~~l~~h~~~h~~~~~~~~C~~C~k~f~   92 (106)
                      -.+.|.|..||..-...-.+.    ....... ..|..||..|-
T Consensus        19 L~k~FtCp~Cghe~vs~ctvk----k~~~~g~-~~Cg~CGls~e   57 (104)
T COG4888          19 LPKTFTCPRCGHEKVSSCTVK----KTVNIGT-AVCGNCGLSFE   57 (104)
T ss_pred             CCceEecCccCCeeeeEEEEE----ecCceeE-EEcccCcceEE
Confidence            456799999986644332221    1111123 67888887763


No 184
>COG4896 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=32.44  E-value=27  Score=17.59  Aligned_cols=9  Identities=22%  Similarity=0.833  Sum_probs=4.8

Q ss_pred             ceecccccc
Q psy12021         52 MFPCEVCGK   60 (106)
Q Consensus        52 ~~~C~~C~~   60 (106)
                      .|.|++|.-
T Consensus        31 tymC~eC~~   39 (68)
T COG4896          31 TYMCPECEH   39 (68)
T ss_pred             eEechhhHh
Confidence            355655543


No 185
>PRK00432 30S ribosomal protein S27ae; Validated
Probab=32.30  E-value=20  Score=17.16  Aligned_cols=12  Identities=25%  Similarity=0.999  Sum_probs=8.7

Q ss_pred             CCCcccCcccccc
Q psy12021         79 EPKYQCPQCPYRA   91 (106)
Q Consensus        79 ~~~~~C~~C~k~f   91 (106)
                      .. +.|..||..+
T Consensus        36 ~r-~~C~~Cgyt~   47 (50)
T PRK00432         36 DR-WHCGKCGYTE   47 (50)
T ss_pred             Cc-EECCCcCCEE
Confidence            45 8888888654


No 186
>KOG3014|consensus
Probab=31.84  E-value=28  Score=22.78  Aligned_cols=10  Identities=50%  Similarity=1.265  Sum_probs=5.4

Q ss_pred             eccccccccc
Q psy12021         54 PCEVCGKKYK   63 (106)
Q Consensus        54 ~C~~C~~~f~   63 (106)
                      .|.+||..|+
T Consensus        39 ~C~~Cgm~Yt   48 (257)
T KOG3014|consen   39 KCKECGMKYT   48 (257)
T ss_pred             ehhhcCceec
Confidence            4566665543


No 187
>PF00301 Rubredoxin:  Rubredoxin;  InterPro: IPR004039 Rubredoxin is a low molecular weight iron-containing bacterial protein involved in electron transfer [, ], sometimes replacing ferredoxin as an electron carrier []. The 3-D structures of a number of rubredoxins have been solved [, ]. The fold belongs to the alpha+beta class, with 2 alpha-helices and 2-3 beta-strands. Its active site contains an iron ion which is co-ordinated by the sulphurs of four conserved cysteine residues forming an almost regular tetrahedron. The conserved cysteines reside on two loops, which are the most conserved regions of the protein. In addition, a ring of acidic residues in the proximity of the [Fe(Cys)4] centre is also well-conserved []. ; GO: 0009055 electron carrier activity, 0046872 metal ion binding; PDB: 2RDV_C 1RDV_A 1S24_A 1T9O_B 1B2J_A 1SMW_A 2PVE_B 1BFY_A 1T9P_C 1C09_C ....
Probab=31.80  E-value=21  Score=16.88  Aligned_cols=36  Identities=25%  Similarity=0.529  Sum_probs=18.0

Q ss_pred             eecccccccccCHHHHHHHHHHH------cCCCCCcccCccccc
Q psy12021         53 FPCEVCGKKYKYKWGLSRHKRDE------CGQEPKYQCPQCPYR   90 (106)
Q Consensus        53 ~~C~~C~~~f~~~~~l~~h~~~h------~~~~~~~~C~~C~k~   90 (106)
                      |.|..||..|.-...-..+ .+.      ....- |.|+.|+..
T Consensus         2 y~C~~CgyvYd~~~Gd~~~-~i~pGt~F~~Lp~~-w~CP~C~a~   43 (47)
T PF00301_consen    2 YQCPVCGYVYDPEKGDPEN-GIPPGTPFEDLPDD-WVCPVCGAP   43 (47)
T ss_dssp             EEETTTSBEEETTTBBGGG-TB-TT--GGGS-TT--B-TTTSSB
T ss_pred             cCCCCCCEEEcCCcCCccc-CcCCCCCHHHCCCC-CcCcCCCCc
Confidence            7899999877543321110 111      11244 899999853


No 188
>TIGR00622 ssl1 transcription factor ssl1. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=31.43  E-value=30  Score=19.68  Aligned_cols=48  Identities=13%  Similarity=0.161  Sum_probs=31.6

Q ss_pred             ecccccccccCHHHHHHHHHHHcCCCCCcccCccccccCChHHHHHHHHhh
Q psy12021         54 PCEVCGKKYKYKWGLSRHKRDECGQEPKYQCPQCPYRASQKATLKTHMAIK  104 (106)
Q Consensus        54 ~C~~C~~~f~~~~~l~~h~~~h~~~~~~~~C~~C~k~f~~~~~l~~H~~~h  104 (106)
                      .|.-|.+.|........  ..-....+ |.|+.|...|-..-....|..+|
T Consensus        57 ~C~~C~~~f~~~~~~~~--~~~~~~~~-y~C~~C~~~FC~dCD~fiHe~Lh  104 (112)
T TIGR00622        57 FCFGCQGPFPKPPVSPF--DELKDSHR-YVCAVCKNVFCVDCDVFVHESLH  104 (112)
T ss_pred             cccCcCCCCCCcccccc--cccccccc-eeCCCCCCccccccchhhhhhcc
Confidence            48888888865432111  11123245 99999999998888777777665


No 189
>PF08209 Sgf11:  Sgf11 (transcriptional regulation protein);  InterPro: IPR013246 The Sgf11 family is a SAGA complex subunit in Saccharomyces cerevisiae (Baker's yeast). The SAGA complex is a multisubunit protein complex involved in transcriptional regulation. SAGA combines proteins involved in interactions with DNA-bound activators and TATA-binding protein (TBP), as well as enzymes for histone acetylation and deubiquitylation [].; PDB: 3M99_B 2LO2_A 3MHH_C 3MHS_C.
Probab=31.09  E-value=39  Score=14.68  Aligned_cols=22  Identities=18%  Similarity=0.443  Sum_probs=13.4

Q ss_pred             ceecccccccccCHHHHHHHHHH
Q psy12021         52 MFPCEVCGKKYKYKWGLSRHKRD   74 (106)
Q Consensus        52 ~~~C~~C~~~f~~~~~l~~h~~~   74 (106)
                      .+.|+.|++... ...+..|+..
T Consensus         4 ~~~C~nC~R~v~-a~RfA~HLek   25 (33)
T PF08209_consen    4 YVECPNCGRPVA-ASRFAPHLEK   25 (33)
T ss_dssp             EEE-TTTSSEEE-GGGHHHHHHH
T ss_pred             eEECCCCcCCcc-hhhhHHHHHH
Confidence            478888887664 3456666553


No 190
>cd00730 rubredoxin Rubredoxin; nonheme iron binding domains containing a [Fe(SCys)4] center. Rubredoxins are small nonheme iron proteins. The iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), but iron can also be replaced by cobalt, nickel or zinc. They are believed to be involved in electron transfer.
Probab=29.27  E-value=24  Score=16.91  Aligned_cols=35  Identities=23%  Similarity=0.523  Sum_probs=19.5

Q ss_pred             eecccccccccCHHHHHHHHHHHc------CCCCCcccCcccc
Q psy12021         53 FPCEVCGKKYKYKWGLSRHKRDEC------GQEPKYQCPQCPY   89 (106)
Q Consensus        53 ~~C~~C~~~f~~~~~l~~h~~~h~------~~~~~~~C~~C~k   89 (106)
                      |.|..||..|.-...-.. ..+-.      .... |.|+.|+.
T Consensus         2 y~C~~CgyiYd~~~Gd~~-~~i~pGt~f~~Lp~~-w~CP~C~a   42 (50)
T cd00730           2 YECRICGYIYDPAEGDPD-EGIPPGTPFEDLPDD-WVCPVCGA   42 (50)
T ss_pred             cCCCCCCeEECCCCCCcc-cCcCCCCCHhHCCCC-CCCCCCCC
Confidence            789999988864321110 01111      1233 89999984


No 191
>COG3357 Predicted transcriptional regulator containing an HTH domain fused to a Zn-ribbon [Transcription]
Probab=28.62  E-value=27  Score=19.10  Aligned_cols=13  Identities=15%  Similarity=0.639  Sum_probs=10.9

Q ss_pred             CcccCccccccCC
Q psy12021         81 KYQCPQCPYRASQ   93 (106)
Q Consensus        81 ~~~C~~C~k~f~~   93 (106)
                      |..|..||..|..
T Consensus        58 Pa~CkkCGfef~~   70 (97)
T COG3357          58 PARCKKCGFEFRD   70 (97)
T ss_pred             ChhhcccCccccc
Confidence            4899999988876


No 192
>PF02891 zf-MIZ:  MIZ/SP-RING zinc finger;  InterPro: IPR004181 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents MIZ-type zinc finger domains. Miz1 (Msx-interacting-zinc finger) is a zinc finger-containing protein with homology to the yeast protein, Nfi-1. Miz1 is a sequence specific DNA binding protein that can function as a positive-acting transcription factor. Miz1 binds to the homeobox protein Msx2, enhancing the specific DNA-binding ability of Msx2 []. Other proteins containing this domain include the human pias family (protein inhibitor of activated STAT protein). More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 3I2D_A.
Probab=28.58  E-value=28  Score=16.50  Aligned_cols=23  Identities=22%  Similarity=0.579  Sum_probs=9.4

Q ss_pred             ccCHHHHHHHHHHHcCCCCCcccCcccc
Q psy12021         62 YKYKWGLSRHKRDECGQEPKYQCPQCPY   89 (106)
Q Consensus        62 f~~~~~l~~h~~~h~~~~~~~~C~~C~k   89 (106)
                      |.....|....+    ... +.|+.|++
T Consensus        27 FDl~~fl~~~~~----~~~-W~CPiC~~   49 (50)
T PF02891_consen   27 FDLESFLESNQR----TPK-WKCPICNK   49 (50)
T ss_dssp             EEHHHHHHHHHH----S----B-TTT--
T ss_pred             ECHHHHHHHhhc----cCC-eECcCCcC
Confidence            555555544333    133 88998875


No 193
>PRK01343 zinc-binding protein; Provisional
Probab=28.42  E-value=38  Score=16.80  Aligned_cols=12  Identities=25%  Similarity=0.789  Sum_probs=8.3

Q ss_pred             CcccCccccccC
Q psy12021         81 KYQCPQCPYRAS   92 (106)
Q Consensus        81 ~~~C~~C~k~f~   92 (106)
                      ...|+.|++.|.
T Consensus         9 ~~~CP~C~k~~~   20 (57)
T PRK01343          9 TRPCPECGKPST   20 (57)
T ss_pred             CCcCCCCCCcCc
Confidence            367888887654


No 194
>PLN03238 probable histone acetyltransferase MYST; Provisional
Probab=28.24  E-value=78  Score=21.27  Aligned_cols=25  Identities=32%  Similarity=0.518  Sum_probs=22.3

Q ss_pred             CCceecccccccccCHHHHHHHHHH
Q psy12021         50 SGMFPCEVCGKKYKYKWGLSRHKRD   74 (106)
Q Consensus        50 ~~~~~C~~C~~~f~~~~~l~~h~~~   74 (106)
                      ...|.|+.|-+-|.+...+.+|+..
T Consensus        46 ~~lyiCe~Clky~~~~~~l~~H~~~   70 (290)
T PLN03238         46 TKLYICEYCLKYMRKKKSLLRHLAK   70 (290)
T ss_pred             CeEEEcCCCcchhCCHHHHHHHHHh
Confidence            4569999999999999999999874


No 195
>PLN03239 histone acetyltransferase; Provisional
Probab=28.20  E-value=40  Score=23.20  Aligned_cols=22  Identities=23%  Similarity=0.141  Sum_probs=19.5

Q ss_pred             CcccCccccccCChHHHHHHHH
Q psy12021         81 KYQCPQCPYRASQKATLKTHMA  102 (106)
Q Consensus        81 ~~~C~~C~k~f~~~~~l~~H~~  102 (106)
                      .|.|+.|-+-|.+...|.+|+.
T Consensus       106 lYiCE~Clky~~~~~~l~~H~~  127 (351)
T PLN03239        106 LYVCEFSFGFFARKSELLRFQA  127 (351)
T ss_pred             EEEeccchhhhcCHHHHHHHHH
Confidence            4999999999999999998875


No 196
>PF01215 COX5B:  Cytochrome c oxidase subunit Vb This family consists of chains F and S ;  InterPro: IPR002124 Cytochrome c oxidase (1.9.3.1 from EC) is an oligomeric enzymatic complex which is a component of the respiratory chain complex and is involved in the transfer of electrons from cytochrome c to oxygen []. In eukaryotes this enzyme complex is located in the mitochondrial inner membrane; in aerobic prokaryotes it is found in the plasma membrane.  In eukaryotes, in addition to the three large subunits, I, II and III, that form the catalytic centre of the enzyme complex, there are a variable number of small polypeptidic subunits. One of these subunits, which is known as Vb in mammals, V in Dictyostelium discoideum (Slime mold) and IV in yeast, binds a zinc atom. The sequence of subunit Vb is well conserved and includes three conserved cysteines that coordinate the zinc ion [, ]. Two of these cysteines are clustered in the C-terminal section of the subunit.; GO: 0004129 cytochrome-c oxidase activity, 0005740 mitochondrial envelope; PDB: 2EIL_S 2ZXW_S 3ASN_S 1OCO_S 3AG4_S 3ABK_S 1OCZ_S 1OCC_F 3ASO_S 3ABL_S ....
Probab=28.02  E-value=24  Score=20.78  Aligned_cols=16  Identities=31%  Similarity=0.665  Sum_probs=12.8

Q ss_pred             CCceecccccccccCH
Q psy12021         50 SGMFPCEVCGKKYKYK   65 (106)
Q Consensus        50 ~~~~~C~~C~~~f~~~   65 (106)
                      .++..|..||..|+..
T Consensus       110 g~~~RCpeCG~~fkL~  125 (136)
T PF01215_consen  110 GKPQRCPECGQVFKLK  125 (136)
T ss_dssp             TSEEEETTTEEEEEEE
T ss_pred             CCccCCCCCCeEEEEE
Confidence            4589999999988643


No 197
>PF02748 PyrI_C:  Aspartate carbamoyltransferase regulatory chain, metal binding domain;  InterPro: IPR020542 Aspartate carbamoyltransferase (aspartate transcarbamylase, ATCase) 2.1.3.2 from EC is an allosteric enzyme that plays a central role in the regulation of the pyrimidine pathway in bacteria. The holoenzyme is a dodecamer composed of six catalytic chains, each with an active site, and six regulatory chains lacking catalytic activity []. The catalytic subunits exist as a dimer of catalytic trimers, (c3)2, while the regulatory subunits exist as a trimer of regulatory dimers, (r2)3, therefore the complete holoenzyme can be represented as (c3)2(r2)3. The association of the catalytic subunits c3 with the regulatory subunits r2 is responsible for the establishment of positive co-operativity between catalytic sites for the binding of aspartate and it dictates the pattern of allosteric response toward nucleotide effectors. ATCase from Escherichia coli is the most extensively studied allosteric enzyme []. The crystal structure of the T-state, the T-state with CTP bound, the R-state with N-phosphonacetyl-L-aspartate (PALA) bound, and the R-state with phosphonoacetamide plus malonate bound have been used in interpreting kinetic and mutational studies. A high-resolution structure of E. coli ATCase in the presence of PALA (a bisubstrate analog) allows a detailed description of the binding at the active site of the enzyme and allows a detailed model of the tetrahedral intermediate to be constructed. The entire regulatory chain has been traced showing that the N-terminal regions of the regulatory chains R1 and R6 are located in close proximity to each other and to the regulatory site. This portion of the molecule may be involved in the observed asymmetry between the regulatory binding sites as well as in the heterotropic response of the enzyme []. The C-terminal domain of the regulatory chains have a rubredoxin-like zinc-bound fold.  ATCase from Enterobacter agglomerans (Erwinia herbicola) (Pantoea agglomerans) differs from the other investigated enterobacterial ATCases by its absence of homotropic co-operativity toward the substrate aspartate and its lack of response to ATP which is an allosteric effector (activator) of this family of enzymes. Nevertheless, the E. herbicola ATCase has the same quaternary structure, two trimers of catalytic chains with three dimers of regulatory chains, (c3)2(r2)3, as other enterobacterial ATCases and shows extensive primary structure conservation [].  This entry represents the C-terminal domain.; PDB: 2YWW_B 1SKU_D 1Q95_L 8ATC_B 3AT1_D 1RAI_D 4E2F_D 1NBE_B 6AT1_B 2FZC_D ....
Probab=27.83  E-value=37  Score=16.37  Aligned_cols=18  Identities=11%  Similarity=0.255  Sum_probs=11.5

Q ss_pred             cCCCceecccccccccCH
Q psy12021         48 YNSGMFPCEVCGKKYKYK   65 (106)
Q Consensus        48 ~~~~~~~C~~C~~~f~~~   65 (106)
                      .....|.|..|++.+...
T Consensus        31 ~~~~~~rC~YCe~~~~~~   48 (52)
T PF02748_consen   31 KEPIKLRCHYCERIITED   48 (52)
T ss_dssp             TTTCEEEETTT--EEEHH
T ss_pred             CCCCEEEeeCCCCEeccc
Confidence            345569999999887644


No 198
>KOG0978|consensus
Probab=27.79  E-value=20  Score=26.94  Aligned_cols=19  Identities=21%  Similarity=0.574  Sum_probs=15.4

Q ss_pred             cccCccccccCChHHHHHH
Q psy12021         82 YQCPQCPYRASQKATLKTH  100 (106)
Q Consensus        82 ~~C~~C~k~f~~~~~l~~H  100 (106)
                      -+||.|+.+|...+.+..|
T Consensus       679 RKCP~Cn~aFganDv~~I~  697 (698)
T KOG0978|consen  679 RKCPKCNAAFGANDVHRIH  697 (698)
T ss_pred             CCCCCCCCCCCcccccccC
Confidence            5899999999988766544


No 199
>COG1326 Uncharacterized archaeal Zn-finger protein [General function prediction only]
Probab=27.56  E-value=53  Score=20.69  Aligned_cols=33  Identities=27%  Similarity=0.578  Sum_probs=18.4

Q ss_pred             eecccccccccCHHHHHHHHHHHc-CCCCCcccCcccccc
Q psy12021         53 FPCEVCGKKYKYKWGLSRHKRDEC-GQEPKYQCPQCPYRA   91 (106)
Q Consensus        53 ~~C~~C~~~f~~~~~l~~h~~~h~-~~~~~~~C~~C~k~f   91 (106)
                      +.|+.|+..    ..  .|.-+-. |..+.+.|..||..+
T Consensus         7 ~~Cp~Cg~e----ev--~hEVik~~g~~~lvrC~eCG~V~   40 (201)
T COG1326           7 IECPSCGSE----EV--SHEVIKERGREPLVRCEECGTVH   40 (201)
T ss_pred             EECCCCCcc----hh--hHHHHHhcCCceEEEccCCCcEe
Confidence            678888811    11  1222222 334458899998765


No 200
>PLN00104 MYST -like histone acetyltransferase; Provisional
Probab=27.54  E-value=40  Score=24.08  Aligned_cols=22  Identities=32%  Similarity=0.526  Sum_probs=19.7

Q ss_pred             CcccCccccccCChHHHHHHHH
Q psy12021         81 KYQCPQCPYRASQKATLKTHMA  102 (106)
Q Consensus        81 ~~~C~~C~k~f~~~~~l~~H~~  102 (106)
                      .|.|+.|-+-|.....|.+|+.
T Consensus       198 lyiCe~Cl~y~~~~~~~~~H~~  219 (450)
T PLN00104        198 LYFCEFCLKFMKRKEQLQRHMK  219 (450)
T ss_pred             EEEchhhhhhhcCHHHHHHHHh
Confidence            4899999999999999999976


No 201
>TIGR00627 tfb4 transcription factor tfb4. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=27.19  E-value=52  Score=21.89  Aligned_cols=24  Identities=25%  Similarity=0.427  Sum_probs=15.4

Q ss_pred             eecccccccccCHHHHHHHHHHHcCCCCCcccCcccccc
Q psy12021         53 FPCEVCGKKYKYKWGLSRHKRDECGQEPKYQCPQCPYRA   91 (106)
Q Consensus        53 ~~C~~C~~~f~~~~~l~~h~~~h~~~~~~~~C~~C~k~f   91 (106)
                      |.|+.|.-.|-.              . |-.|+.||-.|
T Consensus       256 yvCs~Clsi~C~--------------~-p~~C~~Cgt~f  279 (279)
T TIGR00627       256 FVCSVCLSVLCQ--------------Y-TPICKTCKTAF  279 (279)
T ss_pred             EECCCccCCcCC--------------C-CCCCCCCCCCC
Confidence            777777655531              2 35788887655


No 202
>PF14787 zf-CCHC_5:  GAG-polyprotein viral zinc-finger; PDB: 1CL4_A 1DSV_A.
Probab=27.14  E-value=30  Score=15.43  Aligned_cols=13  Identities=23%  Similarity=0.547  Sum_probs=6.9

Q ss_pred             ccCccccccCChH
Q psy12021         83 QCPQCPYRASQKA   95 (106)
Q Consensus        83 ~C~~C~k~f~~~~   95 (106)
                      .|+-|++.|-+.+
T Consensus         4 ~CprC~kg~Hwa~   16 (36)
T PF14787_consen    4 LCPRCGKGFHWAS   16 (36)
T ss_dssp             C-TTTSSSCS-TT
T ss_pred             cCcccCCCcchhh
Confidence            4666777765544


No 203
>KOG2807|consensus
Probab=27.03  E-value=94  Score=21.40  Aligned_cols=54  Identities=15%  Similarity=0.264  Sum_probs=33.5

Q ss_pred             CceecccccccccCHHHHHHHHHHH----------cC----------------CCCCcccCccccccCChHHHHHHHHhh
Q psy12021         51 GMFPCEVCGKKYKYKWGLSRHKRDE----------CG----------------QEPKYQCPQCPYRASQKATLKTHMAIK  104 (106)
Q Consensus        51 ~~~~C~~C~~~f~~~~~l~~h~~~h----------~~----------------~~~~~~C~~C~k~f~~~~~l~~H~~~h  104 (106)
                      -|-+|+.|+.+......|.+--+.-          .+                ....|.|..|...|-.....-.|...|
T Consensus       289 LP~eCpiC~ltLVss~hLARSyhhL~PL~~F~Eip~~~~~~~~~Cf~C~~~~~~~~~y~C~~Ck~~FCldCDv~iHesLh  368 (378)
T KOG2807|consen  289 LPIECPICSLTLVSSPHLARSYHHLFPLKPFVEIPETEYNGSRFCFACQGELLSSGRYRCESCKNVFCLDCDVFIHESLH  368 (378)
T ss_pred             CCccCCccceeEecchHHHHHHHhhcCCcchhhccccccCCCcceeeeccccCCCCcEEchhccceeeccchHHHHhhhh
Confidence            4567788887777776665432210          00                012277888888888877777776655


No 204
>PF06220 zf-U1:  U1 zinc finger;  InterPro: IPR013085 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  C2H2-type (classical) zinc fingers (Znf) were the first class to be characterised. They contain a short beta hairpin and an alpha helix (beta/beta/alpha structure), where a single zinc atom is held in place by Cys(2)His(2) (C2H2) residues in a tetrahedral array. C2H2 Znf's can be divided into three groups based on the number and pattern of fingers: triple-C2H2 (binds single ligand), multiple-adjacent-C2H2 (binds multiple ligands), and separated paired-C2H2 []. C2H2 Znf's are the most common DNA-binding motifs found in eukaryotic transcription factors, and have also been identified in prokaryotes []. Transcription factors usually contain several Znf's (each with a conserved beta/beta/alpha structure) capable of making multiple contacts along the DNA, where the C2H2 Znf motifs recognise DNA sequences by binding to the major groove of DNA via a short alpha-helix in the Znf, the Znf spanning 3-4 bases of the DNA []. C2H2 Znf's can also bind to RNA and protein targets []. This entry represents a C2H2-type zinc finger motif found in several U1 small nuclear ribonucleoprotein C (U1-C) proteins. Some proteins contain multiple copies of this motif. The U1 small nuclear ribonucleoprotein (U1 snRNP) binds to the pre-mRNA 5' splice site at early stages of spliceosome assembly. Recruitment of U1 to a class of weak 5' splice site is promoted by binding of the protein TIA-1 to uridine-rich sequences immediately downstream from the 5' splice site. Binding of TIA-1 in the vicinity of a 5' splice site helps to stabilise U1 snRNP recruitment, at least in part, via a direct interaction with U1-C, thus providing one molecular mechanism for the function of this splicing regulator []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 2VRD_A.
Probab=26.99  E-value=67  Score=14.28  Aligned_cols=10  Identities=30%  Similarity=0.700  Sum_probs=3.2

Q ss_pred             cccCcccccc
Q psy12021         82 YQCPQCPYRA   91 (106)
Q Consensus        82 ~~C~~C~k~f   91 (106)
                      |=|+.|...|
T Consensus         4 yyCdyC~~~~   13 (38)
T PF06220_consen    4 YYCDYCKKYL   13 (38)
T ss_dssp             -B-TTT--B-
T ss_pred             eeccccccee
Confidence            5566666666


No 205
>KOG2907|consensus
Probab=26.95  E-value=36  Score=19.43  Aligned_cols=39  Identities=31%  Similarity=0.672  Sum_probs=21.7

Q ss_pred             eecccccccccCHHHHHHHHHHH-cCCCCCcccCccccccCC
Q psy12021         53 FPCEVCGKKYKYKWGLSRHKRDE-CGQEPKYQCPQCPYRASQ   93 (106)
Q Consensus        53 ~~C~~C~~~f~~~~~l~~h~~~h-~~~~~~~~C~~C~k~f~~   93 (106)
                      -.|+.||..=-.-..+  .+|+. .|.--=|.|+.|+..|..
T Consensus        75 ~kCpkCghe~m~Y~T~--QlRSADEGQTVFYTC~kC~~k~~e  114 (116)
T KOG2907|consen   75 HKCPKCGHEEMSYHTL--QLRSADEGQTVFYTCPKCKYKFTE  114 (116)
T ss_pred             ccCcccCCchhhhhhh--hcccccCCceEEEEcCccceeeec
Confidence            5789998543222222  23333 232222899999988764


No 206
>COG1675 TFA1 Transcription initiation factor IIE, alpha subunit [Transcription]
Probab=26.43  E-value=66  Score=19.90  Aligned_cols=33  Identities=24%  Similarity=0.688  Sum_probs=20.4

Q ss_pred             cCCCceecccccccccCHHHHHHHHHHHcCCCCCcccCccccc
Q psy12021         48 YNSGMFPCEVCGKKYKYKWGLSRHKRDECGQEPKYQCPQCPYR   90 (106)
Q Consensus        48 ~~~~~~~C~~C~~~f~~~~~l~~h~~~h~~~~~~~~C~~C~k~   90 (106)
                      ....-|.|+.|...|+.....      .   .. |.|+.||..
T Consensus       109 ~~~~~y~C~~~~~r~sfdeA~------~---~~-F~Cp~Cg~~  141 (176)
T COG1675         109 TENNYYVCPNCHVKYSFDEAM------E---LG-FTCPKCGED  141 (176)
T ss_pred             ccCCceeCCCCCCcccHHHHH------H---hC-CCCCCCCch
Confidence            445568897777665433322      2   22 889999864


No 207
>PF08792 A2L_zn_ribbon:  A2L zinc ribbon domain;  InterPro: IPR014900 This zinc ribbon protein is found associated with some viral A2L transcription factors []. 
Probab=26.18  E-value=31  Score=14.92  Aligned_cols=10  Identities=20%  Similarity=0.255  Sum_probs=6.3

Q ss_pred             cccCcccccc
Q psy12021         82 YQCPQCPYRA   91 (106)
Q Consensus        82 ~~C~~C~k~f   91 (106)
                      +.|..||..|
T Consensus        22 ~~C~~Cg~~~   31 (33)
T PF08792_consen   22 EVCIFCGSSF   31 (33)
T ss_pred             EEcccCCcEe
Confidence            5666666655


No 208
>COG0846 SIR2 NAD-dependent protein deacetylases, SIR2 family [Transcription]
Probab=26.14  E-value=43  Score=21.89  Aligned_cols=38  Identities=24%  Similarity=0.359  Sum_probs=22.9

Q ss_pred             ccCCCceecccccccccCHHHHHHHHHHHcCCCCCcccCcccc
Q psy12021         47 QYNSGMFPCEVCGKKYKYKWGLSRHKRDECGQEPKYQCPQCPY   89 (106)
Q Consensus        47 ~~~~~~~~C~~C~~~f~~~~~l~~h~~~h~~~~~~~~C~~C~k   89 (106)
                      |..-..+.|..|+..+........   ...+ .. -.|+.||.
T Consensus       117 HGsl~~~~C~~C~~~~~~~~~~~~---~~~~-~~-p~C~~Cg~  154 (250)
T COG0846         117 HGSLKRVRCSKCGNQYYDEDVIKF---IEDG-LI-PRCPKCGG  154 (250)
T ss_pred             ccceeeeEeCCCcCccchhhhhhh---cccC-CC-CcCccCCC
Confidence            444556889999988764442111   1112 33 68999987


No 209
>TIGR03831 YgiT_finger YgiT-type zinc finger domain. This domain model describes a small domain with two copies of a putative zinc-binding motif CXXC (usually CXXCG). Most member proteins consist largely of this domain or else carry an additional C-terminal helix-turn-helix domain, resembling that of the phage protein Cro and modeled by pfam01381.
Probab=26.05  E-value=29  Score=15.52  Aligned_cols=8  Identities=50%  Similarity=1.161  Sum_probs=3.5

Q ss_pred             ccCccccc
Q psy12021         83 QCPQCPYR   90 (106)
Q Consensus        83 ~C~~C~k~   90 (106)
                      .|+.||..
T Consensus        34 ~C~~CGE~   41 (46)
T TIGR03831        34 VCPQCGEE   41 (46)
T ss_pred             ccccCCCE
Confidence            44444443


No 210
>PTZ00064 histone acetyltransferase; Provisional
Probab=26.01  E-value=48  Score=24.12  Aligned_cols=23  Identities=17%  Similarity=0.158  Sum_probs=20.4

Q ss_pred             CcccCccccccCChHHHHHHHHh
Q psy12021         81 KYQCPQCPYRASQKATLKTHMAI  103 (106)
Q Consensus        81 ~~~C~~C~k~f~~~~~l~~H~~~  103 (106)
                      .|.|+.|-+-|.....|.+|+..
T Consensus       280 LYICEfCLkY~~s~~~l~rH~~~  302 (552)
T PTZ00064        280 LHFCEYCLDFFCFEDELIRHLSR  302 (552)
T ss_pred             EEEccchhhhhCCHHHHHHHHhc
Confidence            38999999999999999999763


No 211
>PF12907 zf-met2:  Zinc-binding
Probab=25.84  E-value=51  Score=15.02  Aligned_cols=6  Identities=33%  Similarity=1.315  Sum_probs=2.7

Q ss_pred             eccccc
Q psy12021         54 PCEVCG   59 (106)
Q Consensus        54 ~C~~C~   59 (106)
                      .|.+|-
T Consensus         3 ~C~iC~    8 (40)
T PF12907_consen    3 ICKICR    8 (40)
T ss_pred             CcHHhh
Confidence            344444


No 212
>KOG2747|consensus
Probab=25.45  E-value=56  Score=22.94  Aligned_cols=24  Identities=33%  Similarity=0.616  Sum_probs=17.7

Q ss_pred             CceecccccccccCHHHHHHHHHH
Q psy12021         51 GMFPCEVCGKKYKYKWGLSRHKRD   74 (106)
Q Consensus        51 ~~~~C~~C~~~f~~~~~l~~h~~~   74 (106)
                      ..|.|+.|-+.+.+...|++|+..
T Consensus       157 ~lYiCEfCLkY~~s~~~l~rH~~k  180 (396)
T KOG2747|consen  157 KLYICEFCLKYMKSRTSLQRHLKK  180 (396)
T ss_pred             eEEEehHHHhHhchHHHHHHHHHh
Confidence            447777777777777777777764


No 213
>COG1571 Predicted DNA-binding protein containing a Zn-ribbon domain [General function prediction only]
Probab=25.43  E-value=49  Score=23.45  Aligned_cols=31  Identities=29%  Similarity=0.716  Sum_probs=20.5

Q ss_pred             eecccccccccCHHHHHHHHHHHcCCCCCcccCccccccCChH
Q psy12021         53 FPCEVCGKKYKYKWGLSRHKRDECGQEPKYQCPQCPYRASQKA   95 (106)
Q Consensus        53 ~~C~~C~~~f~~~~~l~~h~~~h~~~~~~~~C~~C~k~f~~~~   95 (106)
                      -.|+.||....+           .|..- |+|+.||..+....
T Consensus       351 p~Cp~Cg~~m~S-----------~G~~g-~rC~kCg~~~~~~~  381 (421)
T COG1571         351 PVCPRCGGRMKS-----------AGRNG-FRCKKCGTRARETL  381 (421)
T ss_pred             CCCCccCCchhh-----------cCCCC-cccccccccCCccc
Confidence            368888866432           23334 89999998776543


No 214
>COG3364 Zn-ribbon containing protein [General function prediction only]
Probab=25.42  E-value=36  Score=19.10  Aligned_cols=14  Identities=21%  Similarity=0.619  Sum_probs=11.6

Q ss_pred             ceecccccccccCH
Q psy12021         52 MFPCEVCGKKYKYK   65 (106)
Q Consensus        52 ~~~C~~C~~~f~~~   65 (106)
                      |..|..||..|..-
T Consensus         2 pH~CtrCG~vf~~g   15 (112)
T COG3364           2 PHQCTRCGEVFDDG   15 (112)
T ss_pred             Cceecccccccccc
Confidence            56899999999764


No 215
>TIGR00319 desulf_FeS4 desulfoferrodoxin FeS4 iron-binding domain. Neelaredoxin, a monomeric blue non-heme iron protein, lacks this domain.
Probab=25.27  E-value=35  Score=14.56  Aligned_cols=12  Identities=42%  Similarity=1.090  Sum_probs=9.3

Q ss_pred             Cceecccccccc
Q psy12021         51 GMFPCEVCGKKY   62 (106)
Q Consensus        51 ~~~~C~~C~~~f   62 (106)
                      +-|.|+.||...
T Consensus         6 ~~ykC~~Cgniv   17 (34)
T TIGR00319         6 QVYKCEVCGNIV   17 (34)
T ss_pred             cEEEcCCCCcEE
Confidence            458999998765


No 216
>PTZ00043 cytochrome c oxidase subunit; Provisional
Probab=25.26  E-value=35  Score=22.07  Aligned_cols=16  Identities=13%  Similarity=0.555  Sum_probs=13.0

Q ss_pred             CCCceecccccccccC
Q psy12021         49 NSGMFPCEVCGKKYKY   64 (106)
Q Consensus        49 ~~~~~~C~~C~~~f~~   64 (106)
                      ..++..|.+||..|..
T Consensus       178 EGkpqRCpECGqVFKL  193 (268)
T PTZ00043        178 EGFLYRCGECDQIFML  193 (268)
T ss_pred             CCCCccCCCCCcEEEE
Confidence            4567899999999865


No 217
>PF01096 TFIIS_C:  Transcription factor S-II (TFIIS);  InterPro: IPR001222 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents a zinc finger motif found in transcription factor IIs (TFIIS). In eukaryotes the initiation of transcription of protein encoding genes by polymerase II (Pol II) is modulated by general and specific transcription factors. The general transcription factors operate through common promoters elements (such as the TATA box). At least eight different proteins associate to form the general transcription factors: TFIIA, -IIB, -IID, -IIE, -IIF, -IIG, -IIH and -IIS []. During mRNA elongation, Pol II can encounter DNA sequences that cause reverse movement of the enzyme. Such backtracking involves extrusion of the RNA 3'-end into the pore, and can lead to transcriptional arrest. Escape from arrest requires cleavage of the extruded RNA with the help of TFIIS, which induces mRNA cleavage by enhancing the intrinsic nuclease activity of RNA polymerase (Pol) II, past template-encoded pause sites []. TFIIS extends from the polymerase surface via a pore to the internal active site. Two essential and invariant acidic residues in a TFIIS loop complement the Pol II active site and could position a metal ion and a water molecule for hydrolytic RNA cleavage. TFIIS also induces extensive structural changes in Pol II that would realign nucleic acids in the active centre.  TFIIS is a protein of about 300 amino acids. It contains three regions: a variable N-terminal domain not required for TFIIS activity; a conserved central domain required for Pol II binding; and a conserved C-terminal C4-type zinc finger essential for RNA cleavage. The zinc finger folds in a conformation termed a zinc ribbon [] characterised by a three-stranded antiparallel beta-sheet and two beta-hairpins. A backbone model for Pol II-TFIIS complex was obtained from X-ray analysis. It shows that a beta hairpin protrudes from the zinc finger and complements the pol II active site [].  Some viral proteins also contain the TFIIS zinc ribbon C-terminal domain. The Vaccinia virus protein, unlike its eukaryotic homologue, is an integral RNA polymerase subunit rather than a readily separable transcription factor []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003676 nucleic acid binding, 0008270 zinc ion binding, 0006351 transcription, DNA-dependent; PDB: 3M4O_I 3S14_I 2E2J_I 4A3J_I 3HOZ_I 1TWA_I 3S1Q_I 3S1N_I 1TWG_I 3I4M_I ....
Probab=25.12  E-value=30  Score=15.44  Aligned_cols=10  Identities=30%  Similarity=1.168  Sum_probs=8.2

Q ss_pred             eecccccccc
Q psy12021         53 FPCEVCGKKY   62 (106)
Q Consensus        53 ~~C~~C~~~f   62 (106)
                      |.|..|+..|
T Consensus        29 y~C~~C~~~w   38 (39)
T PF01096_consen   29 YVCCNCGHRW   38 (39)
T ss_dssp             EEESSSTEEE
T ss_pred             EEeCCCCCee
Confidence            7898898765


No 218
>smart00440 ZnF_C2C2 C2C2 Zinc finger. Nucleic-acid-binding motif in transcriptional elongation factor TFIIS and RNA polymerases.
Probab=24.99  E-value=33  Score=15.43  Aligned_cols=10  Identities=40%  Similarity=0.939  Sum_probs=4.6

Q ss_pred             cccCcccccc
Q psy12021         82 YQCPQCPYRA   91 (106)
Q Consensus        82 ~~C~~C~k~f   91 (106)
                      |.|..|+..|
T Consensus        29 y~C~~C~~~w   38 (40)
T smart00440       29 YVCTKCGHRW   38 (40)
T ss_pred             EEeCCCCCEe
Confidence            4454454433


No 219
>PRK14138 NAD-dependent deacetylase; Provisional
Probab=24.81  E-value=1e+02  Score=19.95  Aligned_cols=38  Identities=24%  Similarity=0.458  Sum_probs=23.1

Q ss_pred             ccCCCceecccccccccCHHHHHHHHHHHcCCCCCcccCcccc
Q psy12021         47 QYNSGMFPCEVCGKKYKYKWGLSRHKRDECGQEPKYQCPQCPY   89 (106)
Q Consensus        47 ~~~~~~~~C~~C~~~f~~~~~l~~h~~~h~~~~~~~~C~~C~k   89 (106)
                      |..-....|..|++.|.....+.   ..... .. -.|+.|+.
T Consensus       114 HG~~~~~~C~~C~~~~~~~~~~~---~~~~~-~~-p~Cp~Cgg  151 (244)
T PRK14138        114 HGNVEEYYCVRCGKRYTVEDVIE---KLEKS-DV-PRCDDCSG  151 (244)
T ss_pred             cCCcCeeEECCCCCcccHHHHHH---HHhcC-CC-CCCCCCCC
Confidence            44455578999999887654433   11112 23 57999975


No 220
>cd01410 SIRT7 SIRT7: Eukaryotic and prokaryotic group (class4) which includes human sirtuin SIRT6, SIRT7, and several bacterial homologs; and are members of the SIR2 family of proteins, silent information regulator 2 (Sir2) enzymes which catalyze NAD+-dependent protein/histone deacetylation. Sir2 proteins have been shown to regulate gene silencing, DNA repair, metabolic enzymes, and life span.
Probab=24.18  E-value=1.2e+02  Score=19.01  Aligned_cols=40  Identities=18%  Similarity=0.233  Sum_probs=23.1

Q ss_pred             ccCCCceecccccccccCHHHHHHHHHHHcCCCCCcccCccccc
Q psy12021         47 QYNSGMFPCEVCGKKYKYKWGLSRHKRDECGQEPKYQCPQCPYR   90 (106)
Q Consensus        47 ~~~~~~~~C~~C~~~f~~~~~l~~h~~~h~~~~~~~~C~~C~k~   90 (106)
                      |..-....|..|+..+.....+.   ........ ..|+.||..
T Consensus        90 HG~~~~~~C~~C~~~~~~~~~~~---~~~~~~~~-p~C~~Cgg~  129 (206)
T cd01410          90 HGNMFIEVCKSCGPEYVRDDVVE---TRGDKETG-RRCHACGGI  129 (206)
T ss_pred             cCCcCcccCCCCCCccchHHHHH---HhhcCCCC-CcCCCCcCc
Confidence            44455578999998776544332   11122222 579999854


No 221
>cd00974 DSRD Desulforedoxin (DSRD) domain; a small non-heme iron domain present in the desulforedoxin (rubredoxin oxidoreductase) and desulfoferrodoxin proteins of some archeael and bacterial methanogens and sulfate/sulfur reducers. Desulforedoxin is a small, single-domain homodimeric protein; each subunit contains an iron atom bound to four cysteinyl sulfur atoms, Fe(S-Cys)4, in a distorted tetrahedral coordination. Its metal center is similar to that found in rubredoxin type proteins. Desulforedoxin is regarded as a potential redox partner for rubredoxin. Desulfoferrodoxin forms a homodimeric protein, with each protomer comprised of two domains, the N-terminal DSRD domain and C-terminal superoxide reductase-like (SORL) domain. Each domain has a distinct iron center: the DSRD iron center I, Fe(S-Cys)4; and the SORL iron center II, Fe[His4Cys(Glu)].
Probab=24.07  E-value=37  Score=14.47  Aligned_cols=12  Identities=33%  Similarity=1.088  Sum_probs=8.9

Q ss_pred             Cceecccccccc
Q psy12021         51 GMFPCEVCGKKY   62 (106)
Q Consensus        51 ~~~~C~~C~~~f   62 (106)
                      +-|.|+.||...
T Consensus         3 ~~ykC~~CGniv   14 (34)
T cd00974           3 EVYKCEICGNIV   14 (34)
T ss_pred             cEEEcCCCCcEE
Confidence            348898888765


No 222
>KOG3507|consensus
Probab=23.94  E-value=43  Score=16.71  Aligned_cols=31  Identities=26%  Similarity=0.697  Sum_probs=18.8

Q ss_pred             CCCceecccccccccCHHHHHHHHHHHcCCCCCcccCcccccc
Q psy12021         49 NSGMFPCEVCGKKYKYKWGLSRHKRDECGQEPKYQCPQCPYRA   91 (106)
Q Consensus        49 ~~~~~~C~~C~~~f~~~~~l~~h~~~h~~~~~~~~C~~C~k~f   91 (106)
                      ....|.|..|+..-.    |       ..... +.|.+||...
T Consensus        17 ~~miYiCgdC~~en~----l-------k~~D~-irCReCG~RI   47 (62)
T KOG3507|consen   17 ATMIYICGDCGQENT----L-------KRGDV-IRCRECGYRI   47 (62)
T ss_pred             ccEEEEecccccccc----c-------cCCCc-EehhhcchHH
Confidence            344588999974421    1       11244 8999998653


No 223
>PF02591 DUF164:  Putative zinc ribbon domain;  InterPro: IPR003743 This entry describes proteins of unknown function.
Probab=23.46  E-value=96  Score=14.84  Aligned_cols=32  Identities=25%  Similarity=0.431  Sum_probs=19.2

Q ss_pred             ecccccccccCHHHHHHHHHHHcCCCCCcccCccccc
Q psy12021         54 PCEVCGKKYKYKWGLSRHKRDECGQEPKYQCPQCPYR   90 (106)
Q Consensus        54 ~C~~C~~~f~~~~~l~~h~~~h~~~~~~~~C~~C~k~   90 (106)
                      .|.-|+....... +.   .+..+.+. ..|+.||+.
T Consensus        24 ~C~gC~~~l~~~~-~~---~i~~~~~i-~~Cp~CgRi   55 (56)
T PF02591_consen   24 TCSGCHMELPPQE-LN---EIRKGDEI-VFCPNCGRI   55 (56)
T ss_pred             ccCCCCEEcCHHH-HH---HHHcCCCe-EECcCCCcc
Confidence            6888876654332 22   23334455 889999863


No 224
>PF08271 TF_Zn_Ribbon:  TFIIB zinc-binding;  InterPro: IPR013137 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents a zinc finger motif found in transcription factor IIB (TFIIB). In eukaryotes the initiation of transcription of protein encoding genes by the polymerase II complexe (Pol II) is modulated by general and specific transcription factors. The general transcription factors operate through common promoters elements (such as the TATA box). At least seven different proteins associate to form the general transcription factors: TFIIA, -IIB, -IID, -IIE, -IIF, -IIG, and -IIH [].  TFIIB and TFIID are responsible for promoter recognition and interaction with pol II; together with Pol II, they form a minimal initiation complex capable of transcription under certain conditions. The TATA box of a Pol II promoter is bound in the initiation complex by the TBP subunit of TFIID, which bends the DNA around the C-terminal domain of TFIIB whereas the N-terminal zinc finger of TFIIB interacts with Pol II [, ]. The TFIIB zinc finger adopts a zinc ribbon fold characterised by two beta-hairpins forming two structurally similar zinc-binding sub-sites []. The zinc finger contacts the rbp1 subunit of Pol II through its dock domain, a conserved region of about 70 amino acids located close to the polymerase active site []. In the Pol II complex this surface is located near the RNA exit groove. Interestingly this sequence is best conserved in the three polymerases that utilise a TFIIB-like general transcription factor (Pol II, Pol III, and archaeal RNA polymerase) but not in Pol I [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0006355 regulation of transcription, DNA-dependent; PDB: 1VD4_A 1PFT_A 3K1F_M 3K7A_M 1RO4_A 1RLY_A 1DL6_A.
Probab=22.98  E-value=42  Score=15.16  Aligned_cols=9  Identities=33%  Similarity=1.176  Sum_probs=4.8

Q ss_pred             cccCccccc
Q psy12021         82 YQCPQCPYR   90 (106)
Q Consensus        82 ~~C~~C~k~   90 (106)
                      |.|+.||..
T Consensus         1 m~Cp~Cg~~    9 (43)
T PF08271_consen    1 MKCPNCGSK    9 (43)
T ss_dssp             ESBTTTSSS
T ss_pred             CCCcCCcCC
Confidence            356666543


No 225
>PRK08222 hydrogenase 4 subunit H; Validated
Probab=22.98  E-value=65  Score=19.79  Aligned_cols=18  Identities=17%  Similarity=0.427  Sum_probs=14.0

Q ss_pred             CcccCccccccCChHHHH
Q psy12021         81 KYQCPQCPYRASQKATLK   98 (106)
Q Consensus        81 ~~~C~~C~k~f~~~~~l~   98 (106)
                      ...|..||+.|.....+.
T Consensus       114 ~~~C~~Cg~~f~~~k~i~  131 (181)
T PRK08222        114 LQRCSRCERPFAPQKTVA  131 (181)
T ss_pred             cCcCcccCCccCcHhHHH
Confidence            388999999998665543


No 226
>KOG1842|consensus
Probab=22.87  E-value=52  Score=23.57  Aligned_cols=26  Identities=27%  Similarity=0.701  Sum_probs=22.4

Q ss_pred             CCCcccCccccccCChHHHHHHHHhhc
Q psy12021         79 EPKYQCPQCPYRASQKATLKTHMAIKH  105 (106)
Q Consensus        79 ~~~~~C~~C~k~f~~~~~l~~H~~~hh  105 (106)
                      +- |.|+.|.+-|..-..|..|.-.-|
T Consensus        14 eg-flCPiC~~dl~~~~~L~~H~d~eH   39 (505)
T KOG1842|consen   14 EG-FLCPICLLDLPNLSALNDHLDVEH   39 (505)
T ss_pred             hc-ccCchHhhhhhhHHHHHHHHhhhc
Confidence            44 899999999999999999987655


No 227
>cd01413 SIR2_Af2 SIR2_Af2: Archaeal and prokaryotic group which includes Archaeoglobus fulgidus Sir2-Af2, Sulfolobus solfataricus ssSir2, and several bacterial homologs; and are members of the SIR2 family of proteins, silent information regulator 2 (Sir2) enzymes which catalyze NAD+-dependent protein/histone deacetylation. Sir2 proteins have been shown to regulate gene silencing, DNA repair, metabolic enzymes, and life span. The Sir2 homolog from the archaea Sulfolobus solftaricus deacetylates the non-specific DNA protein Alba to mediate transcription repression.
Probab=22.76  E-value=1e+02  Score=19.52  Aligned_cols=39  Identities=23%  Similarity=0.315  Sum_probs=22.8

Q ss_pred             eccCCCceecccccccccCHHHHHHHHHHHcCCCCCcccCccccc
Q psy12021         46 RQYNSGMFPCEVCGKKYKYKWGLSRHKRDECGQEPKYQCPQCPYR   90 (106)
Q Consensus        46 ~~~~~~~~~C~~C~~~f~~~~~l~~h~~~h~~~~~~~~C~~C~k~   90 (106)
                      -|..-....|..|++.|..... .   .. ..... ..|+.|+..
T Consensus       107 lHG~l~~~~C~~C~~~~~~~~~-~---~~-~~~~~-p~C~~Cgg~  145 (222)
T cd01413         107 LHGTLQTAYCVNCGSKYDLEEV-K---YA-KKHEV-PRCPKCGGI  145 (222)
T ss_pred             ccCCcCcceECCCCCCcchhHH-H---Hh-ccCCC-CcCCCCCCc
Confidence            3444455789999988765543 1   11 11233 579999753


No 228
>TIGR00244 transcriptional regulator NrdR. Members of this almost entirely bacterial family contain an ATP cone domain (PFAM:PF03477). There is never more than one member per genome. Common gene symbols given include nrdR, ybaD, ribX and ytcG. The member from Streptomyces coelicolor is found upstream in the operon of the class II oxygen-independent ribonucleotide reductase gene nrdJ and was shown to repress nrdJ expression. Many members of this family are found near genes for riboflavin biosynthesis in Gram-negative bacteria, suggesting a role in that pathway. However, a phylogenetic profiling study associates members of this family with the presence of a palindromic signal with consensus acaCwAtATaTwGtgt, termed the NrdR-box, an upstream element for most operons for ribonucleotide reductase of all three classes in bacterial genomes.
Probab=21.56  E-value=41  Score=20.13  Aligned_cols=12  Identities=25%  Similarity=0.623  Sum_probs=8.6

Q ss_pred             cccCccccccCC
Q psy12021         82 YQCPQCPYRASQ   93 (106)
Q Consensus        82 ~~C~~C~k~f~~   93 (106)
                      -.|..||+.|++
T Consensus        29 ReC~~C~~RFTT   40 (147)
T TIGR00244        29 RECLECHERFTT   40 (147)
T ss_pred             ccCCccCCccce
Confidence            577777777765


No 229
>PF04438 zf-HIT:  HIT zinc finger;  InterPro: IPR007529 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents the HIT-type zinc finger, which contains 7 conserved cysteines and one histidine that can potentially coordinate two zinc atoms. It has been named after the first protein that originally defined the domain: the yeast HIT1 protein (P46973 from SWISSPROT) []. The HIT-type zinc finger displays some sequence similarities to the MYND-type zinc finger. The function of this domain is unknown but it is mainly found in nuclear proteins involved in gene regulation and chromatin remodeling. This domain is also found in the thyroid receptor interacting protein 3 (TRIP-3) Q15649 from SWISSPROT, that specifically interacts with the ligand binding domain of the thyroid receptor. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 2YQP_A 2YQQ_A 1X4S_A.
Probab=21.52  E-value=39  Score=14.20  Aligned_cols=11  Identities=45%  Similarity=1.216  Sum_probs=5.2

Q ss_pred             cccCccccccC
Q psy12021         82 YQCPQCPYRAS   92 (106)
Q Consensus        82 ~~C~~C~k~f~   92 (106)
                      |.|+.|+..+-
T Consensus        14 Y~Cp~C~~~~C   24 (30)
T PF04438_consen   14 YRCPRCGARYC   24 (30)
T ss_dssp             EE-TTT--EES
T ss_pred             EECCCcCCcee
Confidence            77777776553


No 230
>PF02146 SIR2:  Sir2 family;  InterPro: IPR003000 These sequences represent the Sirtuin (Sir2-related) family of NAD+-dependent deacetylases. This family of enzymes is broadly conserved from bacteria to humans. In yeast, Sir2 proteins form complexes with other proteins to silence chromatin by accessing histones and deacetylating them. Sir2 proteins have been proposed to play a role in silencing, chromosome stability and ageing []. The bacterial enzyme CobB, an homologue of Sir2, is a phosphoribosyltransferase []. An in vitro ADP ribosyltransferase activity has also been associated with human members of this family []. Sir2-like enzymes employ NAD+ as a cosubstrate in deacetylation reactions [] and catalyse a reaction in which the cleavage of NAD(+)and histone and/or protein deacetylation are coupled to the formation of O-acetyl-ADP-ribose, a novel metabolite. The dependence of the reaction on both NAD(+) and the generation of this potential second messenger offers new clues to understanding the function and regulation of nuclear, cytoplasmic and mitochondrial Sir2-like enzymes []. Silent Information Regulator protein of Saccharomyces cerevisiae (Sir2) is one of several factors critical for silencing at least three loci. Among them, it is unique because it silences the rDNA as well as the mating type loci and telomeres []. Sir2 interacts in a complex with itself and with Sir3 and Sir4, two proteins that are able to interact with nucleosomes. In addition Sir2 also interacts with ubiquitination factors and/or complexes [].  Homologues of Sir2 share a core domain including the GAG and NID motifs and a putative C4 Zinc finger. The regions containing these three conserved motifs are individually essential for Sir2 silencing function, as are the four cysteins []. In addition, the conserved residues HG next to the putative Zn finger have been shown to be essential for the ADP ribosyltransferase activity []. ; GO: 0008270 zinc ion binding, 0070403 NAD+ binding, 0006476 protein deacetylation; PDB: 1S5P_A 3PKI_E 3PKJ_F 3K35_A 1ICI_A 1M2K_A 1M2G_A 1M2N_B 1M2H_A 1M2J_A ....
Probab=21.27  E-value=69  Score=19.33  Aligned_cols=39  Identities=26%  Similarity=0.444  Sum_probs=23.8

Q ss_pred             ccCCCceecccccccccCHHHHHHHHHHHcCCCCCcccCccccc
Q psy12021         47 QYNSGMFPCEVCGKKYKYKWGLSRHKRDECGQEPKYQCPQCPYR   90 (106)
Q Consensus        47 ~~~~~~~~C~~C~~~f~~~~~l~~h~~~h~~~~~~~~C~~C~k~   90 (106)
                      |..-....|..|++.+.......   ..... .. ..|+.|+..
T Consensus       100 HG~l~~~~C~~C~~~~~~~~~~~---~~~~~-~~-~~C~~C~~~  138 (178)
T PF02146_consen  100 HGSLFRLRCSKCGKEYDREDIVD---SIDEE-EP-PRCPKCGGL  138 (178)
T ss_dssp             TEEEEEEEETTTSBEEEGHHHHH---HHHTT-SS-CBCTTTSCB
T ss_pred             HhhhceeeecCCCccccchhhcc---ccccc-cc-ccccccCcc
Confidence            33344578999999887654322   12222 33 589999874


No 231
>TIGR00515 accD acetyl-CoA carboxylase, carboxyl transferase, beta subunit. The enzyme acetyl-CoA carboxylase contains a biotin carboxyl carrier protein or domain, a biotin carboxylase, and a carboxyl transferase. This model represents the beta chain of the carboxyl transferase for cases in which the architecture of the protein is as in E. coli, in which the carboxyltransferase portion consists of two non-identical subnits, alpha and beta.
Probab=21.25  E-value=79  Score=21.11  Aligned_cols=32  Identities=25%  Similarity=0.499  Sum_probs=19.3

Q ss_pred             eecccccccccCHHHHHHHHHHHcCCCCCcccCccccccCCh
Q psy12021         53 FPCEVCGKKYKYKWGLSRHKRDECGQEPKYQCPQCPYRASQK   94 (106)
Q Consensus        53 ~~C~~C~~~f~~~~~l~~h~~~h~~~~~~~~C~~C~k~f~~~   94 (106)
                      ..|+.|+.....+. |.        ..- +.|+.|+.-|...
T Consensus        27 ~~c~~c~~~~~~~~-l~--------~~~-~vc~~c~~h~rl~   58 (285)
T TIGR00515        27 TKCPKCGQVLYTKE-LE--------RNL-EVCPKCDHHMRMD   58 (285)
T ss_pred             eECCCCcchhhHHH-HH--------hhC-CCCCCCCCcCcCC
Confidence            47888887653322 11        123 6888888766543


No 232
>PF14369 zf-RING_3:  zinc-finger
Probab=21.19  E-value=45  Score=14.56  Aligned_cols=10  Identities=30%  Similarity=0.750  Sum_probs=7.4

Q ss_pred             ccCccccccC
Q psy12021         83 QCPQCPYRAS   92 (106)
Q Consensus        83 ~C~~C~k~f~   92 (106)
                      .|+.|+..|.
T Consensus        23 ~CP~C~~gFv   32 (35)
T PF14369_consen   23 ACPRCHGGFV   32 (35)
T ss_pred             CCcCCCCcEe
Confidence            5888887774


No 233
>KOG4727|consensus
Probab=20.95  E-value=63  Score=19.97  Aligned_cols=23  Identities=26%  Similarity=0.459  Sum_probs=19.5

Q ss_pred             CceecccccccccCHHHHHHHHH
Q psy12021         51 GMFPCEVCGKKYKYKWGLSRHKR   73 (106)
Q Consensus        51 ~~~~C~~C~~~f~~~~~l~~h~~   73 (106)
                      .-|-|++|.-++...-++..|+.
T Consensus        74 ~GyyCdVCdcvvKDSinflDHiN   96 (193)
T KOG4727|consen   74 GGYYCDVCDCVVKDSINFLDHIN   96 (193)
T ss_pred             CceeeeecceeehhhHHHHHHhc
Confidence            34889999999999888888865


No 234
>TIGR01384 TFS_arch transcription factor S, archaeal. There has been an apparent duplication event in the Halobacteriaceae lineage (Haloarcula, Haloferax, Haloquadratum, Halobacterium and Natromonas). There appears to be a separate duplication in Methanosphaera stadtmanae.
Probab=20.59  E-value=39  Score=18.47  Aligned_cols=12  Identities=25%  Similarity=0.866  Sum_probs=7.3

Q ss_pred             ceeccccccccc
Q psy12021         52 MFPCEVCGKKYK   63 (106)
Q Consensus        52 ~~~C~~C~~~f~   63 (106)
                      .+.|..|+..+.
T Consensus        16 ~~~C~~C~~~~~   27 (104)
T TIGR01384        16 VYVCPSCGYEKE   27 (104)
T ss_pred             eEECcCCCCccc
Confidence            466777775543


No 235
>PRK11823 DNA repair protein RadA; Provisional
Probab=20.47  E-value=70  Score=22.69  Aligned_cols=24  Identities=25%  Similarity=0.678  Sum_probs=15.5

Q ss_pred             ceecccccccccCHHHHHHHHHHHcCCCCCcccCccccc
Q psy12021         52 MFPCEVCGKKYKYKWGLSRHKRDECGQEPKYQCPQCPYR   90 (106)
Q Consensus        52 ~~~C~~C~~~f~~~~~l~~h~~~h~~~~~~~~C~~C~k~   90 (106)
                      .|.|..||..+.               +.-.+|+.|+.+
T Consensus         7 ~y~C~~Cg~~~~---------------~~~g~Cp~C~~w   30 (446)
T PRK11823          7 AYVCQECGAESP---------------KWLGRCPECGAW   30 (446)
T ss_pred             eEECCcCCCCCc---------------ccCeeCcCCCCc
Confidence            488999985432               222578888754


No 236
>PF12773 DZR:  Double zinc ribbon
Probab=20.05  E-value=63  Score=14.87  Aligned_cols=10  Identities=30%  Similarity=0.786  Sum_probs=6.8

Q ss_pred             cccCcccccc
Q psy12021         82 YQCPQCPYRA   91 (106)
Q Consensus        82 ~~C~~C~k~f   91 (106)
                      ..|+.|+...
T Consensus        30 ~~C~~Cg~~~   39 (50)
T PF12773_consen   30 KICPNCGAEN   39 (50)
T ss_pred             CCCcCCcCCC
Confidence            6777777653


Done!