Query         psy12028
Match_columns 118
No_of_seqs    129 out of 1137
Neff          11.6
Searched_HMMs 46136
Date          Fri Aug 16 16:48:02 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy12028.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/12028hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG2462|consensus              100.0 6.5E-33 1.4E-37  161.8   5.1  110    2-118   131-242 (279)
  2 KOG2462|consensus              100.0 1.3E-30 2.9E-35  152.2   5.0  104    2-113   162-265 (279)
  3 KOG1074|consensus               99.9 3.7E-24 7.9E-29  140.4   1.4   53   62-115   605-657 (958)
  4 KOG3576|consensus               99.8 1.2E-21 2.6E-26  110.7   3.4  110    2-116   118-237 (267)
  5 KOG1074|consensus               99.8 8.1E-21 1.8E-25  125.0   3.5   53   63-116   880-932 (958)
  6 KOG3623|consensus               99.7   2E-18 4.3E-23  112.8   2.9  110    2-112   211-330 (1007)
  7 KOG3608|consensus               99.7 5.1E-18 1.1E-22  103.1   3.6  108    2-115   238-376 (467)
  8 KOG3576|consensus               99.7 1.9E-18 4.1E-23   97.9   0.5   85   28-117   115-199 (267)
  9 KOG3608|consensus               99.7 3.2E-17   7E-22   99.7   5.1  108    4-114   182-315 (467)
 10 KOG3623|consensus               99.7 1.8E-17 3.9E-22  108.5   1.6   80   28-112   892-971 (1007)
 11 PHA00733 hypothetical protein   99.5 2.6E-14 5.6E-19   77.4   4.0   85   28-116    38-124 (128)
 12 PLN03086 PRLI-interacting fact  99.4 5.7E-13 1.2E-17   86.8   7.1  102    2-116   454-565 (567)
 13 PHA02768 hypothetical protein;  99.3 1.2E-12 2.6E-17   59.8   1.6   44   62-108     5-48  (55)
 14 PHA00733 hypothetical protein   99.3 2.9E-12 6.2E-17   69.5   3.2   80    2-87     41-124 (128)
 15 PHA02768 hypothetical protein;  99.2 4.8E-12 1.1E-16   57.8   2.0   42    2-46      6-47  (55)
 16 KOG3993|consensus               99.2   4E-12 8.6E-17   79.4   0.9   52    2-54    268-319 (500)
 17 PF13465 zf-H2C2_2:  Zinc-finge  99.1 2.8E-11 6.1E-16   47.7   1.3   26   77-103     1-26  (26)
 18 PLN03086 PRLI-interacting fact  99.1 5.2E-10 1.1E-14   73.4   6.0   77   28-114   451-537 (567)
 19 KOG3993|consensus               99.1 2.1E-11 4.6E-16   76.2  -0.4   82   31-116   268-381 (500)
 20 PHA00616 hypothetical protein   99.0 1.9E-10   4E-15   50.2   1.2   33   62-95      1-33  (44)
 21 PF13465 zf-H2C2_2:  Zinc-finge  98.9 6.4E-10 1.4E-14   43.8   1.8   26   16-42      1-26  (26)
 22 PHA00616 hypothetical protein   98.9 5.5E-10 1.2E-14   48.8   1.5   34    1-35      1-34  (44)
 23 PHA00732 hypothetical protein   98.9 2.8E-09   6E-14   53.0   3.1   45    1-51      1-45  (79)
 24 PHA00732 hypothetical protein   98.8 2.2E-09 4.8E-14   53.4   2.1   48   30-86      1-48  (79)
 25 PF05605 zf-Di19:  Drought indu  98.8 1.5E-08 3.3E-13   46.9   3.6   51   63-116     3-54  (54)
 26 PF05605 zf-Di19:  Drought indu  98.6 1.2E-07 2.6E-12   43.9   4.1   46    2-50      3-49  (54)
 27 PF00096 zf-C2H2:  Zinc finger,  98.6 2.5E-08 5.3E-13   38.0   1.1   22   92-113     1-22  (23)
 28 PF13894 zf-C2H2_4:  C2H2-type   98.5 6.3E-08 1.4E-12   37.1   1.7   24   92-115     1-24  (24)
 29 PF00096 zf-C2H2:  Zinc finger,  98.5 7.3E-08 1.6E-12   36.7   1.1   22    2-23      1-22  (23)
 30 PF13912 zf-C2H2_6:  C2H2-type   98.4 1.2E-07 2.7E-12   37.5   1.1   26   91-116     1-26  (27)
 31 PF13912 zf-C2H2_6:  C2H2-type   98.3 1.8E-07 3.9E-12   37.0   0.9   25    1-25      1-25  (27)
 32 PF12756 zf-C2H2_2:  C2H2 type   98.3 6.2E-07 1.4E-11   46.6   2.0   73   32-114     1-73  (100)
 33 PF13894 zf-C2H2_4:  C2H2-type   98.2 8.6E-07 1.9E-11   33.8   1.5   23    2-24      1-23  (24)
 34 COG5189 SFP1 Putative transcri  98.1 3.2E-07   7E-12   56.2  -0.6   70   28-112   347-419 (423)
 35 PF09237 GAGA:  GAGA factor;  I  98.1   3E-06 6.6E-11   37.9   1.9   29   89-117    22-50  (54)
 36 smart00355 ZnF_C2H2 zinc finge  98.0   8E-06 1.7E-10   31.5   2.5   23   92-114     1-23  (26)
 37 PF13909 zf-H2C2_5:  C2H2-type   98.0 4.7E-06   1E-10   31.9   1.5   24   92-116     1-24  (24)
 38 PF12756 zf-C2H2_2:  C2H2 type   98.0   4E-06 8.7E-11   43.6   1.6   74    3-86      1-74  (100)
 39 COG5189 SFP1 Putative transcri  97.9 2.4E-06 5.2E-11   52.5   0.6   25    1-25    349-375 (423)
 40 smart00355 ZnF_C2H2 zinc finge  97.8 2.4E-05 5.3E-10   30.1   2.1   23    2-24      1-23  (26)
 41 PF09237 GAGA:  GAGA factor;  I  97.7 2.8E-05   6E-10   34.9   1.8   32   59-91     21-52  (54)
 42 PF12874 zf-met:  Zinc-finger o  97.6 2.4E-05 5.2E-10   30.1   1.0   23   92-114     1-23  (25)
 43 PRK04860 hypothetical protein;  97.6 2.7E-05 5.8E-10   44.0   1.2   40   61-105   118-157 (160)
 44 PF12874 zf-met:  Zinc-finger o  97.5 4.7E-05   1E-09   29.3   0.8   20    3-22      2-21  (25)
 45 KOG2785|consensus               97.4  0.0003 6.5E-09   44.6   4.3  112    2-113     4-242 (390)
 46 PRK04860 hypothetical protein;  97.4 0.00011 2.3E-09   41.6   1.9   37   30-74    119-155 (160)
 47 PF12171 zf-C2H2_jaz:  Zinc-fin  97.4 0.00013 2.8E-09   28.6   1.4   21    2-22      2-22  (27)
 48 KOG2231|consensus               97.3 0.00095 2.1E-08   45.6   5.8   97   11-115   124-236 (669)
 49 PF12171 zf-C2H2_jaz:  Zinc-fin  97.3 8.9E-05 1.9E-09   29.1   0.6   22   92-113     2-23  (27)
 50 PF13909 zf-H2C2_5:  C2H2-type   97.2  0.0002 4.4E-09   27.2   1.3   22    2-24      1-22  (24)
 51 PF13913 zf-C2HC_2:  zinc-finge  97.0 0.00087 1.9E-08   25.8   2.0   20   92-112     3-22  (25)
 52 KOG4173|consensus               96.8 0.00044 9.6E-09   40.3   0.8   80   29-115    78-170 (253)
 53 KOG1146|consensus               96.7 0.00044 9.5E-09   50.1   0.3   23   90-112   588-610 (1406)
 54 smart00451 ZnF_U1 U1-like zinc  96.5  0.0028   6E-08   26.2   2.0   23   91-113     3-25  (35)
 55 KOG1146|consensus               96.4  0.0018 3.9E-08   47.2   1.6   53   61-113   464-540 (1406)
 56 smart00451 ZnF_U1 U1-like zinc  96.2   0.004 8.7E-08   25.8   1.5   20    2-21      4-23  (35)
 57 cd00350 rubredoxin_like Rubred  96.1  0.0038 8.2E-08   25.7   1.3   25    2-39      2-26  (33)
 58 COG2888 Predicted Zn-ribbon RN  95.8  0.0094   2E-07   27.8   2.0   33   29-70     26-58  (61)
 59 COG4049 Uncharacterized protei  95.7  0.0038 8.3E-08   28.6   0.5   28   60-87     15-42  (65)
 60 COG5048 FOG: Zn-finger [Genera  95.7  0.0028   6E-08   41.1  -0.0   50    1-51    289-344 (467)
 61 COG5236 Uncharacterized conser  95.3   0.026 5.6E-07   35.9   3.1  102    2-112   152-272 (493)
 62 COG5048 FOG: Zn-finger [Genera  94.9  0.0044 9.5E-08   40.2  -0.9   55   61-116   288-348 (467)
 63 PF09538 FYDLN_acid:  Protein o  94.5   0.026 5.7E-07   30.0   1.5   11   31-41     10-20  (108)
 64 PRK14890 putative Zn-ribbon RN  94.2   0.041 8.9E-07   25.7   1.7   33   29-70     24-56  (59)
 65 KOG2482|consensus               94.1   0.068 1.5E-06   34.0   2.9   49   63-111   280-354 (423)
 66 KOG2482|consensus               94.1    0.14 3.1E-06   32.7   4.3   24   92-115   280-303 (423)
 67 cd00729 rubredoxin_SM Rubredox  94.0   0.038 8.2E-07   22.9   1.2   25    2-39      3-27  (34)
 68 PF13719 zinc_ribbon_5:  zinc-r  93.9   0.029 6.3E-07   23.7   0.8   32   64-101     4-35  (37)
 69 KOG4173|consensus               93.8   0.022 4.9E-07   33.5   0.4   78    3-84     81-168 (253)
 70 PF09986 DUF2225:  Uncharacteri  93.4   0.017 3.7E-07   34.5  -0.5   41    2-42      6-60  (214)
 71 KOG2231|consensus               93.4    0.12 2.6E-06   36.0   3.3   82   32-115   117-206 (669)
 72 smart00834 CxxC_CXXC_SSSS Puta  93.2   0.031 6.7E-07   23.9   0.3   12    2-13      6-17  (41)
 73 PF12013 DUF3505:  Protein of u  93.1   0.085 1.8E-06   28.0   1.9   26   91-116    80-109 (109)
 74 KOG2186|consensus               93.1   0.052 1.1E-06   33.0   1.2   46    2-51      4-49  (276)
 75 TIGR00622 ssl1 transcription f  93.0    0.26 5.7E-06   26.4   3.6   84   28-114    13-104 (112)
 76 PF09723 Zn-ribbon_8:  Zinc rib  93.0   0.027 5.8E-07   24.5  -0.1   12    2-13      6-17  (42)
 77 COG4049 Uncharacterized protei  92.9    0.11 2.4E-06   23.9   1.9   23   28-50     15-37  (65)
 78 TIGR02605 CxxC_CxxC_SSSS putat  92.8   0.032   7E-07   25.3   0.1   12    2-13      6-17  (52)
 79 PF13717 zinc_ribbon_4:  zinc-r  92.8   0.056 1.2E-06   22.7   0.8   32   64-101     4-35  (36)
 80 TIGR02098 MJ0042_CXXC MJ0042 f  92.6   0.057 1.2E-06   22.8   0.7   10   92-101    26-35  (38)
 81 TIGR00373 conserved hypothetic  92.4    0.12 2.7E-06   29.4   2.1   32   28-72    107-138 (158)
 82 PF12013 DUF3505:  Protein of u  92.3    0.25 5.5E-06   26.2   3.1   25   63-87     81-109 (109)
 83 PRK00464 nrdR transcriptional   92.2   0.042 9.2E-07   31.1   0.0   48    2-50      1-48  (154)
 84 COG1592 Rubrerythrin [Energy p  92.0   0.096 2.1E-06   30.0   1.3   24   62-99    134-157 (166)
 85 TIGR00373 conserved hypothetic  91.9    0.11 2.4E-06   29.6   1.5   30    2-41    110-139 (158)
 86 COG1997 RPL43A Ribosomal prote  91.8   0.055 1.2E-06   27.4   0.2   29   63-102    36-64  (89)
 87 smart00531 TFIIE Transcription  91.8    0.11 2.4E-06   29.2   1.4   38   28-73     97-134 (147)
 88 smart00614 ZnF_BED BED zinc fi  91.7    0.18 3.9E-06   22.7   1.8   24   92-115    19-47  (50)
 89 PRK00398 rpoP DNA-directed RNA  91.7   0.074 1.6E-06   23.6   0.5   11    2-12      4-14  (46)
 90 KOG2186|consensus               91.3    0.13 2.9E-06   31.3   1.5   47   30-83      3-49  (276)
 91 PRK06266 transcription initiat  91.3    0.14   3E-06   29.8   1.5   33   28-73    115-147 (178)
 92 TIGR02300 FYDLN_acid conserved  91.1    0.18   4E-06   27.5   1.7   13   29-41     25-37  (129)
 93 PF02892 zf-BED:  BED zinc fing  91.0    0.14   3E-06   22.4   1.0   27   89-115    14-44  (45)
 94 PRK06266 transcription initiat  90.9    0.19   4E-06   29.3   1.8   30   61-100   116-145 (178)
 95 smart00659 RPOLCX RNA polymera  90.6    0.19 4.1E-06   22.1   1.3   26    2-39      3-28  (44)
 96 PF09845 DUF2072:  Zn-ribbon co  90.6    0.13 2.8E-06   28.2   0.9   28    1-39      1-28  (131)
 97 PF05443 ROS_MUCR:  ROS/MUCR tr  90.6    0.12 2.7E-06   28.5   0.8   25   89-116    70-94  (132)
 98 smart00734 ZnF_Rad18 Rad18-lik  89.5    0.48   1E-05   18.3   1.9   19   93-112     3-21  (26)
 99 COG3357 Predicted transcriptio  88.9    0.26 5.5E-06   25.2   1.1   14   29-42     57-70  (97)
100 KOG4167|consensus               88.7   0.069 1.5E-06   37.3  -1.2   25    2-26    793-817 (907)
101 PF14353 CpXC:  CpXC protein     88.7    0.38 8.3E-06   26.3   1.8   48    2-49      2-57  (128)
102 KOG2893|consensus               88.6    0.09 1.9E-06   31.8  -0.7   41   65-110    13-53  (341)
103 PF03604 DNA_RNApol_7kD:  DNA d  88.6    0.34 7.5E-06   19.7   1.2   26    2-39      1-26  (32)
104 PF10571 UPF0547:  Uncharacteri  88.5    0.31 6.8E-06   18.8   1.0   10   93-102    16-25  (26)
105 PF04959 ARS2:  Arsenite-resist  88.0     0.2 4.3E-06   30.1   0.4   29   89-117    75-103 (214)
106 PF06524 NOA36:  NOA36 protein;  87.2    0.27 5.8E-06   30.3   0.7   26   89-114   207-232 (314)
107 COG5188 PRP9 Splicing factor 3  86.3    0.54 1.2E-05   30.3   1.7   23   89-111   372-395 (470)
108 PF08274 PhnA_Zn_Ribbon:  PhnA   86.2    0.32   7E-06   19.5   0.5   26    3-40      4-29  (30)
109 TIGR01206 lysW lysine biosynth  86.2    0.33 7.2E-06   22.4   0.6   31    2-41      3-33  (54)
110 smart00440 ZnF_C2C2 C2C2 Zinc   86.1     0.1 2.3E-06   22.4  -1.1   11   30-40     28-38  (40)
111 COG1996 RPC10 DNA-directed RNA  86.0    0.36 7.9E-06   21.8   0.6   10    2-11      7-16  (49)
112 PF13878 zf-C2H2_3:  zinc-finge  85.5     1.1 2.3E-05   19.4   2.0   22    3-24     15-38  (41)
113 PHA00626 hypothetical protein   85.4     0.5 1.1E-05   21.9   0.9   15   89-103    21-35  (59)
114 COG4957 Predicted transcriptio  84.9    0.66 1.4E-05   25.6   1.4   22   92-116    77-98  (148)
115 PF07754 DUF1610:  Domain of un  84.3    0.51 1.1E-05   17.9   0.6   11   28-38     14-24  (24)
116 COG5236 Uncharacterized conser  84.2     1.8 3.9E-05   28.1   3.2   21    4-24    223-243 (493)
117 KOG2893|consensus               84.2    0.28   6E-06   29.8  -0.2   41    4-49     13-53  (341)
118 PF09963 DUF2197:  Uncharacteri  84.0    0.27 5.8E-06   22.9  -0.3    9    4-12      5-13  (56)
119 KOG2785|consensus               83.7     1.6 3.4E-05   28.6   2.9   49    3-51    168-241 (390)
120 TIGR00686 phnA alkylphosphonat  83.6     0.7 1.5E-05   24.5   1.1   30    3-44      4-33  (109)
121 PF15269 zf-C2H2_7:  Zinc-finge  83.4    0.88 1.9E-05   20.0   1.2   19    3-21     22-40  (54)
122 COG3364 Zn-ribbon containing p  83.1    0.86 1.9E-05   23.9   1.3   14    1-14      2-15  (112)
123 PF13453 zf-TFIIB:  Transcripti  82.9    0.63 1.4E-05   20.0   0.7   21   28-48     17-37  (41)
124 PRK09678 DNA-binding transcrip  82.3     0.7 1.5E-05   22.7   0.8   40    2-44      2-43  (72)
125 PF07975 C1_4:  TFIIH C1-like d  81.8     1.4 2.9E-05   20.1   1.6   21   29-49     20-40  (51)
126 KOG2593|consensus               81.8    0.98 2.1E-05   30.0   1.5   18   30-47    128-145 (436)
127 PF06524 NOA36:  NOA36 protein;  81.2    0.72 1.6E-05   28.5   0.7   82    2-85    143-232 (314)
128 KOG2907|consensus               80.6    0.95 2.1E-05   24.2   1.0   40   30-73     74-113 (116)
129 PRK10220 hypothetical protein;  80.4     1.3 2.8E-05   23.6   1.4   30    3-44      5-34  (111)
130 PF01927 Mut7-C:  Mut7-C RNAse   79.8     1.3 2.7E-05   25.0   1.4   11   62-72    124-134 (147)
131 COG4338 Uncharacterized protei  78.6    0.86 1.9E-05   20.4   0.4   18   31-48     13-30  (54)
132 COG1656 Uncharacterized conser  78.5     2.5 5.5E-05   24.4   2.3   18   30-47    130-147 (165)
133 PRK03824 hypA hydrogenase nick  78.3    0.91   2E-05   25.2   0.5   15   29-43     69-83  (135)
134 PF01096 TFIIS_C:  Transcriptio  78.1   0.083 1.8E-06   22.6  -2.9   10   31-40     29-38  (39)
135 PRK04023 DNA polymerase II lar  78.0     4.2   9E-05   30.4   3.6   10   30-39    626-635 (1121)
136 PF07503 zf-HYPF:  HypF finger;  77.9     1.1 2.4E-05   18.7   0.6   31   65-102     2-32  (35)
137 PF14446 Prok-RING_1:  Prokaryo  77.8    0.75 1.6E-05   21.2   0.1   10   31-40     22-31  (54)
138 smart00154 ZnF_AN1 AN1-like Zi  77.4     1.2 2.6E-05   19.0   0.7   12    1-12     12-23  (39)
139 COG0068 HypF Hydrogenase matur  76.7    0.46 9.9E-06   33.5  -1.1   58   31-100   124-182 (750)
140 PF12907 zf-met2:  Zinc-binding  76.0       2 4.3E-05   18.5   1.1   22   63-84      2-26  (40)
141 COG1675 TFA1 Transcription ini  75.2     4.4 9.5E-05   23.7   2.7   33   28-73    111-143 (176)
142 PF02176 zf-TRAF:  TRAF-type zi  75.2    0.88 1.9E-05   21.1  -0.1   41   29-74      8-54  (60)
143 KOG0978|consensus               74.9     1.4 2.9E-05   31.3   0.7   20   91-110   678-697 (698)
144 TIGR00280 L37a ribosomal prote  74.8    0.76 1.6E-05   23.7  -0.4   11   91-101    53-63  (91)
145 PF10013 DUF2256:  Uncharacteri  74.2     2.8   6E-05   18.3   1.3   16   93-108    10-25  (42)
146 PF04780 DUF629:  Protein of un  74.0     2.8 6.1E-05   28.4   1.9   25   91-115    57-81  (466)
147 PRK12380 hydrogenase nickel in  73.8     1.6 3.4E-05   23.5   0.7   13   31-43     71-83  (113)
148 KOG4167|consensus               73.7     1.7 3.6E-05   31.1   0.9   28   60-87    790-817 (907)
149 PF04959 ARS2:  Arsenite-resist  73.5     2.2 4.7E-05   25.8   1.2   27   28-54     75-101 (214)
150 PF05191 ADK_lid:  Adenylate ki  72.9    0.74 1.6E-05   19.3  -0.6    9   64-72      3-11  (36)
151 KOG2636|consensus               72.5     3.3 7.1E-05   27.9   1.9   28   83-111   394-422 (497)
152 COG1594 RPB9 DNA-directed RNA   72.5    0.87 1.9E-05   24.5  -0.5   39   31-73     73-111 (113)
153 PF13240 zinc_ribbon_2:  zinc-r  71.5     2.2 4.8E-05   15.8   0.7    6   33-38     16-21  (23)
154 TIGR00100 hypA hydrogenase nic  71.4     1.7 3.7E-05   23.4   0.5   13   31-43     71-83  (115)
155 KOG1842|consensus               71.4     2.3   5E-05   28.5   1.1   25   63-87     16-40  (505)
156 PF13824 zf-Mss51:  Zinc-finger  71.3     5.7 0.00012   18.4   2.1   15   28-42     12-26  (55)
157 PF08790 zf-LYAR:  LYAR-type C2  71.2     0.9   2E-05   17.9  -0.5    9   32-40      2-10  (28)
158 PRK03976 rpl37ae 50S ribosomal  71.1       1 2.2E-05   23.2  -0.4   11   91-101    54-64  (90)
159 PF07282 OrfB_Zn_ribbon:  Putat  69.8     3.8 8.3E-05   19.6   1.5   29   31-73     29-57  (69)
160 KOG1280|consensus               69.8     5.3 0.00011   26.0   2.3   24    2-25     80-103 (381)
161 COG1655 Uncharacterized protei  69.6       1 2.2E-05   27.4  -0.7   20    3-22     21-40  (267)
162 COG2331 Uncharacterized protei  68.9     1.1 2.3E-05   22.2  -0.6   10   31-40     13-22  (82)
163 COG4896 Uncharacterized protei  68.6     1.8   4E-05   20.4   0.2   38    3-41      4-42  (68)
164 smart00661 RPOL9 RNA polymeras  67.9     2.8 6.1E-05   18.7   0.7   13   30-42     20-32  (52)
165 KOG3408|consensus               66.1     4.7  0.0001   22.0   1.4   24   61-84     56-79  (129)
166 PF13451 zf-trcl:  Probable zin  65.6       3 6.4E-05   18.9   0.5   41   28-71      2-42  (49)
167 PHA02998 RNA polymerase subuni  65.5     1.5 3.2E-05   25.6  -0.5   42   30-75    143-184 (195)
168 KOG2071|consensus               65.2     5.7 0.00012   27.7   2.0   27   89-115   416-442 (579)
169 COG1571 Predicted DNA-binding   64.3     4.6  0.0001   27.0   1.4   29   64-104   352-380 (421)
170 PRK00564 hypA hydrogenase nick  64.3       3 6.5E-05   22.6   0.5   13   31-43     72-84  (117)
171 PRK03681 hypA hydrogenase nick  64.0     3.5 7.5E-05   22.2   0.7   12   31-42     71-82  (114)
172 PF04423 Rad50_zn_hook:  Rad50   63.9     2.7 5.9E-05   19.2   0.3   12   32-43     22-33  (54)
173 KOG4124|consensus               63.0     1.3 2.8E-05   28.7  -1.1   22    1-22    349-372 (442)
174 PF01428 zf-AN1:  AN1-like Zinc  62.0     2.2 4.7E-05   18.5  -0.2   12   90-101    12-23  (43)
175 PTZ00255 60S ribosomal protein  61.0     3.9 8.4E-05   21.1   0.5   33   28-74     34-66  (90)
176 PF15135 UPF0515:  Uncharacteri  60.5     8.1 0.00018   24.0   1.9   14   29-42    111-124 (278)
177 PTZ00448 hypothetical protein;  59.8     8.5 0.00018   25.3   2.0   23   91-113   314-336 (373)
178 cd00730 rubredoxin Rubredoxin;  59.5     4.7  0.0001   18.3   0.6   12    2-13      2-13  (50)
179 PF01155 HypA:  Hydrogenase exp  58.9     3.2 6.9E-05   22.3   0.0   12   31-42     71-82  (113)
180 PTZ00448 hypothetical protein;  57.4     9.2  0.0002   25.2   1.8   21   31-51    315-335 (373)
181 COG1773 Rubredoxin [Energy pro  57.3     3.8 8.2E-05   19.0   0.1   12    2-13      4-15  (55)
182 PRK00762 hypA hydrogenase nick  57.3     5.1 0.00011   21.9   0.6   11   31-42     71-81  (124)
183 PRK05978 hypothetical protein;  57.3     3.7 8.1E-05   23.3   0.1    9   31-39     34-42  (148)
184 PF06397 Desulfoferrod_N:  Desu  56.8     3.2 6.8E-05   17.5  -0.2   10    2-11      7-16  (36)
185 PF01780 Ribosomal_L37ae:  Ribo  56.6       2 4.3E-05   22.1  -0.9   32   29-74     34-65  (90)
186 PF04780 DUF629:  Protein of un  56.6     8.1 0.00017   26.4   1.5   23   29-51     56-78  (466)
187 TIGR01384 TFS_arch transcripti  56.3     2.1 4.5E-05   22.5  -0.9   40   30-73     62-101 (104)
188 COG1198 PriA Primosomal protei  55.8     4.9 0.00011   29.0   0.5   12   28-39    473-484 (730)
189 PLN02294 cytochrome c oxidase   55.0     7.2 0.00016   22.7   1.0   16   28-43    139-154 (174)
190 PRK14714 DNA polymerase II lar  54.9      14  0.0003   28.7   2.5   32   31-71    668-701 (1337)
191 PF05290 Baculo_IE-1:  Baculovi  54.3     4.5 9.6E-05   22.5   0.1   16   28-43     78-93  (140)
192 KOG2593|consensus               53.8      16 0.00035   24.7   2.5   34   61-98    127-160 (436)
193 TIGR00416 sms DNA repair prote  53.5     6.7 0.00014   26.6   0.8   10   31-40      8-17  (454)
194 KOG0717|consensus               53.5     7.3 0.00016   26.5   1.0   22    2-23    293-314 (508)
195 PF01286 XPA_N:  XPA protein N-  53.2     4.7  0.0001   16.7   0.1   14   92-105     4-17  (34)
196 PF08209 Sgf11:  Sgf11 (transcr  52.8      14 0.00031   15.1   1.5   20   30-50      4-23  (33)
197 PRK00420 hypothetical protein;  52.3      12 0.00025   20.3   1.5   10   31-40     24-33  (112)
198 cd00924 Cyt_c_Oxidase_Vb Cytoc  52.0     8.8 0.00019   20.1   1.0   15   28-42     77-91  (97)
199 COG5216 Uncharacterized conser  51.4      11 0.00024   17.7   1.1   11   31-42     23-33  (67)
200 PF00301 Rubredoxin:  Rubredoxi  50.8     4.5 9.8E-05   18.1  -0.2   13    2-14      2-14  (47)
201 COG4530 Uncharacterized protei  50.7      16 0.00035   19.6   1.8   14   89-102    24-37  (129)
202 CHL00174 accD acetyl-CoA carbo  50.7     8.8 0.00019   24.5   1.0   10   31-40     39-48  (296)
203 PF12760 Zn_Tnp_IS1595:  Transp  50.1     6.9 0.00015   17.2   0.4    9   31-39     19-27  (46)
204 PRK11823 DNA repair protein Ra  49.3     8.6 0.00019   26.0   0.8    9    2-10      8-16  (446)
205 COG3091 SprT Zn-dependent meta  48.8     6.7 0.00015   22.4   0.3   35   60-100   115-149 (156)
206 PF14311 DUF4379:  Domain of un  48.3      17 0.00037   16.5   1.6   15   30-44     28-42  (55)
207 COG1326 Uncharacterized archae  48.3      17 0.00037   21.7   1.8   14   28-41     28-41  (201)
208 TIGR00515 accD acetyl-CoA carb  47.8      15 0.00033   23.4   1.7   10   31-40     27-36  (285)
209 TIGR01385 TFSII transcription   47.8     4.7  0.0001   25.7  -0.5   41   29-73    257-297 (299)
210 PF01363 FYVE:  FYVE zinc finge  47.7     8.9 0.00019   18.3   0.6   11   31-41     10-20  (69)
211 PF11931 DUF3449:  Domain of un  46.5     6.6 0.00014   23.5   0.0   22   89-110    99-121 (196)
212 PF10276 zf-CHCC:  Zinc-finger   46.4     4.6 9.9E-05   17.4  -0.5   11   91-101    29-39  (40)
213 TIGR00143 hypF [NiFe] hydrogen  46.3     2.7 5.9E-05   30.1  -1.8   58   32-100    92-149 (711)
214 PF13821 DUF4187:  Domain of un  46.2      12 0.00026   17.4   0.8   18   93-110    29-46  (55)
215 COG3677 Transposase and inacti  46.0     9.9 0.00021   21.0   0.6   36   63-104    31-66  (129)
216 cd00974 DSRD Desulforedoxin (D  45.6       8 0.00017   15.7   0.2   10    2-11      5-14  (34)
217 PF14787 zf-CCHC_5:  GAG-polypr  45.6      14  0.0003   15.5   0.9   15   92-106     3-17  (36)
218 TIGR00319 desulf_FeS4 desulfof  45.4     7.8 0.00017   15.7   0.1   10    2-11      8-17  (34)
219 COG2956 Predicted N-acetylgluc  45.2      20 0.00043   23.6   1.9   14   28-41    352-365 (389)
220 PF10537 WAC_Acf1_DNA_bd:  ATP-  45.1      28 0.00061   18.5   2.2   37    2-40      4-40  (102)
221 KOG1280|consensus               45.1      24 0.00052   23.2   2.2   29   89-117    77-105 (381)
222 cd01121 Sms Sms (bacterial rad  44.2      13 0.00027   24.7   1.0   23    2-39      1-23  (372)
223 COG4391 Uncharacterized protei  44.0      15 0.00032   17.5   1.0   14   28-41     46-59  (62)
224 PF11672 DUF3268:  Protein of u  44.0      13 0.00027   19.8   0.8    8   31-38     32-39  (102)
225 PRK05654 acetyl-CoA carboxylas  43.9      13 0.00027   23.8   1.0   12   30-41     27-38  (292)
226 PLN02748 tRNA dimethylallyltra  43.4      23 0.00051   24.3   2.1   24   90-113   417-441 (468)
227 TIGR01562 FdhE formate dehydro  43.4      18  0.0004   23.3   1.6    8   63-70    225-232 (305)
228 PF14447 Prok-RING_4:  Prokaryo  43.2      13 0.00029   17.3   0.7   16   28-43     37-52  (55)
229 COG4306 Uncharacterized protei  43.1      11 0.00025   20.7   0.6   25   16-40     25-49  (160)
230 PF04810 zf-Sec23_Sec24:  Sec23  43.0     4.6 9.9E-05   17.2  -0.8   10   29-38     23-32  (40)
231 KOG2071|consensus               42.9      18 0.00039   25.5   1.6   26    1-26    418-443 (579)
232 PF02891 zf-MIZ:  MIZ/SP-RING z  42.2      10 0.00023   17.0   0.3    8   31-38     42-49  (50)
233 KOG2857|consensus               41.5      18 0.00039   20.4   1.2   21   30-50     17-37  (157)
234 PF12773 DZR:  Double zinc ribb  41.4      20 0.00044   15.8   1.2   10   32-41     14-23  (50)
235 PF11789 zf-Nse:  Zinc-finger o  41.4      12 0.00026   17.4   0.4   16   29-44     23-38  (57)
236 KOG2807|consensus               41.3      32  0.0007   22.5   2.4   19   30-48    290-308 (378)
237 TIGR03829 YokU_near_AblA uncha  41.3      20 0.00044   18.5   1.3   14    3-16     37-50  (89)
238 PRK14892 putative transcriptio  41.0       8 0.00017   20.4  -0.2    8   30-37     21-28  (99)
239 PF02591 DUF164:  Putative zinc  40.9      29 0.00062   15.9   1.7   33   31-71     23-55  (56)
240 PF14255 Cys_rich_CPXG:  Cystei  40.9      15 0.00033   16.8   0.7   11   32-42      2-12  (52)
241 TIGR00244 transcriptional regu  40.7      14 0.00031   21.0   0.7   16   90-105    27-42  (147)
242 PF14803 Nudix_N_2:  Nudix N-te  40.5     8.6 0.00019   15.9  -0.1    8   31-38     23-30  (34)
243 PF14369 zf-RING_3:  zinc-finge  40.5      16 0.00035   15.1   0.7   10   32-41     23-32  (35)
244 PRK08222 hydrogenase 4 subunit  40.3      22 0.00049   20.9   1.6   17    2-18    115-131 (181)
245 KOG1842|consensus               40.0      26 0.00057   23.9   1.9   22   29-50     14-35  (505)
246 PF13005 zf-IS66:  zinc-finger   39.6     6.1 0.00013   17.2  -0.7    9    4-12      5-13  (47)
247 KOG2272|consensus               38.8      41 0.00089   21.2   2.5   14   91-104   221-234 (332)
248 PF07800 DUF1644:  Protein of u  38.2      43 0.00094   19.4   2.4   51   63-116    81-133 (162)
249 PF10071 DUF2310:  Zn-ribbon-co  37.6      11 0.00023   23.7  -0.1   30   31-71    221-250 (258)
250 PRK05452 anaerobic nitric oxid  37.5      14 0.00031   25.3   0.5   16   28-43    423-438 (479)
251 smart00132 LIM Zinc-binding do  37.4      20 0.00043   14.3   0.8   10    2-11     28-37  (39)
252 PRK12722 transcriptional activ  37.4      29 0.00063   20.7   1.7   30   29-70    133-162 (187)
253 PTZ00043 cytochrome c oxidase   37.3      20 0.00044   22.0   1.0   16   28-43    179-194 (268)
254 PRK01343 zinc-binding protein;  37.2      25 0.00055   16.5   1.2   12   91-102     9-20  (57)
255 PRK06260 threonine synthase; V  37.2      25 0.00055   23.4   1.6   29    2-43      4-32  (397)
256 KOG4727|consensus               36.6      17 0.00037   21.2   0.7   21    2-22     76-96  (193)
257 KOG2923|consensus               36.5      32 0.00069   16.5   1.4    6   36-41     27-32  (67)
258 PF11023 DUF2614:  Protein of u  36.2      13 0.00029   20.0   0.2   15   28-42     67-81  (114)
259 PF14354 Lar_restr_allev:  Rest  36.2      26 0.00057   16.2   1.2   11   30-40      3-13  (61)
260 COG1885 Uncharacterized protei  36.1      21 0.00046   19.0   0.9   15   29-43     48-62  (115)
261 COG5112 UFD2 U1-like Zn-finger  35.6      30 0.00064   18.5   1.4   23   62-84     55-77  (126)
262 PRK12387 formate hydrogenlyase  35.0      26 0.00057   20.4   1.3   16    2-17    115-130 (180)
263 PF09332 Mcm10:  Mcm10 replicat  34.8     4.5 9.7E-05   26.4  -2.0   12   31-42    253-264 (344)
264 PRK12860 transcriptional activ  34.4      34 0.00074   20.4   1.7   29   29-69    133-161 (189)
265 KOG3214|consensus               34.3      19 0.00041   19.0   0.5   13   63-75     48-60  (109)
266 PF08271 TF_Zn_Ribbon:  TFIIB z  34.2      24 0.00053   15.1   0.8    9   92-100     1-9   (43)
267 PF09855 DUF2082:  Nucleic-acid  34.1      22 0.00047   17.1   0.7    8   92-99      1-8   (64)
268 TIGR03831 YgiT_finger YgiT-typ  33.8      22 0.00047   15.1   0.7   14   29-42     31-44  (46)
269 cd00065 FYVE FYVE domain; Zinc  33.6      24 0.00051   15.9   0.8    9   33-41      5-13  (57)
270 PRK06450 threonine synthase; V  33.4      30 0.00065   22.6   1.5   27    2-42      4-30  (338)
271 COG5151 SSL1 RNA polymerase II  33.3   1E+02  0.0022   20.3   3.6   24   90-113   387-410 (421)
272 PLN03238 probable histone acet  32.9      43 0.00093   21.5   2.0   24   89-112    46-69  (290)
273 TIGR02159 PA_CoA_Oxy4 phenylac  32.7      12 0.00025   21.3  -0.4   38   30-74    105-142 (146)
274 COG1327 Predicted transcriptio  32.5      22 0.00049   20.3   0.7   16   90-105    27-42  (156)
275 PF14690 zf-ISL3:  zinc-finger   32.0      32 0.00069   14.8   1.1   10   91-100     2-11  (47)
276 PF04438 zf-HIT:  HIT zinc fing  31.7      18  0.0004   14.4   0.2   13   30-42     13-25  (30)
277 PF03107 C1_2:  C1 domain;  Int  31.6      39 0.00085   13.2   1.2    9   92-100     1-9   (30)
278 PF08792 A2L_zn_ribbon:  A2L zi  31.5      22 0.00048   14.5   0.5    8   93-100    23-30  (33)
279 COG2824 PhnA Uncharacterized Z  31.5      16 0.00036   19.5   0.1   29    3-43      5-33  (112)
280 KOG1940|consensus               30.6      63  0.0014   20.7   2.4   18   31-49    197-214 (276)
281 PRK05580 primosome assembly pr  30.3      23 0.00051   25.5   0.7   12   28-39    419-430 (679)
282 PF01215 COX5B:  Cytochrome c o  29.6      15 0.00032   20.6  -0.3   16   28-43    110-125 (136)
283 PF14375 Cys_rich_CWC:  Cystein  29.1      37  0.0008   15.2   1.0    6   95-100     2-7   (50)
284 KOG4317|consensus               29.1      21 0.00045   23.2   0.2   20   30-49     19-38  (383)
285 KOG1701|consensus               29.1      10 0.00022   25.6  -1.1   14   30-43    302-315 (468)
286 PF05741 zf-nanos:  Nanos RNA b  28.8      21 0.00046   16.6   0.2   11   90-100    32-42  (55)
287 COG0675 Transposase and inacti  28.8      36 0.00078   21.7   1.3   13   62-74    322-334 (364)
288 PF10263 SprT-like:  SprT-like   28.7      12 0.00026   21.0  -0.8   32   61-101   122-153 (157)
289 TIGR00595 priA primosomal prot  27.9      27 0.00059   24.2   0.7   10   29-38    252-261 (505)
290 PRK07591 threonine synthase; V  27.6      44 0.00095   22.6   1.5   28    2-43     19-46  (421)
291 smart00064 FYVE Protein presen  27.5      61  0.0013   15.2   1.7   12   31-42     11-22  (68)
292 PF10367 Vps39_2:  Vacuolar sor  26.5      41 0.00088   17.4   1.0   12   92-103    79-90  (109)
293 COG3024 Uncharacterized protei  26.4      37 0.00081   16.3   0.8    9    3-11      9-17  (65)
294 PF14599 zinc_ribbon_6:  Zinc-r  26.4      14  0.0003   17.6  -0.7   15   31-45     31-45  (61)
295 PF14122 YokU:  YokU-like prote  25.2      43 0.00093   17.2   0.9   15    3-17     37-51  (87)
296 PRK14559 putative protein seri  24.9      71  0.0015   23.2   2.2    9    2-10      2-10  (645)
297 KOG4118|consensus               24.9      55  0.0012   15.8   1.2   25   63-87     39-63  (74)
298 PF03833 PolC_DP2:  DNA polymer  24.7      25 0.00053   26.2   0.0    9   31-39    656-664 (900)
299 KOG3002|consensus               24.7 1.1E+02  0.0024   19.8   2.8   16   28-43     78-93  (299)
300 KOG3014|consensus               24.6      55  0.0012   20.6   1.4   23    3-25     39-63  (257)
301 PF05129 Elf1:  Transcription e  24.4      36 0.00078   17.2   0.6   40   28-75     20-59  (81)
302 KOG0402|consensus               24.2      26 0.00055   17.9   0.0   31   29-73     35-65  (92)
303 PRK03922 hypothetical protein;  24.1      45 0.00098   18.0   0.9   14   30-43     49-62  (113)
304 PF02146 SIR2:  Sir2 family;  I  23.8      63  0.0014   18.7   1.6   11   31-41    106-116 (178)
305 COG3478 Predicted nucleic-acid  23.6      50  0.0011   16.0   0.9    8   91-98      4-11  (68)
306 PF01844 HNH:  HNH endonuclease  23.5      18 0.00039   15.4  -0.6   10    4-13      1-10  (47)
307 PF03966 Trm112p:  Trm112p-like  23.4      29 0.00063   16.6   0.1   15   28-42     51-65  (68)
308 PF03145 Sina:  Seven in absent  23.1      54  0.0012   19.4   1.2   26   61-87     43-72  (198)
309 PF06676 DUF1178:  Protein of u  23.1 1.1E+02  0.0023   17.6   2.3   34   11-49     18-51  (148)
310 KOG0801|consensus               23.1      28  0.0006   20.3  -0.0   12   31-42    139-150 (205)
311 PF13248 zf-ribbon_3:  zinc-rib  22.9      33 0.00071   12.9   0.2    8    3-10      4-11  (26)
312 KOG2906|consensus               22.8      11 0.00025   19.7  -1.4   38   31-72     66-103 (105)
313 PF03380 DUF282:  Caenorhabditi  22.8      54  0.0012   14.1   0.9    9    4-12      2-10  (39)
314 TIGR00627 tfb4 transcription f  22.7      60  0.0013   20.8   1.4    8   93-100   271-278 (279)
315 PF03884 DUF329:  Domain of unk  22.6      33 0.00071   16.1   0.2   12   31-42      3-14  (57)
316 PLN03239 histone acetyltransfe  22.3      58  0.0013   21.6   1.3   24   89-112   104-127 (351)
317 PF06220 zf-U1:  U1 zinc finger  22.1      84  0.0018   13.2   1.6   10   92-101     4-13  (38)
318 PF11494 Ta0938:  Ta0938;  Inte  22.0      51  0.0011   17.4   0.8   12   30-41     14-25  (105)
319 PF02748 PyrI_C:  Aspartate car  21.8      30 0.00065   15.8  -0.0   14   89-102    33-46  (52)
320 PF12230 PRP21_like_P:  Pre-mRN  21.6      31 0.00067   21.1   0.0   26   89-115   166-191 (229)
321 PTZ00303 phosphatidylinositol   21.6      12 0.00025   27.6  -2.0   13   31-43    461-473 (1374)
322 PF10058 DUF2296:  Predicted in  21.4      46 0.00099   15.3   0.5   11   89-99     42-52  (54)
323 PF06170 DUF983:  Protein of un  21.3      54  0.0012   16.8   0.8   11   93-103    10-20  (86)
324 COG5152 Uncharacterized conser  21.1      37 0.00081   20.5   0.3   13    1-13    196-208 (259)
325 TIGR03830 CxxCG_CxxCG_HTH puta  21.1      81  0.0018   16.9   1.6   17    2-18     32-48  (127)
326 PF04988 AKAP95:  A-kinase anch  20.8      73  0.0016   18.6   1.3   21   31-51      1-21  (165)
327 PF13696 zf-CCHC_2:  Zinc knuck  20.7      45 0.00098   13.6   0.4   10   91-100     8-17  (32)
328 PLN00104 MYST -like histone ac  20.7      63  0.0014   22.3   1.2   24   89-112   196-219 (450)
329 COG1066 Sms Predicted ATP-depe  20.7      46   0.001   22.8   0.6   10   31-40      8-17  (456)
330 smart00647 IBR In Between Ring  20.6      74  0.0016   14.5   1.2   11   63-73     41-51  (64)
331 TIGR03655 anti_R_Lar restricti  20.5      52  0.0011   14.9   0.6    8   32-39      3-10  (53)
332 PTZ00064 histone acetyltransfe  20.0      76  0.0016   22.3   1.5   24   89-112   278-301 (552)

No 1  
>KOG2462|consensus
Probab=99.98  E-value=6.5e-33  Score=161.79  Aligned_cols=110  Identities=28%  Similarity=0.573  Sum_probs=93.4

Q ss_pred             ccCCCCCccccchHHHHhhhhhhcCC--CCCccCCCCCcccccchHHHHHhhhhhccCCcccccccCchhhhhhchHHHH
Q psy12028          2 YACDVCGKEYQHKRTLYRHKKDECGQ--EPKFGCPQCPYRSRQKATLNRHLGWEQLQGNAHVMYACDVCGKVYQHKQTLD   79 (118)
Q Consensus         2 ~~C~~C~~~~~~~~~l~~h~~~~~~~--~~~~~C~~c~~~f~~~~~l~~h~~~~~~~~~~~~~~~c~~c~~~~~~~~~l~   79 (118)
                      |+|.+||+.|.+..+|.+|+.+|...  .+.+.|+.|++.+.+...|..|+++|-      .+..|.+||+.|.+++.|+
T Consensus       131 ~~c~eCgk~ysT~snLsrHkQ~H~~~~s~ka~~C~~C~K~YvSmpALkMHirTH~------l~c~C~iCGKaFSRPWLLQ  204 (279)
T KOG2462|consen  131 YKCPECGKSYSTSSNLSRHKQTHRSLDSKKAFSCKYCGKVYVSMPALKMHIRTHT------LPCECGICGKAFSRPWLLQ  204 (279)
T ss_pred             eeccccccccccccccchhhcccccccccccccCCCCCceeeehHHHhhHhhccC------CCcccccccccccchHHhh
Confidence            67889999999999999998888753  356889999999999999998876544      4578999999999999999


Q ss_pred             HHHhhhcCCCCCccCCCCCCCCCChhHHHHHHhhhcCCC
Q psy12028         80 RHKKDECGQEPKFECPHCPYRSKRKDTLDRHMKIIHFSD  118 (118)
Q Consensus        80 ~h~~~h~~~~~~~~C~~C~~~f~~~~~l~~H~~~~~~~~  118 (118)
                      .|+|+||| |+||.|..|+++|+++++|+.||++|.+.|
T Consensus       205 GHiRTHTG-EKPF~C~hC~kAFADRSNLRAHmQTHS~~K  242 (279)
T KOG2462|consen  205 GHIRTHTG-EKPFSCPHCGKAFADRSNLRAHMQTHSDVK  242 (279)
T ss_pred             cccccccC-CCCccCCcccchhcchHHHHHHHHhhcCCc
Confidence            99999998 999999999999999999999999887653


No 2  
>KOG2462|consensus
Probab=99.96  E-value=1.3e-30  Score=152.19  Aligned_cols=104  Identities=23%  Similarity=0.479  Sum_probs=98.1

Q ss_pred             ccCCCCCccccchHHHHhhhhhhcCCCCCccCCCCCcccccchHHHHHhhhhhccCCcccccccCchhhhhhchHHHHHH
Q psy12028          2 YACDVCGKEYQHKRTLYRHKKDECGQEPKFGCPQCPYRSRQKATLNRHLGWEQLQGNAHVMYACDVCGKVYQHKQTLDRH   81 (118)
Q Consensus         2 ~~C~~C~~~~~~~~~l~~h~~~~~~~~~~~~C~~c~~~f~~~~~l~~h~~~~~~~~~~~~~~~c~~c~~~~~~~~~l~~h   81 (118)
                      +.|..|+++|.+..+|.+|+++|+.   +..|.+||+.|...+-|+.|+    ..|++||||.|+.|+++|.+.++|+.|
T Consensus       162 ~~C~~C~K~YvSmpALkMHirTH~l---~c~C~iCGKaFSRPWLLQGHi----RTHTGEKPF~C~hC~kAFADRSNLRAH  234 (279)
T KOG2462|consen  162 FSCKYCGKVYVSMPALKMHIRTHTL---PCECGICGKAFSRPWLLQGHI----RTHTGEKPFSCPHCGKAFADRSNLRAH  234 (279)
T ss_pred             ccCCCCCceeeehHHHhhHhhccCC---CcccccccccccchHHhhccc----ccccCCCCccCCcccchhcchHHHHHH
Confidence            6899999999999999999999964   799999999999999999995    588899999999999999999999999


Q ss_pred             HhhhcCCCCCccCCCCCCCCCChhHHHHHHhh
Q psy12028         82 KKDECGQEPKFECPHCPYRSKRKDTLDRHMKI  113 (118)
Q Consensus        82 ~~~h~~~~~~~~C~~C~~~f~~~~~l~~H~~~  113 (118)
                      +++|.+ .++|+|..|+|+|+..+.|.+|...
T Consensus       235 mQTHS~-~K~~qC~~C~KsFsl~SyLnKH~ES  265 (279)
T KOG2462|consen  235 MQTHSD-VKKHQCPRCGKSFALKSYLNKHSES  265 (279)
T ss_pred             HHhhcC-CccccCcchhhHHHHHHHHHHhhhh
Confidence            999998 8899999999999999999999753


No 3  
>KOG1074|consensus
Probab=99.88  E-value=3.7e-24  Score=140.36  Aligned_cols=53  Identities=26%  Similarity=0.495  Sum_probs=50.1

Q ss_pred             ccccCchhhhhhchHHHHHHHhhhcCCCCCccCCCCCCCCCChhHHHHHHhhhc
Q psy12028         62 MYACDVCGKVYQHKQTLDRHKKDECGQEPKFECPHCPYRSKRKDTLDRHMKIIH  115 (118)
Q Consensus        62 ~~~c~~c~~~~~~~~~l~~h~~~h~~~~~~~~C~~C~~~f~~~~~l~~H~~~~~  115 (118)
                      |.+|.+|.++++=.+.|+.|.++|+| |+||+|.+||++|.++.+|+.|+-+|-
T Consensus       605 PNqCiiC~rVlSC~saLqmHyrtHtG-ERPFkCKiCgRAFtTkGNLkaH~~vHk  657 (958)
T KOG1074|consen  605 PNQCIICLRVLSCPSALQMHYRTHTG-ERPFKCKICGRAFTTKGNLKAHMSVHK  657 (958)
T ss_pred             ccceeeeeecccchhhhhhhhhcccC-cCccccccccchhccccchhhcccccc
Confidence            57899999999999999999999999 999999999999999999999997763


No 4  
>KOG3576|consensus
Probab=99.84  E-value=1.2e-21  Score=110.66  Aligned_cols=110  Identities=28%  Similarity=0.562  Sum_probs=99.3

Q ss_pred             ccCCCCCccccchHHHHhhhhhhcCCCCCccCCCCCcccccchHHHHHhhhhhccCCcccccccCchhhhhhchHHHHHH
Q psy12028          2 YACDVCGKEYQHKRTLYRHKKDECGQEPKFGCPQCPYRSRQKATLNRHLGWEQLQGNAHVMYACDVCGKVYQHKQTLDRH   81 (118)
Q Consensus         2 ~~C~~C~~~~~~~~~l~~h~~~~~~~~~~~~C~~c~~~f~~~~~l~~h~~~~~~~~~~~~~~~c~~c~~~~~~~~~l~~h   81 (118)
                      |.|.+|++.|.-+..|.+|++.|.. .+.+.|..||++|.....|++|++    .|++-+||.|..|+++|...-+|..|
T Consensus       118 ftCrvCgK~F~lQRmlnrh~kch~~-vkr~lct~cgkgfndtfdlkrh~r----thtgvrpykc~~c~kaftqrcslesh  192 (267)
T KOG3576|consen  118 FTCRVCGKKFGLQRMLNRHLKCHSD-VKRHLCTFCGKGFNDTFDLKRHTR----THTGVRPYKCSLCEKAFTQRCSLESH  192 (267)
T ss_pred             eeeehhhhhhhHHHHHHHHhhhccH-HHHHHHhhccCcccchhhhhhhhc----cccCccccchhhhhHHHHhhccHHHH
Confidence            7899999999999999999999987 778999999999999999999965    66677999999999999999999999


Q ss_pred             HhhhcCC----------CCCccCCCCCCCCCChhHHHHHHhhhcC
Q psy12028         82 KKDECGQ----------EPKFECPHCPYRSKRKDTLDRHMKIIHF  116 (118)
Q Consensus        82 ~~~h~~~----------~~~~~C~~C~~~f~~~~~l~~H~~~~~~  116 (118)
                      ...-+|.          ++.|.|..||++-.....+..|+..+|.
T Consensus       193 l~kvhgv~~~yaykerr~kl~vcedcg~t~~~~e~~~~h~~~~hp  237 (267)
T KOG3576|consen  193 LKKVHGVQHQYAYKERRAKLYVCEDCGYTSERPEVYYLHLKLHHP  237 (267)
T ss_pred             HHHHcCchHHHHHHHhhhheeeecccCCCCCChhHHHHHHHhcCC
Confidence            8766652          5679999999999999999999988874


No 5  
>KOG1074|consensus
Probab=99.82  E-value=8.1e-21  Score=124.95  Aligned_cols=53  Identities=26%  Similarity=0.563  Sum_probs=50.5

Q ss_pred             cccCchhhhhhchHHHHHHHhhhcCCCCCccCCCCCCCCCChhHHHHHHhhhcC
Q psy12028         63 YACDVCGKVYQHKQTLDRHKKDECGQEPKFECPHCPYRSKRKDTLDRHMKIIHF  116 (118)
Q Consensus        63 ~~c~~c~~~~~~~~~l~~h~~~h~~~~~~~~C~~C~~~f~~~~~l~~H~~~~~~  116 (118)
                      ..|.+|++.|..+++|+.|+++|+| ++||.|..|++.|..+.+|+.||.+|+.
T Consensus       880 h~C~vCgk~FsSSsALqiH~rTHtg-~KPF~C~fC~~aFttrgnLKvHMgtH~w  932 (958)
T KOG1074|consen  880 HVCNVCGKQFSSSAALEIHMRTHTG-PKPFFCHFCEEAFTTRGNLKVHMGTHMW  932 (958)
T ss_pred             hhhccchhcccchHHHHHhhhcCCC-CCCccchhhhhhhhhhhhhhhhhccccc
Confidence            4799999999999999999999999 9999999999999999999999998864


No 6  
>KOG3623|consensus
Probab=99.72  E-value=2e-18  Score=112.83  Aligned_cols=110  Identities=30%  Similarity=0.650  Sum_probs=94.6

Q ss_pred             ccCCCCCccccchHHHHhhhhh-hcCCCCCccCCCCCcccccchHHHHHhhhhhccC---------CcccccccCchhhh
Q psy12028          2 YACDVCGKEYQHKRTLYRHKKD-ECGQEPKFGCPQCPYRSRQKATLNRHLGWEQLQG---------NAHVMYACDVCGKV   71 (118)
Q Consensus         2 ~~C~~C~~~~~~~~~l~~h~~~-~~~~~~~~~C~~c~~~f~~~~~l~~h~~~~~~~~---------~~~~~~~c~~c~~~   71 (118)
                      ..|+.|...+.....|..|++- |...+.-|.|..|...|.....|.+||..|-...         ..-+.|+|.+|+++
T Consensus       211 ltcpycdrgykrltslkeHikyrhekne~nfsC~lCsytFAyRtQLErhm~~hkpg~dqa~sltqsa~lRKFKCtECgKA  290 (1007)
T KOG3623|consen  211 LTCPYCDRGYKRLTSLKEHIKYRHEKNEPNFSCMLCSYTFAYRTQLERHMQLHKPGGDQAISLTQSALLRKFKCTECGKA  290 (1007)
T ss_pred             hcchhHHHHHHHHHHHHHHHHHHHhhCCCCCcchhhhhhhhhHHHHHHHHHhhcCCCcccccccchhhhccccccccchh
Confidence            4699999999999999999874 4433566999999999999999999998553211         12467999999999


Q ss_pred             hhchHHHHHHHhhhcCCCCCccCCCCCCCCCChhHHHHHHh
Q psy12028         72 YQHKQTLDRHKKDECGQEPKFECPHCPYRSKRKDTLDRHMK  112 (118)
Q Consensus        72 ~~~~~~l~~h~~~h~~~~~~~~C~~C~~~f~~~~~l~~H~~  112 (118)
                      |...--|.-|+|+|.| ++||.|+-|+|+|+....+..||-
T Consensus       291 FKfKHHLKEHlRIHSG-EKPfeCpnCkKRFSHSGSySSHmS  330 (1007)
T KOG3623|consen  291 FKFKHHLKEHLRIHSG-EKPFECPNCKKRFSHSGSYSSHMS  330 (1007)
T ss_pred             hhhHHHHHhhheeecC-CCCcCCcccccccccCCccccccc
Confidence            9999999999999999 999999999999999999998874


No 7  
>KOG3608|consensus
Probab=99.72  E-value=5.1e-18  Score=103.09  Aligned_cols=108  Identities=19%  Similarity=0.465  Sum_probs=54.9

Q ss_pred             ccCCCCCccccchHHHHhhhhhhcCCCCCccCCCCCcccccchHHHHHhhhhhccCCcccccccCchhhhhhchHHHHHH
Q psy12028          2 YACDVCGKEYQHKRTLYRHKKDECGQEPKFGCPQCPYRSRQKATLNRHLGWEQLQGNAHVMYACDVCGKVYQHKQTLDRH   81 (118)
Q Consensus         2 ~~C~~C~~~~~~~~~l~~h~~~~~~~~~~~~C~~c~~~f~~~~~l~~h~~~~~~~~~~~~~~~c~~c~~~~~~~~~l~~h   81 (118)
                      |.|..|.|.|.+...|..|+..|.   .-|.||.|..+....++|..||++.   |..++||+|..|+..+.+.+.|.+|
T Consensus       238 fqC~~C~KrFaTeklL~~Hv~rHv---n~ykCplCdmtc~~~ssL~~H~r~r---Hs~dkpfKCd~Cd~~c~~esdL~kH  311 (467)
T KOG3608|consen  238 FQCAQCFKRFATEKLLKSHVVRHV---NCYKCPLCDMTCSSASSLTTHIRYR---HSKDKPFKCDECDTRCVRESDLAKH  311 (467)
T ss_pred             hHHHHHHHHHhHHHHHHHHHHHhh---hcccccccccCCCChHHHHHHHHhh---hccCCCccccchhhhhccHHHHHHH
Confidence            445555555555555555555442   2455555555555555555555322   2234555555555555555555555


Q ss_pred             Hhhhc------------------------------C-CCCCccCCCCCCCCCChhHHHHHHhhhc
Q psy12028         82 KKDEC------------------------------G-QEPKFECPHCPYRSKRKDTLDRHMKIIH  115 (118)
Q Consensus        82 ~~~h~------------------------------~-~~~~~~C~~C~~~f~~~~~l~~H~~~~~  115 (118)
                      ...|.                              | ...+|.|..|.+.|.+-.+|.+|+...|
T Consensus       312 ~~~HS~~~y~C~h~~C~~s~r~~~q~~~H~~evhEg~np~~Y~CH~Cdr~ft~G~~L~~HL~kkH  376 (467)
T KOG3608|consen  312 VQVHSKTVYQCEHPDCHYSVRTYTQMRRHFLEVHEGNNPILYACHCCDRFFTSGKSLSAHLMKKH  376 (467)
T ss_pred             HHhccccceecCCCCCcHHHHHHHHHHHHHHHhccCCCCCceeeecchhhhccchhHHHHHHHhh
Confidence            44442                              1 1334566666666666666666655444


No 8  
>KOG3576|consensus
Probab=99.70  E-value=1.9e-18  Score=97.87  Aligned_cols=85  Identities=26%  Similarity=0.512  Sum_probs=76.1

Q ss_pred             CCCccCCCCCcccccchHHHHHhhhhhccCCcccccccCchhhhhhchHHHHHHHhhhcCCCCCccCCCCCCCCCChhHH
Q psy12028         28 EPKFGCPQCPYRSRQKATLNRHLGWEQLQGNAHVMYACDVCGKVYQHKQTLDRHKKDECGQEPKFECPHCPYRSKRKDTL  107 (118)
Q Consensus        28 ~~~~~C~~c~~~f~~~~~l~~h~~~~~~~~~~~~~~~c~~c~~~~~~~~~l~~h~~~h~~~~~~~~C~~C~~~f~~~~~l  107 (118)
                      ...|.|.+|++.|.-..-|.+||+-    |..-+.+-|..||+.|.+.-.|.+|+++|+| .+||+|..|+++|.++-.|
T Consensus       115 ~d~ftCrvCgK~F~lQRmlnrh~kc----h~~vkr~lct~cgkgfndtfdlkrh~rthtg-vrpykc~~c~kaftqrcsl  189 (267)
T KOG3576|consen  115 QDSFTCRVCGKKFGLQRMLNRHLKC----HSDVKRHLCTFCGKGFNDTFDLKRHTRTHTG-VRPYKCSLCEKAFTQRCSL  189 (267)
T ss_pred             CCeeeeehhhhhhhHHHHHHHHhhh----ccHHHHHHHhhccCcccchhhhhhhhccccC-ccccchhhhhHHHHhhccH
Confidence            3459999999999999989999753    3344678999999999999999999999999 9999999999999999999


Q ss_pred             HHHHhhhcCC
Q psy12028        108 DRHMKIIHFS  117 (118)
Q Consensus       108 ~~H~~~~~~~  117 (118)
                      ..|++..||.
T Consensus       190 eshl~kvhgv  199 (267)
T KOG3576|consen  190 ESHLKKVHGV  199 (267)
T ss_pred             HHHHHHHcCc
Confidence            9999888864


No 9  
>KOG3608|consensus
Probab=99.69  E-value=3.2e-17  Score=99.67  Aligned_cols=108  Identities=24%  Similarity=0.479  Sum_probs=73.4

Q ss_pred             CCCCCccccchHHHHhhhhhhcCCCCCccCCCCCcccccchHHHHHhhhhhccCCcccc---------------------
Q psy12028          4 CDVCGKEYQHKRTLYRHKKDECGQEPKFGCPQCPYRSRQKATLNRHLGWEQLQGNAHVM---------------------   62 (118)
Q Consensus         4 C~~C~~~~~~~~~l~~h~~~~~~~~~~~~C~~c~~~f~~~~~l~~h~~~~~~~~~~~~~---------------------   62 (118)
                      +..|-+.+.++..|..|++.|++ ++...||.||..|.+...|.-|++.....  ...+                     
T Consensus       182 W~~Ct~~~~~k~~LreH~r~Hs~-eKvvACp~Cg~~F~~~tkl~DH~rRqt~l--~~n~fqC~~C~KrFaTeklL~~Hv~  258 (467)
T KOG3608|consen  182 WAMCTKHMGNKYRLREHIRTHSN-EKVVACPHCGELFRTKTKLFDHLRRQTEL--NTNSFQCAQCFKRFATEKLLKSHVV  258 (467)
T ss_pred             chhhhhhhccHHHHHHHHHhcCC-CeEEecchHHHHhccccHHHHHHHhhhhh--cCCchHHHHHHHHHhHHHHHHHHHH
Confidence            45688889999999999999987 88889999999999998888887633221  1223                     


Q ss_pred             -----cccCchhhhhhchHHHHHHHhhhcCCCCCccCCCCCCCCCChhHHHHHHhhh
Q psy12028         63 -----YACDVCGKVYQHKQTLDRHKKDECGQEPKFECPHCPYRSKRKDTLDRHMKII  114 (118)
Q Consensus        63 -----~~c~~c~~~~~~~~~l~~h~~~h~~~~~~~~C~~C~~~f~~~~~l~~H~~~~  114 (118)
                           |+|+.|+.....+++|..|++..+...+||+|..|.+.|.+.++|.+|..+|
T Consensus       259 rHvn~ykCplCdmtc~~~ssL~~H~r~rHs~dkpfKCd~Cd~~c~~esdL~kH~~~H  315 (467)
T KOG3608|consen  259 RHVNCYKCPLCDMTCSSASSLTTHIRYRHSKDKPFKCDECDTRCVRESDLAKHVQVH  315 (467)
T ss_pred             HhhhcccccccccCCCChHHHHHHHHhhhccCCCccccchhhhhccHHHHHHHHHhc
Confidence                 4555555555555555555554444456666666666666666666666544


No 10 
>KOG3623|consensus
Probab=99.66  E-value=1.8e-17  Score=108.48  Aligned_cols=80  Identities=29%  Similarity=0.670  Sum_probs=69.0

Q ss_pred             CCCccCCCCCcccccchHHHHHhhhhhccCCcccccccCchhhhhhchHHHHHHHhhhcCCCCCccCCCCCCCCCChhHH
Q psy12028         28 EPKFGCPQCPYRSRQKATLNRHLGWEQLQGNAHVMYACDVCGKVYQHKQTLDRHKKDECGQEPKFECPHCPYRSKRKDTL  107 (118)
Q Consensus        28 ~~~~~C~~c~~~f~~~~~l~~h~~~~~~~~~~~~~~~c~~c~~~~~~~~~l~~h~~~h~~~~~~~~C~~C~~~f~~~~~l  107 (118)
                      +.+|.|..|++.|...+.|.+|    -=.|.+.+||.|.+|.++|...--|.-|+|.|.| ++||+|..|+|+|+....+
T Consensus       892 ~gmyaCDqCDK~FqKqSSLaRH----KYEHsGqRPyqC~iCkKAFKHKHHLtEHkRLHSG-EKPfQCdKClKRFSHSGSY  966 (1007)
T KOG3623|consen  892 DGMYACDQCDKAFQKQSSLARH----KYEHSGQRPYQCIICKKAFKHKHHLTEHKRLHSG-EKPFQCDKCLKRFSHSGSY  966 (1007)
T ss_pred             cccchHHHHHHHHHhhHHHHHh----hhhhcCCCCcccchhhHhhhhhhhhhhhhhhccC-CCcchhhhhhhhcccccch
Confidence            4568999999999888888888    3467788899999999999998888899999988 9999999999999998888


Q ss_pred             HHHHh
Q psy12028        108 DRHMK  112 (118)
Q Consensus       108 ~~H~~  112 (118)
                      ..||.
T Consensus       967 SQHMN  971 (1007)
T KOG3623|consen  967 SQHMN  971 (1007)
T ss_pred             Hhhhc
Confidence            88874


No 11 
>PHA00733 hypothetical protein
Probab=99.50  E-value=2.6e-14  Score=77.41  Aligned_cols=85  Identities=18%  Similarity=0.203  Sum_probs=70.5

Q ss_pred             CCCccCCCCCcccccchHHHHH--hhhhhccCCcccccccCchhhhhhchHHHHHHHhhhcCCCCCccCCCCCCCCCChh
Q psy12028         28 EPKFGCPQCPYRSRQKATLNRH--LGWEQLQGNAHVMYACDVCGKVYQHKQTLDRHKKDECGQEPKFECPHCPYRSKRKD  105 (118)
Q Consensus        28 ~~~~~C~~c~~~f~~~~~l~~h--~~~~~~~~~~~~~~~c~~c~~~~~~~~~l~~h~~~h~~~~~~~~C~~C~~~f~~~~  105 (118)
                      .+++.|.+|...|.....|..+  +..+. ...+.+||.|+.|++.|.....|..|++.+   +.+|.|..|++.|....
T Consensus        38 ~~~~~~~~~~~~~~~~~~l~~~~~l~~~~-~~~~~kPy~C~~Cgk~Fss~s~L~~H~r~h---~~~~~C~~CgK~F~~~~  113 (128)
T PHA00733         38 QKRLIRAVVKTLIYNPQLLDESSYLYKLL-TSKAVSPYVCPLCLMPFSSSVSLKQHIRYT---EHSKVCPVCGKEFRNTD  113 (128)
T ss_pred             hhhHHHHHHhhhccChhhhcchHHHHhhc-ccCCCCCccCCCCCCcCCCHHHHHHHHhcC---CcCccCCCCCCccCCHH
Confidence            4679999999999888777666  32222 334478999999999999999999999876   34799999999999999


Q ss_pred             HHHHHHhhhcC
Q psy12028        106 TLDRHMKIIHF  116 (118)
Q Consensus       106 ~l~~H~~~~~~  116 (118)
                      .|..|+...|+
T Consensus       114 sL~~H~~~~h~  124 (128)
T PHA00733        114 STLDHVCKKHN  124 (128)
T ss_pred             HHHHHHHHhcC
Confidence            99999988875


No 12 
>PLN03086 PRLI-interacting factor K; Provisional
Probab=99.43  E-value=5.7e-13  Score=86.85  Aligned_cols=102  Identities=22%  Similarity=0.460  Sum_probs=81.8

Q ss_pred             ccCCCCCccccchHHHHhhhhhhcCCCCCccCCCCCcccccchHHHHHhhhhhccCCcccccccCchhhhhh--------
Q psy12028          2 YACDVCGKEYQHKRTLYRHKKDECGQEPKFGCPQCPYRSRQKATLNRHLGWEQLQGNAHVMYACDVCGKVYQ--------   73 (118)
Q Consensus         2 ~~C~~C~~~~~~~~~l~~h~~~~~~~~~~~~C~~c~~~f~~~~~l~~h~~~~~~~~~~~~~~~c~~c~~~~~--------   73 (118)
                      +.|+.|++.|. ...|..|+..++   .++.|+ |+..+ ....|..|+.    .+...+++.|+.|+..+.        
T Consensus       454 ~~C~~Cgk~f~-~s~LekH~~~~H---kpv~Cp-Cg~~~-~R~~L~~H~~----thCp~Kpi~C~fC~~~v~~g~~~~d~  523 (567)
T PLN03086        454 VHCEKCGQAFQ-QGEMEKHMKVFH---EPLQCP-CGVVL-EKEQMVQHQA----STCPLRLITCRFCGDMVQAGGSAMDV  523 (567)
T ss_pred             ccCCCCCCccc-hHHHHHHHHhcC---CCccCC-CCCCc-chhHHHhhhh----ccCCCCceeCCCCCCccccCccccch
Confidence            57999999996 678999999875   589999 99755 5678888854    445668999999999885        


Q ss_pred             --chHHHHHHHhhhcCCCCCccCCCCCCCCCChhHHHHHHhhhcC
Q psy12028         74 --HKQTLDRHKKDECGQEPKFECPHCPYRSKRKDTLDRHMKIIHF  116 (118)
Q Consensus        74 --~~~~l~~h~~~h~~~~~~~~C~~C~~~f~~~~~l~~H~~~~~~  116 (118)
                        ....|..|.... | .+++.|..||+.+. ...|..|+...|.
T Consensus       524 ~d~~s~Lt~HE~~C-G-~rt~~C~~Cgk~Vr-lrdm~~H~~~~h~  565 (567)
T PLN03086        524 RDRLRGMSEHESIC-G-SRTAPCDSCGRSVM-LKEMDIHQIAVHQ  565 (567)
T ss_pred             hhhhhhHHHHHHhc-C-CcceEccccCCeee-ehhHHHHHHHhhc
Confidence              235788998885 6 89999999998875 5567889887764


No 13 
>PHA02768 hypothetical protein; Provisional
Probab=99.29  E-value=1.2e-12  Score=59.79  Aligned_cols=44  Identities=20%  Similarity=0.526  Sum_probs=38.4

Q ss_pred             ccccCchhhhhhchHHHHHHHhhhcCCCCCccCCCCCCCCCChhHHH
Q psy12028         62 MYACDVCGKVYQHKQTLDRHKKDECGQEPKFECPHCPYRSKRKDTLD  108 (118)
Q Consensus        62 ~~~c~~c~~~~~~~~~l~~h~~~h~~~~~~~~C~~C~~~f~~~~~l~  108 (118)
                      .|.|+.||+.|...+.|..|+++|+   ++++|..|++.|.+.+.|.
T Consensus         5 ~y~C~~CGK~Fs~~~~L~~H~r~H~---k~~kc~~C~k~f~~~s~l~   48 (55)
T PHA02768          5 GYECPICGEIYIKRKSMITHLRKHN---TNLKLSNCKRISLRTGEYI   48 (55)
T ss_pred             ccCcchhCCeeccHHHHHHHHHhcC---CcccCCcccceecccceeE
Confidence            3789999999999999999999986   5889999999998877664


No 14 
>PHA00733 hypothetical protein
Probab=99.29  E-value=2.9e-12  Score=69.51  Aligned_cols=80  Identities=16%  Similarity=0.270  Sum_probs=62.8

Q ss_pred             ccCCCCCccccchHHHHhh--hh--hhcCCCCCccCCCCCcccccchHHHHHhhhhhccCCcccccccCchhhhhhchHH
Q psy12028          2 YACDVCGKEYQHKRTLYRH--KK--DECGQEPKFGCPQCPYRSRQKATLNRHLGWEQLQGNAHVMYACDVCGKVYQHKQT   77 (118)
Q Consensus         2 ~~C~~C~~~~~~~~~l~~h--~~--~~~~~~~~~~C~~c~~~f~~~~~l~~h~~~~~~~~~~~~~~~c~~c~~~~~~~~~   77 (118)
                      +.|.+|.+.|.....|..+  ..  ..+...++|.|+.|++.|.....|..|++.+      +.++.|+.|++.|.....
T Consensus        41 ~~~~~~~~~~~~~~~l~~~~~l~~~~~~~~~kPy~C~~Cgk~Fss~s~L~~H~r~h------~~~~~C~~CgK~F~~~~s  114 (128)
T PHA00733         41 LIRAVVKTLIYNPQLLDESSYLYKLLTSKAVSPYVCPLCLMPFSSSVSLKQHIRYT------EHSKVCPVCGKEFRNTDS  114 (128)
T ss_pred             HHHHHHhhhccChhhhcchHHHHhhcccCCCCCccCCCCCCcCCCHHHHHHHHhcC------CcCccCCCCCCccCCHHH
Confidence            4677888888877766665  11  1222368999999999999999999997532      246899999999999999


Q ss_pred             HHHHHhhhcC
Q psy12028         78 LDRHKKDECG   87 (118)
Q Consensus        78 l~~h~~~h~~   87 (118)
                      |..|+...++
T Consensus       115 L~~H~~~~h~  124 (128)
T PHA00733        115 TLDHVCKKHN  124 (128)
T ss_pred             HHHHHHHhcC
Confidence            9999887765


No 15 
>PHA02768 hypothetical protein; Provisional
Probab=99.24  E-value=4.8e-12  Score=57.81  Aligned_cols=42  Identities=19%  Similarity=0.551  Sum_probs=32.7

Q ss_pred             ccCCCCCccccchHHHHhhhhhhcCCCCCccCCCCCcccccchHH
Q psy12028          2 YACDVCGKEYQHKRTLYRHKKDECGQEPKFGCPQCPYRSRQKATL   46 (118)
Q Consensus         2 ~~C~~C~~~~~~~~~l~~h~~~~~~~~~~~~C~~c~~~f~~~~~l   46 (118)
                      |+|+.||+.|.....|..|+++|+   +++.|..|++.|...+.|
T Consensus         6 y~C~~CGK~Fs~~~~L~~H~r~H~---k~~kc~~C~k~f~~~s~l   47 (55)
T PHA02768          6 YECPICGEIYIKRKSMITHLRKHN---TNLKLSNCKRISLRTGEY   47 (55)
T ss_pred             cCcchhCCeeccHHHHHHHHHhcC---CcccCCcccceeccccee
Confidence            678888888888888888888876   467888888887765543


No 16 
>KOG3993|consensus
Probab=99.20  E-value=4e-12  Score=79.38  Aligned_cols=52  Identities=25%  Similarity=0.616  Sum_probs=42.5

Q ss_pred             ccCCCCCccccchHHHHhhhhhhcCCCCCccCCCCCcccccchHHHHHhhhhh
Q psy12028          2 YACDVCGKEYQHKRTLYRHKKDECGQEPKFGCPQCPYRSRQKATLNRHLGWEQ   54 (118)
Q Consensus         2 ~~C~~C~~~~~~~~~l~~h~~~~~~~~~~~~C~~c~~~f~~~~~l~~h~~~~~   54 (118)
                      |.|..|...|.+.-.|..|+...+- ...|.|++|++.|+...+|..|.+||-
T Consensus       268 yiCqLCK~kYeD~F~LAQHrC~RIV-~vEYrCPEC~KVFsCPANLASHRRWHK  319 (500)
T KOG3993|consen  268 YICQLCKEKYEDAFALAQHRCPRIV-HVEYRCPECDKVFSCPANLASHRRWHK  319 (500)
T ss_pred             HHHHHHHHhhhhHHHHhhccCCeeE-EeeecCCcccccccCchhhhhhhcccC
Confidence            6788899999999999998765443 445999999999999999999988663


No 17 
>PF13465 zf-H2C2_2:  Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A ....
Probab=99.11  E-value=2.8e-11  Score=47.70  Aligned_cols=26  Identities=31%  Similarity=0.686  Sum_probs=23.3

Q ss_pred             HHHHHHhhhcCCCCCccCCCCCCCCCC
Q psy12028         77 TLDRHKKDECGQEPKFECPHCPYRSKR  103 (118)
Q Consensus        77 ~l~~h~~~h~~~~~~~~C~~C~~~f~~  103 (118)
                      +|..|+++|+| ++||.|+.|+++|.+
T Consensus         1 ~l~~H~~~H~~-~k~~~C~~C~k~F~~   26 (26)
T PF13465_consen    1 NLRRHMRTHTG-EKPYKCPYCGKSFSN   26 (26)
T ss_dssp             HHHHHHHHHSS-SSSEEESSSSEEESS
T ss_pred             CHHHHhhhcCC-CCCCCCCCCcCeeCc
Confidence            47899999999 999999999999864


No 18 
>PLN03086 PRLI-interacting factor K; Provisional
Probab=99.06  E-value=5.2e-10  Score=73.40  Aligned_cols=77  Identities=19%  Similarity=0.446  Sum_probs=61.8

Q ss_pred             CCCccCCCCCcccccchHHHHHhhhhhccCCcccccccCchhhhhhchHHHHHHHhhhcCCCCCccCCCCCCCCC-----
Q psy12028         28 EPKFGCPQCPYRSRQKATLNRHLGWEQLQGNAHVMYACDVCGKVYQHKQTLDRHKKDECGQEPKFECPHCPYRSK-----  102 (118)
Q Consensus        28 ~~~~~C~~c~~~f~~~~~l~~h~~~~~~~~~~~~~~~c~~c~~~~~~~~~l~~h~~~h~~~~~~~~C~~C~~~f~-----  102 (118)
                      ++.+.|+.|++.|. ...|..|+..++      +++.|+ |+..+ ....|..|+..|.+ .+++.|..|++.+.     
T Consensus       451 ~~H~~C~~Cgk~f~-~s~LekH~~~~H------kpv~Cp-Cg~~~-~R~~L~~H~~thCp-~Kpi~C~fC~~~v~~g~~~  520 (567)
T PLN03086        451 KNHVHCEKCGQAFQ-QGEMEKHMKVFH------EPLQCP-CGVVL-EKEQMVQHQASTCP-LRLITCRFCGDMVQAGGSA  520 (567)
T ss_pred             ccCccCCCCCCccc-hHHHHHHHHhcC------CCccCC-CCCCc-chhHHHhhhhccCC-CCceeCCCCCCccccCccc
Confidence            34578999999996 577899975432      679999 99765 56889999999998 99999999999885     


Q ss_pred             -----ChhHHHHHHhhh
Q psy12028        103 -----RKDTLDRHMKII  114 (118)
Q Consensus       103 -----~~~~l~~H~~~~  114 (118)
                           ..+.|..|..+.
T Consensus       521 ~d~~d~~s~Lt~HE~~C  537 (567)
T PLN03086        521 MDVRDRLRGMSEHESIC  537 (567)
T ss_pred             cchhhhhhhHHHHHHhc
Confidence                 245788898764


No 19 
>KOG3993|consensus
Probab=99.06  E-value=2.1e-11  Score=76.20  Aligned_cols=82  Identities=23%  Similarity=0.434  Sum_probs=69.3

Q ss_pred             ccCCCCCcccccchHHHHHhhhhhccCCcccccccCchhhhhhchHHHHHHHhhhcCC----------------------
Q psy12028         31 FGCPQCPYRSRQKATLNRHLGWEQLQGNAHVMYACDVCGKVYQHKQTLDRHKKDECGQ----------------------   88 (118)
Q Consensus        31 ~~C~~c~~~f~~~~~l~~h~~~~~~~~~~~~~~~c~~c~~~~~~~~~l~~h~~~h~~~----------------------   88 (118)
                      |.|..|...|.....|.+|.   + .......|.|++|+++|+=+.+|..|.+.|...                      
T Consensus       268 yiCqLCK~kYeD~F~LAQHr---C-~RIV~vEYrCPEC~KVFsCPANLASHRRWHKPR~eaa~a~~~P~k~~~~~rae~~  343 (500)
T KOG3993|consen  268 YICQLCKEKYEDAFALAQHR---C-PRIVHVEYRCPECDKVFSCPANLASHRRWHKPRPEAAKAGSPPPKQAVETRAEVQ  343 (500)
T ss_pred             HHHHHHHHhhhhHHHHhhcc---C-CeeEEeeecCCcccccccCchhhhhhhcccCCchhhhhcCCCChhhhhhhhhhhh
Confidence            99999999999999999994   2 333445699999999999999999999988531                      


Q ss_pred             ----------CCCccCCCCCCCCCChhHHHHHHhhhcC
Q psy12028         89 ----------EPKFECPHCPYRSKRKDTLDRHMKIIHF  116 (118)
Q Consensus        89 ----------~~~~~C~~C~~~f~~~~~l~~H~~~~~~  116 (118)
                                +..|.|..|+|.|.+...|+.|+-+|+.
T Consensus       344 ea~rsg~dss~gi~~C~~C~KkFrRqAYLrKHqlthq~  381 (500)
T KOG3993|consen  344 EAERSGDDSSSGIFSCHTCGKKFRRQAYLRKHQLTHQR  381 (500)
T ss_pred             hccccCCcccCceeecHHhhhhhHHHHHHHHhHHhhhc
Confidence                      1248999999999999999999888864


No 20 
>PHA00616 hypothetical protein
Probab=98.98  E-value=1.9e-10  Score=50.22  Aligned_cols=33  Identities=24%  Similarity=0.502  Sum_probs=23.5

Q ss_pred             ccccCchhhhhhchHHHHHHHhhhcCCCCCccCC
Q psy12028         62 MYACDVCGKVYQHKQTLDRHKKDECGQEPKFECP   95 (118)
Q Consensus        62 ~~~c~~c~~~~~~~~~l~~h~~~h~~~~~~~~C~   95 (118)
                      ||+|+.||..|...+.+..|++.|+| +.++.|+
T Consensus         1 pYqC~~CG~~F~~~s~l~~H~r~~hg-~~~~~~~   33 (44)
T PHA00616          1 MYQCLRCGGIFRKKKEVIEHLLSVHK-QNKLTLE   33 (44)
T ss_pred             CCccchhhHHHhhHHHHHHHHHHhcC-CCcccee
Confidence            46777777777777777777777777 6776664


No 21 
>PF13465 zf-H2C2_2:  Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A ....
Probab=98.93  E-value=6.4e-10  Score=43.77  Aligned_cols=26  Identities=31%  Similarity=0.645  Sum_probs=22.3

Q ss_pred             HHHhhhhhhcCCCCCccCCCCCccccc
Q psy12028         16 TLYRHKKDECGQEPKFGCPQCPYRSRQ   42 (118)
Q Consensus        16 ~l~~h~~~~~~~~~~~~C~~c~~~f~~   42 (118)
                      +|..|+++|++ ++||.|+.|++.|.+
T Consensus         1 ~l~~H~~~H~~-~k~~~C~~C~k~F~~   26 (26)
T PF13465_consen    1 NLRRHMRTHTG-EKPYKCPYCGKSFSN   26 (26)
T ss_dssp             HHHHHHHHHSS-SSSEEESSSSEEESS
T ss_pred             CHHHHhhhcCC-CCCCCCCCCcCeeCc
Confidence            47889999987 889999999998863


No 22 
>PHA00616 hypothetical protein
Probab=98.92  E-value=5.5e-10  Score=48.76  Aligned_cols=34  Identities=24%  Similarity=0.446  Sum_probs=29.7

Q ss_pred             CccCCCCCccccchHHHHhhhhhhcCCCCCccCCC
Q psy12028          1 MYACDVCGKEYQHKRTLYRHKKDECGQEPKFGCPQ   35 (118)
Q Consensus         1 ~~~C~~C~~~~~~~~~l~~h~~~~~~~~~~~~C~~   35 (118)
                      ||+|..||+.|....+|..|++.+++ ++++.|+.
T Consensus         1 pYqC~~CG~~F~~~s~l~~H~r~~hg-~~~~~~~~   34 (44)
T PHA00616          1 MYQCLRCGGIFRKKKEVIEHLLSVHK-QNKLTLEY   34 (44)
T ss_pred             CCccchhhHHHhhHHHHHHHHHHhcC-CCccceeE
Confidence            78999999999999999999999998 67777764


No 23 
>PHA00732 hypothetical protein
Probab=98.86  E-value=2.8e-09  Score=53.03  Aligned_cols=45  Identities=29%  Similarity=0.560  Sum_probs=36.0

Q ss_pred             CccCCCCCccccchHHHHhhhhhhcCCCCCccCCCCCcccccchHHHHHhh
Q psy12028          1 MYACDVCGKEYQHKRTLYRHKKDECGQEPKFGCPQCPYRSRQKATLNRHLG   51 (118)
Q Consensus         1 ~~~C~~C~~~~~~~~~l~~h~~~~~~~~~~~~C~~c~~~f~~~~~l~~h~~   51 (118)
                      ||+|..|++.|.+...|..|++.++.   ++.|+.|++.|.   .+..|+.
T Consensus         1 py~C~~Cgk~F~s~s~Lk~H~r~~H~---~~~C~~CgKsF~---~l~~H~~   45 (79)
T PHA00732          1 MFKCPICGFTTVTLFALKQHARRNHT---LTKCPVCNKSYR---RLNQHFY   45 (79)
T ss_pred             CccCCCCCCccCCHHHHHHHhhcccC---CCccCCCCCEeC---Chhhhhc
Confidence            78999999999999999999885322   358999999997   3666753


No 24 
>PHA00732 hypothetical protein
Probab=98.83  E-value=2.2e-09  Score=53.37  Aligned_cols=48  Identities=27%  Similarity=0.621  Sum_probs=27.5

Q ss_pred             CccCCCCCcccccchHHHHHhhhhhccCCcccccccCchhhhhhchHHHHHHHhhhc
Q psy12028         30 KFGCPQCPYRSRQKATLNRHLGWEQLQGNAHVMYACDVCGKVYQHKQTLDRHKKDEC   86 (118)
Q Consensus        30 ~~~C~~c~~~f~~~~~l~~h~~~~~~~~~~~~~~~c~~c~~~~~~~~~l~~h~~~h~   86 (118)
                      ||.|+.|++.|.+...|..|++.+   +.   ++.|+.|++.|.+   +..|..+..
T Consensus         1 py~C~~Cgk~F~s~s~Lk~H~r~~---H~---~~~C~~CgKsF~~---l~~H~~~~~   48 (79)
T PHA00732          1 MFKCPICGFTTVTLFALKQHARRN---HT---LTKCPVCNKSYRR---LNQHFYSQY   48 (79)
T ss_pred             CccCCCCCCccCCHHHHHHHhhcc---cC---CCccCCCCCEeCC---hhhhhcccC
Confidence            366777777777777777665421   11   2466677766653   455554443


No 25 
>PF05605 zf-Di19:  Drought induced 19 protein (Di19), zinc-binding;  InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins. Di19 has been found to be strongly expressed in both the roots and leaves of Arabidopsis thaliana during progressive drought [], whilst RING finger proteins are thought to play a role in spermatogenesis. The precise function is unknown.
Probab=98.76  E-value=1.5e-08  Score=46.94  Aligned_cols=51  Identities=33%  Similarity=0.627  Sum_probs=31.5

Q ss_pred             cccCchhhhhhchHHHHHHHhhhc-CCCCCccCCCCCCCCCChhHHHHHHhhhcC
Q psy12028         63 YACDVCGKVYQHKQTLDRHKKDEC-GQEPKFECPHCPYRSKRKDTLDRHMKIIHF  116 (118)
Q Consensus        63 ~~c~~c~~~~~~~~~l~~h~~~h~-~~~~~~~C~~C~~~f~~~~~l~~H~~~~~~  116 (118)
                      |.||+|++ ..+...|..|....+ .+.+.+.|++|...+.  .+|..|+...|+
T Consensus         3 f~CP~C~~-~~~~~~L~~H~~~~H~~~~~~v~CPiC~~~~~--~~l~~Hl~~~H~   54 (54)
T PF05605_consen    3 FTCPYCGK-GFSESSLVEHCEDEHRSESKNVVCPICSSRVT--DNLIRHLNSQHR   54 (54)
T ss_pred             cCCCCCCC-ccCHHHHHHHHHhHCcCCCCCccCCCchhhhh--hHHHHHHHHhcC
Confidence            66777777 445566677755433 3234677777776543  377777776664


No 26 
>PF05605 zf-Di19:  Drought induced 19 protein (Di19), zinc-binding;  InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins. Di19 has been found to be strongly expressed in both the roots and leaves of Arabidopsis thaliana during progressive drought [], whilst RING finger proteins are thought to play a role in spermatogenesis. The precise function is unknown.
Probab=98.60  E-value=1.2e-07  Score=43.93  Aligned_cols=46  Identities=35%  Similarity=0.665  Sum_probs=23.5

Q ss_pred             ccCCCCCccccchHHHHhhhhhhcC-CCCCccCCCCCcccccchHHHHHh
Q psy12028          2 YACDVCGKEYQHKRTLYRHKKDECG-QEPKFGCPQCPYRSRQKATLNRHL   50 (118)
Q Consensus         2 ~~C~~C~~~~~~~~~l~~h~~~~~~-~~~~~~C~~c~~~f~~~~~l~~h~   50 (118)
                      |.|+.|++ ..+...|..|....+. +.+.+.||+|...+.  .+|..|+
T Consensus         3 f~CP~C~~-~~~~~~L~~H~~~~H~~~~~~v~CPiC~~~~~--~~l~~Hl   49 (54)
T PF05605_consen    3 FTCPYCGK-GFSESSLVEHCEDEHRSESKNVVCPICSSRVT--DNLIRHL   49 (54)
T ss_pred             cCCCCCCC-ccCHHHHHHHHHhHCcCCCCCccCCCchhhhh--hHHHHHH
Confidence            55666666 3445556666444332 224456666655433  2455554


No 27 
>PF00096 zf-C2H2:  Zinc finger, C2H2 type;  InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger: #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C], where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter []. This entry represents the classical C2H2 zinc finger domain.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0005622 intracellular; PDB: 2D9H_A 2EPC_A 1SP1_A 1VA3_A 2WBT_B 2ELR_A 2YTP_A 2YTT_A 1VA1_A 2ELO_A ....
Probab=98.58  E-value=2.5e-08  Score=38.05  Aligned_cols=22  Identities=36%  Similarity=0.786  Sum_probs=17.6

Q ss_pred             ccCCCCCCCCCChhHHHHHHhh
Q psy12028         92 FECPHCPYRSKRKDTLDRHMKI  113 (118)
Q Consensus        92 ~~C~~C~~~f~~~~~l~~H~~~  113 (118)
                      |.|+.|++.|.+.+.|..|++.
T Consensus         1 y~C~~C~~~f~~~~~l~~H~~~   22 (23)
T PF00096_consen    1 YKCPICGKSFSSKSNLKRHMRR   22 (23)
T ss_dssp             EEETTTTEEESSHHHHHHHHHH
T ss_pred             CCCCCCCCccCCHHHHHHHHhH
Confidence            5688888888888888888776


No 28 
>PF13894 zf-C2H2_4:  C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A ....
Probab=98.53  E-value=6.3e-08  Score=37.13  Aligned_cols=24  Identities=38%  Similarity=0.804  Sum_probs=18.8

Q ss_pred             ccCCCCCCCCCChhHHHHHHhhhc
Q psy12028         92 FECPHCPYRSKRKDTLDRHMKIIH  115 (118)
Q Consensus        92 ~~C~~C~~~f~~~~~l~~H~~~~~  115 (118)
                      |.|++|++.|.+...|..|+.++|
T Consensus         1 ~~C~~C~~~~~~~~~l~~H~~~~H   24 (24)
T PF13894_consen    1 FQCPICGKSFRSKSELRQHMRTHH   24 (24)
T ss_dssp             EE-SSTS-EESSHHHHHHHHHHHS
T ss_pred             CCCcCCCCcCCcHHHHHHHHHhhC
Confidence            678889999999999999988775


No 29 
>PF00096 zf-C2H2:  Zinc finger, C2H2 type;  InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger: #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C], where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter []. This entry represents the classical C2H2 zinc finger domain.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0005622 intracellular; PDB: 2D9H_A 2EPC_A 1SP1_A 1VA3_A 2WBT_B 2ELR_A 2YTP_A 2YTT_A 1VA1_A 2ELO_A ....
Probab=98.46  E-value=7.3e-08  Score=36.70  Aligned_cols=22  Identities=41%  Similarity=0.984  Sum_probs=14.4

Q ss_pred             ccCCCCCccccchHHHHhhhhh
Q psy12028          2 YACDVCGKEYQHKRTLYRHKKD   23 (118)
Q Consensus         2 ~~C~~C~~~~~~~~~l~~h~~~   23 (118)
                      |+|+.|++.|.+...|..|++.
T Consensus         1 y~C~~C~~~f~~~~~l~~H~~~   22 (23)
T PF00096_consen    1 YKCPICGKSFSSKSNLKRHMRR   22 (23)
T ss_dssp             EEETTTTEEESSHHHHHHHHHH
T ss_pred             CCCCCCCCccCCHHHHHHHHhH
Confidence            4566666666666666666654


No 30 
>PF13912 zf-C2H2_6:  C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B.
Probab=98.40  E-value=1.2e-07  Score=37.50  Aligned_cols=26  Identities=23%  Similarity=0.363  Sum_probs=20.5

Q ss_pred             CccCCCCCCCCCChhHHHHHHhhhcC
Q psy12028         91 KFECPHCPYRSKRKDTLDRHMKIIHF  116 (118)
Q Consensus        91 ~~~C~~C~~~f~~~~~l~~H~~~~~~  116 (118)
                      +|.|..|++.|.+...|..|++.|++
T Consensus         1 ~~~C~~C~~~F~~~~~l~~H~~~h~~   26 (27)
T PF13912_consen    1 PFECDECGKTFSSLSALREHKRSHCS   26 (27)
T ss_dssp             SEEETTTTEEESSHHHHHHHHCTTTT
T ss_pred             CCCCCccCCccCChhHHHHHhHHhcC
Confidence            57788888888888888888877654


No 31 
>PF13912 zf-C2H2_6:  C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B.
Probab=98.34  E-value=1.8e-07  Score=37.02  Aligned_cols=25  Identities=36%  Similarity=0.913  Sum_probs=18.9

Q ss_pred             CccCCCCCccccchHHHHhhhhhhc
Q psy12028          1 MYACDVCGKEYQHKRTLYRHKKDEC   25 (118)
Q Consensus         1 ~~~C~~C~~~~~~~~~l~~h~~~~~   25 (118)
                      ||+|..|++.|.+...|..|++.|.
T Consensus         1 ~~~C~~C~~~F~~~~~l~~H~~~h~   25 (27)
T PF13912_consen    1 PFECDECGKTFSSLSALREHKRSHC   25 (27)
T ss_dssp             SEEETTTTEEESSHHHHHHHHCTTT
T ss_pred             CCCCCccCCccCChhHHHHHhHHhc
Confidence            5777888888888888888776664


No 32 
>PF12756 zf-C2H2_2:  C2H2 type zinc-finger (2 copies); PDB: 2DMI_A.
Probab=98.25  E-value=6.2e-07  Score=46.64  Aligned_cols=73  Identities=18%  Similarity=0.271  Sum_probs=21.6

Q ss_pred             cCCCCCcccccchHHHHHhhhhhccCCcccccccCchhhhhhchHHHHHHHhhhcCCCCCccCCCCCCCCCChhHHHHHH
Q psy12028         32 GCPQCPYRSRQKATLNRHLGWEQLQGNAHVMYACDVCGKVYQHKQTLDRHKKDECGQEPKFECPHCPYRSKRKDTLDRHM  111 (118)
Q Consensus        32 ~C~~c~~~f~~~~~l~~h~~~~~~~~~~~~~~~c~~c~~~~~~~~~l~~h~~~h~~~~~~~~C~~C~~~f~~~~~l~~H~  111 (118)
                      +|..|+..|.+...+..||...+.....        ....+.....+...+....  ...+.|.+|++.|.....|..|+
T Consensus         1 ~C~~C~~~f~~~~~l~~H~~~~H~~~~~--------~~~~l~~~~~~~~~~~~~~--~~~~~C~~C~~~f~s~~~l~~Hm   70 (100)
T PF12756_consen    1 QCLFCDESFSSVDDLLQHMKKKHGFDIP--------DQKYLVDPNRLLNYLRKKV--KESFRCPYCNKTFRSREALQEHM   70 (100)
T ss_dssp             ----------------------------------------------------------SSEEBSSSS-EESSHHHHHHHH
T ss_pred             Cccccccccccccccccccccccccccc--------ccccccccccccccccccc--CCCCCCCccCCCCcCHHHHHHHH
Confidence            5899999999999999998533322111        1111123333444443322  33699999999999999999999


Q ss_pred             hhh
Q psy12028        112 KII  114 (118)
Q Consensus       112 ~~~  114 (118)
                      +.+
T Consensus        71 ~~~   73 (100)
T PF12756_consen   71 RSK   73 (100)
T ss_dssp             HHT
T ss_pred             cCc
Confidence            865


No 33 
>PF13894 zf-C2H2_4:  C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A ....
Probab=98.21  E-value=8.6e-07  Score=33.81  Aligned_cols=23  Identities=30%  Similarity=0.883  Sum_probs=12.7

Q ss_pred             ccCCCCCccccchHHHHhhhhhh
Q psy12028          2 YACDVCGKEYQHKRTLYRHKKDE   24 (118)
Q Consensus         2 ~~C~~C~~~~~~~~~l~~h~~~~   24 (118)
                      |.|+.|++.|.+...|..|+..+
T Consensus         1 ~~C~~C~~~~~~~~~l~~H~~~~   23 (24)
T PF13894_consen    1 FQCPICGKSFRSKSELRQHMRTH   23 (24)
T ss_dssp             EE-SSTS-EESSHHHHHHHHHHH
T ss_pred             CCCcCCCCcCCcHHHHHHHHHhh
Confidence            45666666666666666666544


No 34 
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning]
Probab=98.14  E-value=3.2e-07  Score=56.19  Aligned_cols=70  Identities=20%  Similarity=0.335  Sum_probs=40.7

Q ss_pred             CCCccCCC--CCcccccchHHHHHhhh-hhccCCcccccccCchhhhhhchHHHHHHHhhhcCCCCCccCCCCCCCCCCh
Q psy12028         28 EPKFGCPQ--CPYRSRQKATLNRHLGW-EQLQGNAHVMYACDVCGKVYQHKQTLDRHKKDECGQEPKFECPHCPYRSKRK  104 (118)
Q Consensus        28 ~~~~~C~~--c~~~f~~~~~l~~h~~~-~~~~~~~~~~~~c~~c~~~~~~~~~l~~h~~~h~~~~~~~~C~~C~~~f~~~  104 (118)
                      ++||.||+  |.+.+++...|+-|+.. |+.....+.|              ....+.-.-.. .+||+|++|+|++.+.
T Consensus       347 ~KpykCpV~gC~K~YknqnGLKYH~lhGH~~~~~~~~p--------------~p~~~~~F~~~-~KPYrCevC~KRYKNl  411 (423)
T COG5189         347 GKPYKCPVEGCNKKYKNQNGLKYHMLHGHQNQKLHENP--------------SPEKMNIFSAK-DKPYRCEVCDKRYKNL  411 (423)
T ss_pred             CceecCCCCCchhhhccccchhhhhhccccCcccCCCC--------------Ccccccccccc-CCceeccccchhhccC
Confidence            46777765  77777777777766531 1111111111              00111111222 6899999999999999


Q ss_pred             hHHHHHHh
Q psy12028        105 DTLDRHMK  112 (118)
Q Consensus       105 ~~l~~H~~  112 (118)
                      ..|+-|..
T Consensus       412 NGLKYHr~  419 (423)
T COG5189         412 NGLKYHRK  419 (423)
T ss_pred             ccceeccc
Confidence            99988864


No 35 
>PF09237 GAGA:  GAGA factor;  InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  Members of this entry bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 1YUI_A 1YUJ_A.
Probab=98.08  E-value=3e-06  Score=37.93  Aligned_cols=29  Identities=34%  Similarity=0.676  Sum_probs=14.3

Q ss_pred             CCCccCCCCCCCCCChhHHHHHHhhhcCC
Q psy12028         89 EPKFECPHCPYRSKRKDTLDRHMKIIHFS  117 (118)
Q Consensus        89 ~~~~~C~~C~~~f~~~~~l~~H~~~~~~~  117 (118)
                      +.|-.|++|+..+....+|++|+.+.|+.
T Consensus        22 ~~PatCP~C~a~~~~srnLrRHle~~H~~   50 (54)
T PF09237_consen   22 EQPATCPICGAVIRQSRNLRRHLEIRHFK   50 (54)
T ss_dssp             S--EE-TTT--EESSHHHHHHHHHHHTTT
T ss_pred             CCCCCCCcchhhccchhhHHHHHHHHhcc
Confidence            55556666666666666666666555543


No 36 
>smart00355 ZnF_C2H2 zinc finger.
Probab=98.01  E-value=8e-06  Score=31.52  Aligned_cols=23  Identities=35%  Similarity=0.730  Sum_probs=17.6

Q ss_pred             ccCCCCCCCCCChhHHHHHHhhh
Q psy12028         92 FECPHCPYRSKRKDTLDRHMKII  114 (118)
Q Consensus        92 ~~C~~C~~~f~~~~~l~~H~~~~  114 (118)
                      |.|..|++.|...+.|..|++.|
T Consensus         1 ~~C~~C~~~f~~~~~l~~H~~~H   23 (26)
T smart00355        1 YRCPECGKVFKSKSALKEHMRTH   23 (26)
T ss_pred             CCCCCCcchhCCHHHHHHHHHHh
Confidence            46778888888888888887754


No 37 
>PF13909 zf-H2C2_5:  C2H2-type zinc-finger domain; PDB: 1X5W_A.
Probab=97.98  E-value=4.7e-06  Score=31.91  Aligned_cols=24  Identities=46%  Similarity=1.048  Sum_probs=18.3

Q ss_pred             ccCCCCCCCCCChhHHHHHHhhhcC
Q psy12028         92 FECPHCPYRSKRKDTLDRHMKIIHF  116 (118)
Q Consensus        92 ~~C~~C~~~f~~~~~l~~H~~~~~~  116 (118)
                      |+|+.|++... .+.|.+|++.+|+
T Consensus         1 y~C~~C~y~t~-~~~l~~H~~~~H~   24 (24)
T PF13909_consen    1 YKCPHCSYSTS-KSNLKRHLKRHHP   24 (24)
T ss_dssp             EE-SSSS-EES-HHHHHHHHHHHHS
T ss_pred             CCCCCCCCcCC-HHHHHHHHHhhCc
Confidence            67888998887 8889999888774


No 38 
>PF12756 zf-C2H2_2:  C2H2 type zinc-finger (2 copies); PDB: 2DMI_A.
Probab=97.97  E-value=4e-06  Score=43.55  Aligned_cols=74  Identities=18%  Similarity=0.389  Sum_probs=21.6

Q ss_pred             cCCCCCccccchHHHHhhhhhhcCCCCCccCCCCCcccccchHHHHHhhhhhccCCcccccccCchhhhhhchHHHHHHH
Q psy12028          3 ACDVCGKEYQHKRTLYRHKKDECGQEPKFGCPQCPYRSRQKATLNRHLGWEQLQGNAHVMYACDVCGKVYQHKQTLDRHK   82 (118)
Q Consensus         3 ~C~~C~~~~~~~~~l~~h~~~~~~~~~~~~C~~c~~~f~~~~~l~~h~~~~~~~~~~~~~~~c~~c~~~~~~~~~l~~h~   82 (118)
                      +|..|+..|.+...|..|+...++...+    . ...+.....+...++     ......+.|..|++.|.+...|..|+
T Consensus         1 ~C~~C~~~f~~~~~l~~H~~~~H~~~~~----~-~~~l~~~~~~~~~~~-----~~~~~~~~C~~C~~~f~s~~~l~~Hm   70 (100)
T PF12756_consen    1 QCLFCDESFSSVDDLLQHMKKKHGFDIP----D-QKYLVDPNRLLNYLR-----KKVKESFRCPYCNKTFRSREALQEHM   70 (100)
T ss_dssp             ----------------------------------------------------------SSEEBSSSS-EESSHHHHHHHH
T ss_pred             Cccccccccccccccccccccccccccc----c-ccccccccccccccc-----cccCCCCCCCccCCCCcCHHHHHHHH
Confidence            5899999999999999999776652211    1 111112222222321     01112589999999999999999999


Q ss_pred             hhhc
Q psy12028         83 KDEC   86 (118)
Q Consensus        83 ~~h~   86 (118)
                      +.+.
T Consensus        71 ~~~~   74 (100)
T PF12756_consen   71 RSKH   74 (100)
T ss_dssp             HHTT
T ss_pred             cCcc
Confidence            8753


No 39 
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning]
Probab=97.95  E-value=2.4e-06  Score=52.52  Aligned_cols=25  Identities=32%  Similarity=0.635  Sum_probs=21.8

Q ss_pred             CccCCC--CCccccchHHHHhhhhhhc
Q psy12028          1 MYACDV--CGKEYQHKRTLYRHKKDEC   25 (118)
Q Consensus         1 ~~~C~~--C~~~~~~~~~l~~h~~~~~   25 (118)
                      ||+|++  |+|.|.++..|.-|+..-+
T Consensus       349 pykCpV~gC~K~YknqnGLKYH~lhGH  375 (423)
T COG5189         349 PYKCPVEGCNKKYKNQNGLKYHMLHGH  375 (423)
T ss_pred             eecCCCCCchhhhccccchhhhhhccc
Confidence            799998  9999999999999986533


No 40 
>smart00355 ZnF_C2H2 zinc finger.
Probab=97.79  E-value=2.4e-05  Score=30.08  Aligned_cols=23  Identities=35%  Similarity=0.804  Sum_probs=16.4

Q ss_pred             ccCCCCCccccchHHHHhhhhhh
Q psy12028          2 YACDVCGKEYQHKRTLYRHKKDE   24 (118)
Q Consensus         2 ~~C~~C~~~~~~~~~l~~h~~~~   24 (118)
                      |.|..|++.|.....|..|++.|
T Consensus         1 ~~C~~C~~~f~~~~~l~~H~~~H   23 (26)
T smart00355        1 YRCPECGKVFKSKSALKEHMRTH   23 (26)
T ss_pred             CCCCCCcchhCCHHHHHHHHHHh
Confidence            46777777777777777777654


No 41 
>PF09237 GAGA:  GAGA factor;  InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  Members of this entry bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 1YUI_A 1YUJ_A.
Probab=97.71  E-value=2.8e-05  Score=34.90  Aligned_cols=32  Identities=22%  Similarity=0.404  Sum_probs=18.3

Q ss_pred             cccccccCchhhhhhchHHHHHHHhhhcCCCCC
Q psy12028         59 AHVMYACDVCGKVYQHKQTLDRHKKDECGQEPK   91 (118)
Q Consensus        59 ~~~~~~c~~c~~~~~~~~~l~~h~~~h~~~~~~   91 (118)
                      .+.|-+|++|+..+..+.+|.+|+.+.++ .+|
T Consensus        21 S~~PatCP~C~a~~~~srnLrRHle~~H~-~k~   52 (54)
T PF09237_consen   21 SEQPATCPICGAVIRQSRNLRRHLEIRHF-KKP   52 (54)
T ss_dssp             TS--EE-TTT--EESSHHHHHHHHHHHTT-TS-
T ss_pred             cCCCCCCCcchhhccchhhHHHHHHHHhc-ccC
Confidence            34566777777777777777777777666 443


No 42 
>PF12874 zf-met:  Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A.
Probab=97.64  E-value=2.4e-05  Score=30.14  Aligned_cols=23  Identities=22%  Similarity=0.522  Sum_probs=17.2

Q ss_pred             ccCCCCCCCCCChhHHHHHHhhh
Q psy12028         92 FECPHCPYRSKRKDTLDRHMKII  114 (118)
Q Consensus        92 ~~C~~C~~~f~~~~~l~~H~~~~  114 (118)
                      |.|.+|++.|.+...|..|++.+
T Consensus         1 ~~C~~C~~~f~s~~~~~~H~~s~   23 (25)
T PF12874_consen    1 FYCDICNKSFSSENSLRQHLRSK   23 (25)
T ss_dssp             EEETTTTEEESSHHHHHHHHTTH
T ss_pred             CCCCCCCCCcCCHHHHHHHHCcC
Confidence            56778888888888888887653


No 43 
>PRK04860 hypothetical protein; Provisional
Probab=97.60  E-value=2.7e-05  Score=44.04  Aligned_cols=40  Identities=30%  Similarity=0.621  Sum_probs=34.1

Q ss_pred             cccccCchhhhhhchHHHHHHHhhhcCCCCCccCCCCCCCCCChh
Q psy12028         61 VMYACDVCGKVYQHKQTLDRHKKDECGQEPKFECPHCPYRSKRKD  105 (118)
Q Consensus        61 ~~~~c~~c~~~~~~~~~l~~h~~~h~~~~~~~~C~~C~~~f~~~~  105 (118)
                      .+|.|. |+.   ....+.+|.+++++ +++|.|..|+..|....
T Consensus       118 ~~Y~C~-C~~---~~~~~rrH~ri~~g-~~~YrC~~C~~~l~~~~  157 (160)
T PRK04860        118 FPYRCK-CQE---HQLTVRRHNRVVRG-EAVYRCRRCGETLVFKG  157 (160)
T ss_pred             EEEEcC-CCC---eeCHHHHHHHHhcC-CccEECCCCCceeEEec
Confidence            579998 987   66678899999999 99999999999886543


No 44 
>PF12874 zf-met:  Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A.
Probab=97.48  E-value=4.7e-05  Score=29.28  Aligned_cols=20  Identities=30%  Similarity=0.846  Sum_probs=10.5

Q ss_pred             cCCCCCccccchHHHHhhhh
Q psy12028          3 ACDVCGKEYQHKRTLYRHKK   22 (118)
Q Consensus         3 ~C~~C~~~~~~~~~l~~h~~   22 (118)
                      .|.+|++.|.+...|..|++
T Consensus         2 ~C~~C~~~f~s~~~~~~H~~   21 (25)
T PF12874_consen    2 YCDICNKSFSSENSLRQHLR   21 (25)
T ss_dssp             EETTTTEEESSHHHHHHHHT
T ss_pred             CCCCCCCCcCCHHHHHHHHC
Confidence            45555555555555555543


No 45 
>KOG2785|consensus
Probab=97.44  E-value=0.0003  Score=44.56  Aligned_cols=112  Identities=21%  Similarity=0.339  Sum_probs=81.9

Q ss_pred             ccCCCCCccccchHHHHhhhhhhcC------------------------------------CCCCccCCCCCcccccchH
Q psy12028          2 YACDVCGKEYQHKRTLYRHKKDECG------------------------------------QEPKFGCPQCPYRSRQKAT   45 (118)
Q Consensus         2 ~~C~~C~~~~~~~~~l~~h~~~~~~------------------------------------~~~~~~C~~c~~~f~~~~~   45 (118)
                      |.|..|...|.+...-..|.++-.-                                    .+.++.|.+|.+.|.+...
T Consensus         4 ftC~tC~v~F~~ad~Qr~HyKSdWHRYNLKRkVA~lPPItaE~F~~k~~s~~~~~~~~~e~~~~~~~c~~c~k~~~s~~a   83 (390)
T KOG2785|consen    4 FTCNTCNVEFDDADEQRAHYKSDWHRYNLKRKVASLPPITAEEFNEKVLSDDSEKEENLEEAESVVYCEACNKSFASPKA   83 (390)
T ss_pred             ceeeceeeeeccHHHHHHHhhhhHHHhhHHhHhhcCCCcCHHHHhHHHhhhhhhhhhhhhhcccceehHHhhccccChhh
Confidence            7899999999998888888776421                                    1234889999999999888


Q ss_pred             HHHHhhhh---------------------hcc-CC----------c----------------------------------
Q psy12028         46 LNRHLGWE---------------------QLQ-GN----------A----------------------------------   59 (118)
Q Consensus        46 l~~h~~~~---------------------~~~-~~----------~----------------------------------   59 (118)
                      ...|+.+.                     +.. -.          .                                  
T Consensus        84 ~~~hl~Sk~h~~~~~~~~r~~e~d~a~~~q~~~~~p~~l~~~~e~e~~~~E~~~~~d~~~e~~~dd~~Edi~~d~~~e~e  163 (390)
T KOG2785|consen   84 HENHLKSKKHVENLSNHQRSEEGDSAKISQLPSRRPSNLQNKGESELKWYEVDSDEDSSEEEEEDDEEEDIEEDGDDEDE  163 (390)
T ss_pred             HHHHHHHhhcchhhhhhhccccccchhhhhccccCccccccCCCcccchhhcccccccchhhccCcchhhhhhccchhcc
Confidence            88887711                     000 00          0                                  


Q ss_pred             ccccccCchhhhhhchHHHHHHHhhhcCC----------------------CCCccCCCCC---CCCCChhHHHHHHhh
Q psy12028         60 HVMYACDVCGKVYQHKQTLDRHKKDECGQ----------------------EPKFECPHCP---YRSKRKDTLDRHMKI  113 (118)
Q Consensus        60 ~~~~~c~~c~~~~~~~~~l~~h~~~h~~~----------------------~~~~~C~~C~---~~f~~~~~l~~H~~~  113 (118)
                      .-|-.|..|+..+.+......||..++|=                      ..-+.|..|+   +.|......++||..
T Consensus       164 ~~Pt~CLfC~~~~k~~e~~~~HM~~~HgffIPdreYL~D~~GLl~YLgeKV~~~~~CL~CN~~~~~f~sleavr~HM~~  242 (390)
T KOG2785|consen  164 LIPTDCLFCDKKSKSLEENLKHMFKEHGFFIPDREYLTDEKGLLKYLGEKVGIGFICLFCNELGRPFSSLEAVRAHMRD  242 (390)
T ss_pred             cCCcceeecCCCcccHHHHHHHHhhccCCcCCchHhhhchhHHHHHHHHHhccCceEEEeccccCcccccHHHHHHHhh
Confidence            12456888998888888888898888871                      3457888888   888888888888864


No 46 
>PRK04860 hypothetical protein; Provisional
Probab=97.40  E-value=0.00011  Score=41.64  Aligned_cols=37  Identities=24%  Similarity=0.635  Sum_probs=24.4

Q ss_pred             CccCCCCCcccccchHHHHHhhhhhccCCcccccccCchhhhhhc
Q psy12028         30 KFGCPQCPYRSRQKATLNRHLGWEQLQGNAHVMYACDVCGKVYQH   74 (118)
Q Consensus        30 ~~~C~~c~~~f~~~~~l~~h~~~~~~~~~~~~~~~c~~c~~~~~~   74 (118)
                      +|.|. |+.   ....+..|    ...+.++++|.|..|+..|..
T Consensus       119 ~Y~C~-C~~---~~~~~rrH----~ri~~g~~~YrC~~C~~~l~~  155 (160)
T PRK04860        119 PYRCK-CQE---HQLTVRRH----NRVVRGEAVYRCRRCGETLVF  155 (160)
T ss_pred             EEEcC-CCC---eeCHHHHH----HHHhcCCccEECCCCCceeEE
Confidence            57787 776   44456666    345566677888888776654


No 47 
>PF12171 zf-C2H2_jaz:  Zinc-finger double-stranded RNA-binding;  InterPro: IPR022755  This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length. The mammalian members of this group occur multiple times along the protein, joined by flexible linkers, and are referred to as JAZ - dsRNA-binding ZF protein - zinc-fingers. The JAZ proteins are expressed in all tissues tested and localise in the nucleus, particularly the nucleolus []. JAZ preferentially binds to double-stranded (ds) RNA or RNA/DNA hybrids rather than DNA. In addition to binding double-stranded RNA, these zinc-fingers are required for nucleolar localisation.   This entry represents the multiple-adjacent-C2H2 zinc finger, JAZ. ; PDB: 4DGW_A 1ZR9_A.
Probab=97.35  E-value=0.00013  Score=28.65  Aligned_cols=21  Identities=33%  Similarity=0.779  Sum_probs=12.6

Q ss_pred             ccCCCCCccccchHHHHhhhh
Q psy12028          2 YACDVCGKEYQHKRTLYRHKK   22 (118)
Q Consensus         2 ~~C~~C~~~~~~~~~l~~h~~   22 (118)
                      |.|..|++.|.+...+..|++
T Consensus         2 ~~C~~C~k~f~~~~~~~~H~~   22 (27)
T PF12171_consen    2 FYCDACDKYFSSENQLKQHMK   22 (27)
T ss_dssp             CBBTTTTBBBSSHHHHHCCTT
T ss_pred             CCcccCCCCcCCHHHHHHHHc
Confidence            456666666666666666654


No 48 
>KOG2231|consensus
Probab=97.32  E-value=0.00095  Score=45.60  Aligned_cols=97  Identities=22%  Similarity=0.362  Sum_probs=61.4

Q ss_pred             ccchHHHHhhhhhhcCCCCCccCCCCCcc---------cccchHHHHHhhhhhccCCccc-ccccCchhhhhhchHHHHH
Q psy12028         11 YQHKRTLYRHKKDECGQEPKFGCPQCPYR---------SRQKATLNRHLGWEQLQGNAHV-MYACDVCGKVYQHKQTLDR   80 (118)
Q Consensus        11 ~~~~~~l~~h~~~~~~~~~~~~C~~c~~~---------f~~~~~l~~h~~~~~~~~~~~~-~~~c~~c~~~~~~~~~l~~   80 (118)
                      |.....|..|+...+.   .+.|..|-..         .-+...|..|+..-.......+ --.|..|...|.....|.+
T Consensus       124 ~~s~~~Lk~H~~~~H~---~~~c~lC~~~~kif~~e~k~Yt~~el~~h~~~gd~d~~s~rGhp~C~~C~~~fld~~el~r  200 (669)
T KOG2231|consen  124 FKSVENLKNHMRDQHK---LHLCSLCLQNLKIFINERKLYTRAELNLHLMFGDPDDESCRGHPLCKFCHERFLDDDELYR  200 (669)
T ss_pred             hhHHHHHHHHHHHhhh---hhccccccccceeeeeeeehehHHHHHHHHhcCCCccccccCCccchhhhhhhccHHHHHH
Confidence            3477889999876553   3555554422         2334566777653222111111 2478899999999999999


Q ss_pred             HHhhhcCCCCCccCCCC------CCCCCChhHHHHHHhhhc
Q psy12028         81 HKKDECGQEPKFECPHC------PYRSKRKDTLDRHMKIIH  115 (118)
Q Consensus        81 h~~~h~~~~~~~~C~~C------~~~f~~~~~l~~H~~~~~  115 (118)
                      |++.++-     .|..|      +.-|...++|..|.+..|
T Consensus       201 H~~~~h~-----~chfC~~~~~~neyy~~~~dLe~HfR~~H  236 (669)
T KOG2231|consen  201 HLRFDHE-----FCHFCDYKTGQNEYYNDYDDLEEHFRKGH  236 (669)
T ss_pred             hhcccee-----heeecCcccccchhcccchHHHHHhhhcC
Confidence            9887653     33333      445777889999988776


No 49 
>PF12171 zf-C2H2_jaz:  Zinc-finger double-stranded RNA-binding;  InterPro: IPR022755  This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length. The mammalian members of this group occur multiple times along the protein, joined by flexible linkers, and are referred to as JAZ - dsRNA-binding ZF protein - zinc-fingers. The JAZ proteins are expressed in all tissues tested and localise in the nucleus, particularly the nucleolus []. JAZ preferentially binds to double-stranded (ds) RNA or RNA/DNA hybrids rather than DNA. In addition to binding double-stranded RNA, these zinc-fingers are required for nucleolar localisation.   This entry represents the multiple-adjacent-C2H2 zinc finger, JAZ. ; PDB: 4DGW_A 1ZR9_A.
Probab=97.29  E-value=8.9e-05  Score=29.13  Aligned_cols=22  Identities=32%  Similarity=0.597  Sum_probs=16.2

Q ss_pred             ccCCCCCCCCCChhHHHHHHhh
Q psy12028         92 FECPHCPYRSKRKDTLDRHMKI  113 (118)
Q Consensus        92 ~~C~~C~~~f~~~~~l~~H~~~  113 (118)
                      |-|..|++.|.+...|..|++.
T Consensus         2 ~~C~~C~k~f~~~~~~~~H~~s   23 (27)
T PF12171_consen    2 FYCDACDKYFSSENQLKQHMKS   23 (27)
T ss_dssp             CBBTTTTBBBSSHHHHHCCTTS
T ss_pred             CCcccCCCCcCCHHHHHHHHcc
Confidence            5677777777777777777654


No 50 
>PF13909 zf-H2C2_5:  C2H2-type zinc-finger domain; PDB: 1X5W_A.
Probab=97.24  E-value=0.0002  Score=27.20  Aligned_cols=22  Identities=36%  Similarity=0.634  Sum_probs=10.8

Q ss_pred             ccCCCCCccccchHHHHhhhhhh
Q psy12028          2 YACDVCGKEYQHKRTLYRHKKDE   24 (118)
Q Consensus         2 ~~C~~C~~~~~~~~~l~~h~~~~   24 (118)
                      |+|+.|+.... ...|..|++.+
T Consensus         1 y~C~~C~y~t~-~~~l~~H~~~~   22 (24)
T PF13909_consen    1 YKCPHCSYSTS-KSNLKRHLKRH   22 (24)
T ss_dssp             EE-SSSS-EES-HHHHHHHHHHH
T ss_pred             CCCCCCCCcCC-HHHHHHHHHhh
Confidence            45555555554 55555555544


No 51 
>PF13913 zf-C2HC_2:  zinc-finger of a C2HC-type
Probab=96.98  E-value=0.00087  Score=25.81  Aligned_cols=20  Identities=35%  Similarity=0.755  Sum_probs=13.4

Q ss_pred             ccCCCCCCCCCChhHHHHHHh
Q psy12028         92 FECPHCPYRSKRKDTLDRHMK  112 (118)
Q Consensus        92 ~~C~~C~~~f~~~~~l~~H~~  112 (118)
                      ..|+.||+.| ..+.|.+|+.
T Consensus         3 ~~C~~CgR~F-~~~~l~~H~~   22 (25)
T PF13913_consen    3 VPCPICGRKF-NPDRLEKHEK   22 (25)
T ss_pred             CcCCCCCCEE-CHHHHHHHHH
Confidence            3577777777 5666667764


No 52 
>KOG4173|consensus
Probab=96.83  E-value=0.00044  Score=40.29  Aligned_cols=80  Identities=20%  Similarity=0.399  Sum_probs=61.1

Q ss_pred             CCccCCC--CCcccccchHHHHHhhhhhccCCcccccccCchhhhhhchHHHHHHHhhhcC---------CCCCccCCC-
Q psy12028         29 PKFGCPQ--CPYRSRQKATLNRHLGWEQLQGNAHVMYACDVCGKVYQHKQTLDRHKKDECG---------QEPKFECPH-   96 (118)
Q Consensus        29 ~~~~C~~--c~~~f~~~~~l~~h~~~~~~~~~~~~~~~c~~c~~~~~~~~~l~~h~~~h~~---------~~~~~~C~~-   96 (118)
                      +.+.|++  |...|.+...+..|...   .|+    ..|.+|.+.|...-.|..|+...+.         +.-.|+|.+ 
T Consensus        78 ~~~~cqvagc~~~~d~lD~~E~hY~~---~h~----~sCs~C~r~~Pt~hLLd~HI~E~HDs~Fqa~veRG~dMy~ClvE  150 (253)
T KOG4173|consen   78 PAFACQVAGCCQVFDALDDYEHHYHT---LHG----NSCSFCKRAFPTGHLLDAHILEWHDSLFQALVERGQDMYQCLVE  150 (253)
T ss_pred             ccccccccchHHHHhhhhhHHHhhhh---ccc----chhHHHHHhCCchhhhhHHHHHHHHHHHHHHHHcCccHHHHHHH
Confidence            3478887  66788888878877532   222    3899999999999999999876542         155799954 


Q ss_pred             -CCCCCCChhHHHHHHhhhc
Q psy12028         97 -CPYRSKRKDTLDRHMKIIH  115 (118)
Q Consensus        97 -C~~~f~~~~~l~~H~~~~~  115 (118)
                       |+-.|.+..+...|+...|
T Consensus       151 gCt~KFkT~r~RkdH~I~~H  170 (253)
T KOG4173|consen  151 GCTEKFKTSRDRKDHMIRMH  170 (253)
T ss_pred             hhhhhhhhhhhhhhHHHHhc
Confidence             9999999999999987665


No 53 
>KOG1146|consensus
Probab=96.72  E-value=0.00044  Score=50.14  Aligned_cols=23  Identities=30%  Similarity=0.756  Sum_probs=14.6

Q ss_pred             CCccCCCCCCCCCChhHHHHHHh
Q psy12028         90 PKFECPHCPYRSKRKDTLDRHMK  112 (118)
Q Consensus        90 ~~~~C~~C~~~f~~~~~l~~H~~  112 (118)
                      ..|.|.+|++.-.-..+|+.|+.
T Consensus       588 P~~~C~vc~yetniarnlrihmt  610 (1406)
T KOG1146|consen  588 PSWRCEVCSYETNIARNLRIHMT  610 (1406)
T ss_pred             CCcchhhhcchhhhhhccccccc
Confidence            34677777766666666666654


No 54 
>smart00451 ZnF_U1 U1-like zinc finger. Family of C2H2-type zinc fingers, present in matrin, U1 small nuclear ribonucleoprotein C and other RNA-binding proteins.
Probab=96.51  E-value=0.0028  Score=26.25  Aligned_cols=23  Identities=22%  Similarity=0.418  Sum_probs=19.2

Q ss_pred             CccCCCCCCCCCChhHHHHHHhh
Q psy12028         91 KFECPHCPYRSKRKDTLDRHMKI  113 (118)
Q Consensus        91 ~~~C~~C~~~f~~~~~l~~H~~~  113 (118)
                      +|.|.+|++.|.....+..|+..
T Consensus         3 ~~~C~~C~~~~~~~~~~~~H~~g   25 (35)
T smart00451        3 GFYCKLCNVTFTDEISVEAHLKG   25 (35)
T ss_pred             CeEccccCCccCCHHHHHHHHCh
Confidence            57899999999988888888753


No 55 
>KOG1146|consensus
Probab=96.40  E-value=0.0018  Score=47.21  Aligned_cols=53  Identities=23%  Similarity=0.483  Sum_probs=37.8

Q ss_pred             cccccCchhhhhhchHHHHHHHhhhc------------------------CCCCCccCCCCCCCCCChhHHHHHHhh
Q psy12028         61 VMYACDVCGKVYQHKQTLDRHKKDEC------------------------GQEPKFECPHCPYRSKRKDTLDRHMKI  113 (118)
Q Consensus        61 ~~~~c~~c~~~~~~~~~l~~h~~~h~------------------------~~~~~~~C~~C~~~f~~~~~l~~H~~~  113 (118)
                      +.+.|+.|+..|.....|..|++.-+                        ....+|.|..|.+++....+|.+|+..
T Consensus       464 kt~~cpkc~~~yk~a~~L~vhmRskhp~~~~~~c~~gq~~~~~arg~~~~~~~~p~~C~~C~~stttng~LsihlqS  540 (1406)
T KOG1146|consen  464 KTLKCPKCNWHYKLAQTLGVHMRSKHPESQSAYCKAGQNHPRLARGEVYRCPGKPYPCRACNYSTTTNGNLSIHLQS  540 (1406)
T ss_pred             ccccCCccchhhhhHHHhhhcccccccccchhHhHhccccccccccccccCCCCcccceeeeeeeecchHHHHHHHH
Confidence            45566666666666666666665511                        125689999999999999999999864


No 56 
>smart00451 ZnF_U1 U1-like zinc finger. Family of C2H2-type zinc fingers, present in matrin, U1 small nuclear ribonucleoprotein C and other RNA-binding proteins.
Probab=96.17  E-value=0.004  Score=25.76  Aligned_cols=20  Identities=15%  Similarity=0.584  Sum_probs=9.5

Q ss_pred             ccCCCCCccccchHHHHhhh
Q psy12028          2 YACDVCGKEYQHKRTLYRHK   21 (118)
Q Consensus         2 ~~C~~C~~~~~~~~~l~~h~   21 (118)
                      |.|..|++.|.+...+..|+
T Consensus         4 ~~C~~C~~~~~~~~~~~~H~   23 (35)
T smart00451        4 FYCKLCNVTFTDEISVEAHL   23 (35)
T ss_pred             eEccccCCccCCHHHHHHHH
Confidence            34455555554444444443


No 57 
>cd00350 rubredoxin_like Rubredoxin_like; nonheme iron binding domain containing a [Fe(SCys)4] center. The family includes rubredoxins, a small electron transfer protein, and a slightly smaller modular rubredoxin domain present in rubrerythrin and nigerythrin and detected either N- or C-terminal to such proteins as flavin reductase, NAD(P)H-nitrite reductase, and ferredoxin-thioredoxin reductase. In rubredoxin, the iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), but iron can also be replaced by cobalt, nickel or zinc and believed to be involved in electron transfer.  Rubrerythrins and nigerythrins are small homodimeric proteins, generally consisting of 2 domains: a rubredoxin domain C-terminal to a non-sulfur, oxo-bridged diiron site in the N-terminal rubrerythrin domain.  Rubrerythrins and nigerythrins have putative peroxide activity.
Probab=96.11  E-value=0.0038  Score=25.70  Aligned_cols=25  Identities=40%  Similarity=0.958  Sum_probs=16.6

Q ss_pred             ccCCCCCccccchHHHHhhhhhhcCCCCCccCCCCCcc
Q psy12028          2 YACDVCGKEYQHKRTLYRHKKDECGQEPKFGCPQCPYR   39 (118)
Q Consensus         2 ~~C~~C~~~~~~~~~l~~h~~~~~~~~~~~~C~~c~~~   39 (118)
                      |.|.+||.++...             ..++.||.|+..
T Consensus         2 ~~C~~CGy~y~~~-------------~~~~~CP~Cg~~   26 (33)
T cd00350           2 YVCPVCGYIYDGE-------------EAPWVCPVCGAP   26 (33)
T ss_pred             EECCCCCCEECCC-------------cCCCcCcCCCCc
Confidence            6788888766432             256788888753


No 58 
>COG2888 Predicted Zn-ribbon RNA-binding protein with a function in translation [Translation, ribosomal structure and biogenesis]
Probab=95.83  E-value=0.0094  Score=27.77  Aligned_cols=33  Identities=30%  Similarity=0.544  Sum_probs=19.8

Q ss_pred             CCccCCCCCcccccchHHHHHhhhhhccCCcccccccCchhh
Q psy12028         29 PKFGCPQCPYRSRQKATLNRHLGWEQLQGNAHVMYACDVCGK   70 (118)
Q Consensus        29 ~~~~C~~c~~~f~~~~~l~~h~~~~~~~~~~~~~~~c~~c~~   70 (118)
                      ..|.||.||..-......-+-       .  ..+|.|+.||.
T Consensus        26 v~F~CPnCGe~~I~Rc~~CRk-------~--g~~Y~Cp~CGF   58 (61)
T COG2888          26 VKFPCPNCGEVEIYRCAKCRK-------L--GNPYRCPKCGF   58 (61)
T ss_pred             eEeeCCCCCceeeehhhhHHH-------c--CCceECCCcCc
Confidence            348888888665444322221       1  25688888875


No 59 
>COG4049 Uncharacterized protein containing archaeal-type C2H2 Zn-finger [General function prediction only]
Probab=95.75  E-value=0.0038  Score=28.60  Aligned_cols=28  Identities=25%  Similarity=0.615  Sum_probs=15.3

Q ss_pred             ccccccCchhhhhhchHHHHHHHhhhcC
Q psy12028         60 HVMYACDVCGKVYQHKQTLDRHKKDECG   87 (118)
Q Consensus        60 ~~~~~c~~c~~~~~~~~~l~~h~~~h~~   87 (118)
                      +.-+.|+-|+..|....++.+|....++
T Consensus        15 E~~lrCPRC~~~FR~~K~Y~RHVNKaH~   42 (65)
T COG4049          15 EEFLRCPRCGMVFRRRKDYIRHVNKAHG   42 (65)
T ss_pred             ceeeeCCchhHHHHHhHHHHHHhhHHhh
Confidence            3445566666666666555555544443


No 60 
>COG5048 FOG: Zn-finger [General function prediction only]
Probab=95.69  E-value=0.0028  Score=41.06  Aligned_cols=50  Identities=26%  Similarity=0.538  Sum_probs=43.4

Q ss_pred             CccCCCCCccccchHHHHhhhh--hhcCCC--CCccCC--CCCcccccchHHHHHhh
Q psy12028          1 MYACDVCGKEYQHKRTLYRHKK--DECGQE--PKFGCP--QCPYRSRQKATLNRHLG   51 (118)
Q Consensus         1 ~~~C~~C~~~~~~~~~l~~h~~--~~~~~~--~~~~C~--~c~~~f~~~~~l~~h~~   51 (118)
                      ++.|..|...|.....|..|..  .|.+ +  +++.|+  .|++.|.....+..|..
T Consensus       289 ~~~~~~~~~~~s~~~~l~~~~~~~~h~~-~~~~~~~~p~~~~~~~~~~~~~~~~~~~  344 (467)
T COG5048         289 PIKSKQCNISFSRSSPLTRHLRSVNHSG-ESLKPFSCPYSLCGKLFSRNDALKRHIL  344 (467)
T ss_pred             CCCCccccCCcccccccccccccccccc-ccCCceeeeccCCCccccccccccCCcc
Confidence            3678889999999999999999  6877 6  899999  79999999988888865


No 61 
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only]
Probab=95.29  E-value=0.026  Score=35.94  Aligned_cols=102  Identities=22%  Similarity=0.349  Sum_probs=52.6

Q ss_pred             ccCCC--CCccccchHHHHhhhhhhcCCCCCccCCCCCc---ccccc------hHHHHHhhhhhccCCcc----cccccC
Q psy12028          2 YACDV--CGKEYQHKRTLYRHKKDECGQEPKFGCPQCPY---RSRQK------ATLNRHLGWEQLQGNAH----VMYACD   66 (118)
Q Consensus         2 ~~C~~--C~~~~~~~~~l~~h~~~~~~~~~~~~C~~c~~---~f~~~------~~l~~h~~~~~~~~~~~----~~~~c~   66 (118)
                      |.|+.  |..+......|..|.+..++   .+.|.+|-.   .|...      ..|..|    ......+    .--.|.
T Consensus       152 F~CP~skc~~~C~~~k~lk~H~K~~H~---~~~C~~C~~nKk~F~~E~~lF~~~~Lr~H----~~~G~~e~GFKGHP~C~  224 (493)
T COG5236         152 FKCPKSKCHRRCGSLKELKKHYKAQHG---FVLCSECIGNKKDFWNEIRLFRSSTLRDH----KNGGLEEEGFKGHPLCI  224 (493)
T ss_pred             hcCCchhhhhhhhhHHHHHHHHHhhcC---cEEhHhhhcCcccCccceeeeeccccccc----ccCCccccCcCCCchhh
Confidence            44554  44454455667777666544   355555542   23222      223333    2221111    112577


Q ss_pred             chhhhhhchHHHHHHHhhhcCCCCCccCCCCCC----CCCChhHHHHHHh
Q psy12028         67 VCGKVYQHKQTLDRHKKDECGQEPKFECPHCPY----RSKRKDTLDRHMK  112 (118)
Q Consensus        67 ~c~~~~~~~~~l~~h~~~h~~~~~~~~C~~C~~----~f~~~~~l~~H~~  112 (118)
                      .|...|-+-..|..|++..+  ++-|.|..-+.    -|.+-.+|.+|.+
T Consensus       225 FC~~~FYdDDEL~~HcR~~H--E~ChICD~v~p~~~QYFK~Y~~Le~HF~  272 (493)
T COG5236         225 FCKIYFYDDDELRRHCRLRH--EACHICDMVGPIRYQYFKSYEDLEAHFR  272 (493)
T ss_pred             hccceecChHHHHHHHHhhh--hhhhhhhccCccchhhhhCHHHHHHHhh
Confidence            77777777778888877654  44444444332    2455566666654


No 62 
>COG5048 FOG: Zn-finger [General function prediction only]
Probab=94.91  E-value=0.0044  Score=40.15  Aligned_cols=55  Identities=27%  Similarity=0.550  Sum_probs=43.5

Q ss_pred             cccccCchhhhhhchHHHHHHHh--hhcCCC--CCccCC--CCCCCCCChhHHHHHHhhhcC
Q psy12028         61 VMYACDVCGKVYQHKQTLDRHKK--DECGQE--PKFECP--HCPYRSKRKDTLDRHMKIIHF  116 (118)
Q Consensus        61 ~~~~c~~c~~~~~~~~~l~~h~~--~h~~~~--~~~~C~--~C~~~f~~~~~l~~H~~~~~~  116 (118)
                      .++.|..|...|.....+..|.+  .|.+ +  .++.|+  .|++.|.+...+..|...+.+
T Consensus       288 ~~~~~~~~~~~~s~~~~l~~~~~~~~h~~-~~~~~~~~p~~~~~~~~~~~~~~~~~~~~~~~  348 (467)
T COG5048         288 LPIKSKQCNISFSRSSPLTRHLRSVNHSG-ESLKPFSCPYSLCGKLFSRNDALKRHILLHTS  348 (467)
T ss_pred             cCCCCccccCCcccccccccccccccccc-ccCCceeeeccCCCccccccccccCCcccccC
Confidence            35778888888888888888888  6777 7  788888  688888888888888776654


No 63 
>PF09538 FYDLN_acid:  Protein of unknown function (FYDLN_acid);  InterPro: IPR012644 Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues. The function of members of this family is unknown.
Probab=94.52  E-value=0.026  Score=29.96  Aligned_cols=11  Identities=27%  Similarity=0.630  Sum_probs=5.5

Q ss_pred             ccCCCCCcccc
Q psy12028         31 FGCPQCPYRSR   41 (118)
Q Consensus        31 ~~C~~c~~~f~   41 (118)
                      ..|+.||..|-
T Consensus        10 R~Cp~CG~kFY   20 (108)
T PF09538_consen   10 RTCPSCGAKFY   20 (108)
T ss_pred             ccCCCCcchhc
Confidence            34555555553


No 64 
>PRK14890 putative Zn-ribbon RNA-binding protein; Provisional
Probab=94.25  E-value=0.041  Score=25.71  Aligned_cols=33  Identities=27%  Similarity=0.481  Sum_probs=19.9

Q ss_pred             CCccCCCCCcccccchHHHHHhhhhhccCCcccccccCchhh
Q psy12028         29 PKFGCPQCPYRSRQKATLNRHLGWEQLQGNAHVMYACDVCGK   70 (118)
Q Consensus        29 ~~~~C~~c~~~f~~~~~l~~h~~~~~~~~~~~~~~~c~~c~~   70 (118)
                      ..|.||.||..-...-.-       +...  ..+|.|+.||.
T Consensus        24 ~~F~CPnCG~~~I~RC~~-------CRk~--~~~Y~CP~CGF   56 (59)
T PRK14890         24 VKFLCPNCGEVIIYRCEK-------CRKQ--SNPYTCPKCGF   56 (59)
T ss_pred             CEeeCCCCCCeeEeechh-------HHhc--CCceECCCCCC
Confidence            458999999873332211       1111  25699999985


No 65 
>KOG2482|consensus
Probab=94.13  E-value=0.068  Score=34.02  Aligned_cols=49  Identities=24%  Similarity=0.362  Sum_probs=29.2

Q ss_pred             cccCchhhhhhchHHHHHHHhhhcC-C-------------------------CCCccCCCCCCCCCChhHHHHHH
Q psy12028         63 YACDVCGKVYQHKQTLDRHKKDECG-Q-------------------------EPKFECPHCPYRSKRKDTLDRHM  111 (118)
Q Consensus        63 ~~c~~c~~~~~~~~~l~~h~~~h~~-~-------------------------~~~~~C~~C~~~f~~~~~l~~H~  111 (118)
                      ..|..|.....+...|..||..-+. +                         ...-.|-.|.-.|-....|..|+
T Consensus       280 v~CLfC~~~~en~~~l~eHmk~vHe~Dl~Ki~sd~~Ln~YqrvrviNyiRkq~~~~~c~~cd~~F~~e~~l~~hm  354 (423)
T KOG2482|consen  280 VVCLFCTNFYENPVFLFEHMKIVHEFDLLKIQSDYSLNFYQRVRVINYIRKQKKKSRCAECDLSFWKEPGLLIHM  354 (423)
T ss_pred             eEEEeeccchhhHHHHHHHHHHHHHhhHHhhccccccchhhhhhHHHHHHHHhhccccccccccccCcchhhhhc
Confidence            3566677666666666677665432 0                         11234566666677777777666


No 66 
>KOG2482|consensus
Probab=94.11  E-value=0.14  Score=32.66  Aligned_cols=24  Identities=33%  Similarity=0.483  Sum_probs=20.0

Q ss_pred             ccCCCCCCCCCChhHHHHHHhhhc
Q psy12028         92 FECPHCPYRSKRKDTLDRHMKIIH  115 (118)
Q Consensus        92 ~~C~~C~~~f~~~~~l~~H~~~~~  115 (118)
                      .+|..|.....+...|..||++.|
T Consensus       280 v~CLfC~~~~en~~~l~eHmk~vH  303 (423)
T KOG2482|consen  280 VVCLFCTNFYENPVFLFEHMKIVH  303 (423)
T ss_pred             eEEEeeccchhhHHHHHHHHHHHH
Confidence            578888888888888999988776


No 67 
>cd00729 rubredoxin_SM Rubredoxin, Small Modular nonheme iron binding domain containing a [Fe(SCys)4] center, present in rubrerythrin and nigerythrin and detected either N- or C-terminal to such proteins as flavin reductase, NAD(P)H-nitrite reductase, and ferredoxin-thioredoxin reductase. In rubredoxin, the iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), and  believed to be involved in electron transfer. Rubrerythrins and nigerythrins are small homodimeric proteins, generally consisting of 2 domains: a rubredoxin domain C-terminal to a non-sulfur, oxo-bridged diiron site in the N-terminal rubrerythrin domain. Rubrerythrins and nigerythrins have putative peroxide activity.
Probab=94.01  E-value=0.038  Score=22.88  Aligned_cols=25  Identities=32%  Similarity=0.717  Sum_probs=15.8

Q ss_pred             ccCCCCCccccchHHHHhhhhhhcCCCCCccCCCCCcc
Q psy12028          2 YACDVCGKEYQHKRTLYRHKKDECGQEPKFGCPQCPYR   39 (118)
Q Consensus         2 ~~C~~C~~~~~~~~~l~~h~~~~~~~~~~~~C~~c~~~   39 (118)
                      |.|..||..+..             .+.|..||.|+..
T Consensus         3 ~~C~~CG~i~~g-------------~~~p~~CP~Cg~~   27 (34)
T cd00729           3 WVCPVCGYIHEG-------------EEAPEKCPICGAP   27 (34)
T ss_pred             EECCCCCCEeEC-------------CcCCCcCcCCCCc
Confidence            567788876532             1345688888753


No 68 
>PF13719 zinc_ribbon_5:  zinc-ribbon domain
Probab=93.91  E-value=0.029  Score=23.69  Aligned_cols=32  Identities=25%  Similarity=0.554  Sum_probs=14.4

Q ss_pred             ccCchhhhhhchHHHHHHHhhhcCCCCCccCCCCCCCC
Q psy12028         64 ACDVCGKVYQHKQTLDRHKKDECGQEPKFECPHCPYRS  101 (118)
Q Consensus        64 ~c~~c~~~~~~~~~l~~h~~~h~~~~~~~~C~~C~~~f  101 (118)
                      .|+.|+..|.-...     +...+ ....+|+.|+..|
T Consensus         4 ~CP~C~~~f~v~~~-----~l~~~-~~~vrC~~C~~~f   35 (37)
T PF13719_consen    4 TCPNCQTRFRVPDD-----KLPAG-GRKVRCPKCGHVF   35 (37)
T ss_pred             ECCCCCceEEcCHH-----HcccC-CcEEECCCCCcEe
Confidence            45555555544433     11122 3345566665544


No 69 
>KOG4173|consensus
Probab=93.81  E-value=0.022  Score=33.50  Aligned_cols=78  Identities=22%  Similarity=0.369  Sum_probs=50.7

Q ss_pred             cCCC--CCccccchHHHHhhhhhhcCCCCCccCCCCCcccccchHHHHHhhhh------hccCCcccccccCc--hhhhh
Q psy12028          3 ACDV--CGKEYQHKRTLYRHKKDECGQEPKFGCPQCPYRSRQKATLNRHLGWE------QLQGNAHVMYACDV--CGKVY   72 (118)
Q Consensus         3 ~C~~--C~~~~~~~~~l~~h~~~~~~~~~~~~C~~c~~~f~~~~~l~~h~~~~------~~~~~~~~~~~c~~--c~~~~   72 (118)
                      .|++  |..+|........|-.+.++    -.|.+|.+.|.+...|..|+...      -.+..+.--|.|-+  |+..|
T Consensus        81 ~cqvagc~~~~d~lD~~E~hY~~~h~----~sCs~C~r~~Pt~hLLd~HI~E~HDs~Fqa~veRG~dMy~ClvEgCt~KF  156 (253)
T KOG4173|consen   81 ACQVAGCCQVFDALDDYEHHYHTLHG----NSCSFCKRAFPTGHLLDAHILEWHDSLFQALVERGQDMYQCLVEGCTEKF  156 (253)
T ss_pred             cccccchHHHHhhhhhHHHhhhhccc----chhHHHHHhCCchhhhhHHHHHHHHHHHHHHHHcCccHHHHHHHhhhhhh
Confidence            4554  55666666666666544443    57889999998888888887521      22333333477754  88888


Q ss_pred             hchHHHHHHHhh
Q psy12028         73 QHKQTLDRHKKD   84 (118)
Q Consensus        73 ~~~~~l~~h~~~   84 (118)
                      .....-..|+-.
T Consensus       157 kT~r~RkdH~I~  168 (253)
T KOG4173|consen  157 KTSRDRKDHMIR  168 (253)
T ss_pred             hhhhhhhhHHHH
Confidence            888777777643


No 70 
>PF09986 DUF2225:  Uncharacterized protein conserved in bacteria (DUF2225);  InterPro: IPR018708 This conserved bacterial family has no known function.
Probab=93.39  E-value=0.017  Score=34.51  Aligned_cols=41  Identities=27%  Similarity=0.581  Sum_probs=24.1

Q ss_pred             ccCCCCCccccchHHHHhhhhhhcC---------CCCC-----ccCCCCCccccc
Q psy12028          2 YACDVCGKEYQHKRTLYRHKKDECG---------QEPK-----FGCPQCPYRSRQ   42 (118)
Q Consensus         2 ~~C~~C~~~~~~~~~l~~h~~~~~~---------~~~~-----~~C~~c~~~f~~   42 (118)
                      ..|++|++.|.+........+.-..         +..|     ..||.||..+..
T Consensus         6 ~~CPvC~~~F~~~~vrs~~~r~~~~d~D~~~~Y~~vnP~~Y~V~vCP~CgyA~~~   60 (214)
T PF09986_consen    6 ITCPVCGKEFKTKKVRSGKIRVIRRDSDFCPRYKGVNPLFYEVWVCPHCGYAAFE   60 (214)
T ss_pred             eECCCCCCeeeeeEEEcCCceEeeecCCCccccCCCCCeeeeEEECCCCCCcccc
Confidence            4688888888777655544433111         1222     668888876543


No 71 
>KOG2231|consensus
Probab=93.37  E-value=0.12  Score=35.97  Aligned_cols=82  Identities=20%  Similarity=0.245  Sum_probs=47.2

Q ss_pred             cCCCCCcccccchHHHHHhhhhhccCCc----ccccccCchhhhhhchHHHHHHHhhhcCCCC----CccCCCCCCCCCC
Q psy12028         32 GCPQCPYRSRQKATLNRHLGWEQLQGNA----HVMYACDVCGKVYQHKQTLDRHKKDECGQEP----KFECPHCPYRSKR  103 (118)
Q Consensus        32 ~C~~c~~~f~~~~~l~~h~~~~~~~~~~----~~~~~c~~c~~~~~~~~~l~~h~~~h~~~~~----~~~C~~C~~~f~~  103 (118)
                      .|..| ..|.....|+.||...++.+--    +..-.+..+.+.|.. ..|..|+..--.++.    .-.|..|...|-.
T Consensus       117 ~~~~c-~~~~s~~~Lk~H~~~~H~~~~c~lC~~~~kif~~e~k~Yt~-~el~~h~~~gd~d~~s~rGhp~C~~C~~~fld  194 (669)
T KOG2231|consen  117 ECLHC-TEFKSVENLKNHMRDQHKLHLCSLCLQNLKIFINERKLYTR-AELNLHLMFGDPDDESCRGHPLCKFCHERFLD  194 (669)
T ss_pred             CCccc-cchhHHHHHHHHHHHhhhhhccccccccceeeeeeeehehH-HHHHHHHhcCCCccccccCCccchhhhhhhcc
Confidence            44555 5555788899998643332110    000012223444444 455566554221122    2468999999999


Q ss_pred             hhHHHHHHhhhc
Q psy12028        104 KDTLDRHMKIIH  115 (118)
Q Consensus       104 ~~~l~~H~~~~~  115 (118)
                      ...|.+|++..|
T Consensus       195 ~~el~rH~~~~h  206 (669)
T KOG2231|consen  195 DDELYRHLRFDH  206 (669)
T ss_pred             HHHHHHhhccce
Confidence            999999998766


No 72 
>smart00834 CxxC_CXXC_SSSS Putative regulatory protein. CxxC_CXXC_SSSS represents a region of about 41 amino acids found in a number of small proteins in a wide range of bacteria. The region usually begins with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One protein in this entry has been noted as a putative regulatory protein, designated FmdB. Most proteins in this entry have a C-terminal region containing highly degenerate sequence.
Probab=93.21  E-value=0.031  Score=23.93  Aligned_cols=12  Identities=33%  Similarity=1.162  Sum_probs=7.0

Q ss_pred             ccCCCCCccccc
Q psy12028          2 YACDVCGKEYQH   13 (118)
Q Consensus         2 ~~C~~C~~~~~~   13 (118)
                      |+|..||..|..
T Consensus         6 y~C~~Cg~~fe~   17 (41)
T smart00834        6 YRCEDCGHTFEV   17 (41)
T ss_pred             EEcCCCCCEEEE
Confidence            556666666543


No 73 
>PF12013 DUF3505:  Protein of unknown function (DUF3505);  InterPro: IPR022698  This family of proteins is functionally uncharacterised. This protein is found in eukaryotes. Proteins in this family are typically between 247 to 1018 amino acids in length. This region contains two segments that are likely to be C2H2 zinc binding domains. 
Probab=93.08  E-value=0.085  Score=28.01  Aligned_cols=26  Identities=35%  Similarity=0.819  Sum_probs=23.9

Q ss_pred             CccC----CCCCCCCCChhHHHHHHhhhcC
Q psy12028         91 KFEC----PHCPYRSKRKDTLDRHMKIIHF  116 (118)
Q Consensus        91 ~~~C----~~C~~~f~~~~~l~~H~~~~~~  116 (118)
                      -|.|    ..|++.+.+...+..|++.+||
T Consensus        80 G~~C~~~~~~C~y~~~~~~~m~~H~~~~Hg  109 (109)
T PF12013_consen   80 GYRCQCDPPHCGYITRSKKTMRKHWRKEHG  109 (109)
T ss_pred             CeeeecCCCCCCcEeccHHHHHHHHHHhcC
Confidence            3889    9999999999999999999886


No 74 
>KOG2186|consensus
Probab=93.08  E-value=0.052  Score=33.03  Aligned_cols=46  Identities=20%  Similarity=0.537  Sum_probs=36.4

Q ss_pred             ccCCCCCccccchHHHHhhhhhhcCCCCCccCCCCCcccccchHHHHHhh
Q psy12028          2 YACDVCGKEYQHKRTLYRHKKDECGQEPKFGCPQCPYRSRQKATLNRHLG   51 (118)
Q Consensus         2 ~~C~~C~~~~~~~~~l~~h~~~~~~~~~~~~C~~c~~~f~~~~~l~~h~~   51 (118)
                      |.|..||....-.. +..|+..-++  .-|.|..|+..|.. ..+..|..
T Consensus         4 FtCnvCgEsvKKp~-vekH~srCrn--~~fSCIDC~k~F~~-~sYknH~k   49 (276)
T KOG2186|consen    4 FTCNVCGESVKKPQ-VEKHMSRCRN--AYFSCIDCGKTFER-VSYKNHTK   49 (276)
T ss_pred             Eehhhhhhhccccc-hHHHHHhccC--CeeEEeeccccccc-chhhhhhh
Confidence            78999998876654 6668887765  45999999999998 66888864


No 75 
>TIGR00622 ssl1 transcription factor ssl1. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=92.99  E-value=0.26  Score=26.37  Aligned_cols=84  Identities=13%  Similarity=0.120  Sum_probs=45.9

Q ss_pred             CCCccCCCCCcccccchHHHHHhhhhhccC-Cccc-------ccccCchhhhhhchHHHHHHHhhhcCCCCCccCCCCCC
Q psy12028         28 EPKFGCPQCPYRSRQKATLNRHLGWEQLQG-NAHV-------MYACDVCGKVYQHKQTLDRHKKDECGQEPKFECPHCPY   99 (118)
Q Consensus        28 ~~~~~C~~c~~~f~~~~~l~~h~~~~~~~~-~~~~-------~~~c~~c~~~~~~~~~l~~h~~~h~~~~~~~~C~~C~~   99 (118)
                      +-|..|+.|+........|.+-.......- -.+.       ...|-.|...|..........  -.. ...|.|+.|+.
T Consensus        13 ~LP~~CpiCgLtLVss~HLARSyHHLfPl~~f~ev~~~~~~~~~~C~~C~~~f~~~~~~~~~~--~~~-~~~y~C~~C~~   89 (112)
T TIGR00622        13 ELPVECPICGLTLILSTHLARSYHHLFPLKAFQEIPLEEYNGSRFCFGCQGPFPKPPVSPFDE--LKD-SHRYVCAVCKN   89 (112)
T ss_pred             CCCCcCCcCCCEEeccchHHHhhhccCCCcccccccccccCCCCcccCcCCCCCCcccccccc--ccc-ccceeCCCCCC
Confidence            346778888877776666655322000000 0011       123777777776542111000  112 45688999998


Q ss_pred             CCCChhHHHHHHhhh
Q psy12028        100 RSKRKDTLDRHMKII  114 (118)
Q Consensus       100 ~f~~~~~l~~H~~~~  114 (118)
                      .|-..-+.-.|...|
T Consensus        90 ~FC~dCD~fiHe~Lh  104 (112)
T TIGR00622        90 VFCVDCDVFVHESLH  104 (112)
T ss_pred             ccccccchhhhhhcc
Confidence            888777777776655


No 76 
>PF09723 Zn-ribbon_8:  Zinc ribbon domain;  InterPro: IPR013429  This entry represents a region of about 41 amino acids found in a number of small proteins in a wide range of bacteria. The region usually begins with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One protein in this entry has been noted as a putative regulatory protein, designated FmdB []. Most proteins in this entry have a C-terminal region containing highly degenerate sequence.
Probab=92.97  E-value=0.027  Score=24.52  Aligned_cols=12  Identities=42%  Similarity=1.292  Sum_probs=6.0

Q ss_pred             ccCCCCCccccc
Q psy12028          2 YACDVCGKEYQH   13 (118)
Q Consensus         2 ~~C~~C~~~~~~   13 (118)
                      |.|..||..|..
T Consensus         6 y~C~~Cg~~fe~   17 (42)
T PF09723_consen    6 YRCEECGHEFEV   17 (42)
T ss_pred             EEeCCCCCEEEE
Confidence            445555555533


No 77 
>COG4049 Uncharacterized protein containing archaeal-type C2H2 Zn-finger [General function prediction only]
Probab=92.95  E-value=0.11  Score=23.91  Aligned_cols=23  Identities=30%  Similarity=0.645  Sum_probs=15.4

Q ss_pred             CCCccCCCCCcccccchHHHHHh
Q psy12028         28 EPKFGCPQCPYRSRQKATLNRHL   50 (118)
Q Consensus        28 ~~~~~C~~c~~~f~~~~~l~~h~   50 (118)
                      +..+.||-|+..|.....+.+|+
T Consensus        15 E~~lrCPRC~~~FR~~K~Y~RHV   37 (65)
T COG4049          15 EEFLRCPRCGMVFRRRKDYIRHV   37 (65)
T ss_pred             ceeeeCCchhHHHHHhHHHHHHh
Confidence            45566777777777666666665


No 78 
>TIGR02605 CxxC_CxxC_SSSS putative regulatory protein, FmdB family. This model represents a region of about 50 amino acids found in a number of small proteins in a wide range of bacteria. The region begins usually with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One member of this family is has been noted as a putative regulatory protein, designated FmdB (PubMed:8841393). Most members of this family have a C-terminal region containing highly degenerate sequence, such as SSTSESTKSSGSSGSSGSSESKASGSTEKSTSSTTAAAAV in Mycobacterium tuberculosis and VAVGGSAPAPSPAPRAGGGGGGCCGGGCCG in Streptomyces avermitilis. These low complexity regions, which are not included in the model, resemble low-complexity C-terminal regions of some heterocycle-containing bacteriocin precursors.
Probab=92.84  E-value=0.032  Score=25.35  Aligned_cols=12  Identities=33%  Similarity=1.185  Sum_probs=7.1

Q ss_pred             ccCCCCCccccc
Q psy12028          2 YACDVCGKEYQH   13 (118)
Q Consensus         2 ~~C~~C~~~~~~   13 (118)
                      |+|..|+..|..
T Consensus         6 y~C~~Cg~~fe~   17 (52)
T TIGR02605         6 YRCTACGHRFEV   17 (52)
T ss_pred             EEeCCCCCEeEE
Confidence            556666666653


No 79 
>PF13717 zinc_ribbon_4:  zinc-ribbon domain
Probab=92.79  E-value=0.056  Score=22.69  Aligned_cols=32  Identities=19%  Similarity=0.345  Sum_probs=14.7

Q ss_pred             ccCchhhhhhchHHHHHHHhhhcCCCCCccCCCCCCCC
Q psy12028         64 ACDVCGKVYQHKQTLDRHKKDECGQEPKFECPHCPYRS  101 (118)
Q Consensus        64 ~c~~c~~~~~~~~~l~~h~~~h~~~~~~~~C~~C~~~f  101 (118)
                      .|+.|+..|.-.+..     +... ....+|+.|+..|
T Consensus         4 ~Cp~C~~~y~i~d~~-----ip~~-g~~v~C~~C~~~f   35 (36)
T PF13717_consen    4 TCPNCQAKYEIDDEK-----IPPK-GRKVRCSKCGHVF   35 (36)
T ss_pred             ECCCCCCEEeCCHHH-----CCCC-CcEEECCCCCCEe
Confidence            455555555444331     1111 3345566666544


No 80 
>TIGR02098 MJ0042_CXXC MJ0042 family finger-like domain. This domain contains a CXXCX(19)CXXC motif suggestive of both zinc fingers and thioredoxin, usually found at the N-terminus of prokaryotic proteins. One partially characterized gene, agmX, is among a large set in Myxococcus whose interruption affects adventurous gliding motility.
Probab=92.56  E-value=0.057  Score=22.78  Aligned_cols=10  Identities=20%  Similarity=0.447  Sum_probs=5.1

Q ss_pred             ccCCCCCCCC
Q psy12028         92 FECPHCPYRS  101 (118)
Q Consensus        92 ~~C~~C~~~f  101 (118)
                      ..|+.|+..|
T Consensus        26 v~C~~C~~~~   35 (38)
T TIGR02098        26 VRCGKCGHVW   35 (38)
T ss_pred             EECCCCCCEE
Confidence            4555555443


No 81 
>TIGR00373 conserved hypothetical protein TIGR00373. This family of proteins is, so far, restricted to archaeal genomes. The family appears to be distantly related to the N-terminal region of the eukaryotic transcription initiation factor IIE alpha chain.
Probab=92.41  E-value=0.12  Score=29.43  Aligned_cols=32  Identities=22%  Similarity=0.480  Sum_probs=20.0

Q ss_pred             CCCccCCCCCcccccchHHHHHhhhhhccCCcccccccCchhhhh
Q psy12028         28 EPKFGCPQCPYRSRQKATLNRHLGWEQLQGNAHVMYACDVCGKVY   72 (118)
Q Consensus        28 ~~~~~C~~c~~~f~~~~~l~~h~~~~~~~~~~~~~~~c~~c~~~~   72 (118)
                      ...|.||.|+..|.....+..             .|.|+.||...
T Consensus       107 ~~~Y~Cp~c~~r~tf~eA~~~-------------~F~Cp~Cg~~L  138 (158)
T TIGR00373       107 NMFFICPNMCVRFTFNEAMEL-------------NFTCPRCGAML  138 (158)
T ss_pred             CCeEECCCCCcEeeHHHHHHc-------------CCcCCCCCCEe
Confidence            345777777777766554431             27777777644


No 82 
>PF12013 DUF3505:  Protein of unknown function (DUF3505);  InterPro: IPR022698  This family of proteins is functionally uncharacterised. This protein is found in eukaryotes. Proteins in this family are typically between 247 to 1018 amino acids in length. This region contains two segments that are likely to be C2H2 zinc binding domains. 
Probab=92.35  E-value=0.25  Score=26.19  Aligned_cols=25  Identities=36%  Similarity=0.820  Sum_probs=22.1

Q ss_pred             ccc----CchhhhhhchHHHHHHHhhhcC
Q psy12028         63 YAC----DVCGKVYQHKQTLDRHKKDECG   87 (118)
Q Consensus        63 ~~c----~~c~~~~~~~~~l~~h~~~h~~   87 (118)
                      |.|    ..|+....+...+..|++.++|
T Consensus        81 ~~C~~~~~~C~y~~~~~~~m~~H~~~~Hg  109 (109)
T PF12013_consen   81 YRCQCDPPHCGYITRSKKTMRKHWRKEHG  109 (109)
T ss_pred             eeeecCCCCCCcEeccHHHHHHHHHHhcC
Confidence            789    8899999999999999988765


No 83 
>PRK00464 nrdR transcriptional regulator NrdR; Validated
Probab=92.19  E-value=0.042  Score=31.11  Aligned_cols=48  Identities=15%  Similarity=0.196  Sum_probs=26.6

Q ss_pred             ccCCCCCccccchHHHHhhhhhhcCCCCCccCCCCCcccccchHHHHHh
Q psy12028          2 YACDVCGKEYQHKRTLYRHKKDECGQEPKFGCPQCPYRSRQKATLNRHL   50 (118)
Q Consensus         2 ~~C~~C~~~~~~~~~l~~h~~~~~~~~~~~~C~~c~~~f~~~~~l~~h~   50 (118)
                      ++|+.||........-. -+.--....+.++|+.||..|.....+..-+
T Consensus         1 m~cp~c~~~~~~~~~s~-~~~~~~~~~~~~~c~~c~~~f~~~e~~~~~~   48 (154)
T PRK00464          1 MRCPFCGHPDTRVIDSR-PAEDGNAIRRRRECLACGKRFTTFERVELVP   48 (154)
T ss_pred             CcCCCCCCCCCEeEecc-ccCCCCceeeeeeccccCCcceEeEeccCcc
Confidence            47999997653221111 0000000123499999999998876555443


No 84 
>COG1592 Rubrerythrin [Energy production and conversion]
Probab=91.97  E-value=0.096  Score=30.05  Aligned_cols=24  Identities=38%  Similarity=0.862  Sum_probs=18.8

Q ss_pred             ccccCchhhhhhchHHHHHHHhhhcCCCCCccCCCCCC
Q psy12028         62 MYACDVCGKVYQHKQTLDRHKKDECGQEPKFECPHCPY   99 (118)
Q Consensus        62 ~~~c~~c~~~~~~~~~l~~h~~~h~~~~~~~~C~~C~~   99 (118)
                      .|.|++||.             ++-| +.|-+||+||-
T Consensus       134 ~~vC~vCGy-------------~~~g-e~P~~CPiCga  157 (166)
T COG1592         134 VWVCPVCGY-------------THEG-EAPEVCPICGA  157 (166)
T ss_pred             EEEcCCCCC-------------cccC-CCCCcCCCCCC
Confidence            589999974             3456 88899999984


No 85 
>TIGR00373 conserved hypothetical protein TIGR00373. This family of proteins is, so far, restricted to archaeal genomes. The family appears to be distantly related to the N-terminal region of the eukaryotic transcription initiation factor IIE alpha chain.
Probab=91.89  E-value=0.11  Score=29.61  Aligned_cols=30  Identities=17%  Similarity=0.492  Sum_probs=24.3

Q ss_pred             ccCCCCCccccchHHHHhhhhhhcCCCCCccCCCCCcccc
Q psy12028          2 YACDVCGKEYQHKRTLYRHKKDECGQEPKFGCPQCPYRSR   41 (118)
Q Consensus         2 ~~C~~C~~~~~~~~~l~~h~~~~~~~~~~~~C~~c~~~f~   41 (118)
                      |.|+.|+..|+...++.          .-|.||.||....
T Consensus       110 Y~Cp~c~~r~tf~eA~~----------~~F~Cp~Cg~~L~  139 (158)
T TIGR00373       110 FICPNMCVRFTFNEAME----------LNFTCPRCGAMLD  139 (158)
T ss_pred             EECCCCCcEeeHHHHHH----------cCCcCCCCCCEee
Confidence            78999999998888774          1499999997643


No 86 
>COG1997 RPL43A Ribosomal protein L37AE/L43A [Translation, ribosomal structure and biogenesis]
Probab=91.79  E-value=0.055  Score=27.37  Aligned_cols=29  Identities=24%  Similarity=0.652  Sum_probs=15.7

Q ss_pred             cccCchhhhhhchHHHHHHHhhhcCCCCCccCCCCCCCCC
Q psy12028         63 YACDVCGKVYQHKQTLDRHKKDECGQEPKFECPHCPYRSK  102 (118)
Q Consensus        63 ~~c~~c~~~~~~~~~l~~h~~~h~~~~~~~~C~~C~~~f~  102 (118)
                      |.|+.|++.        .+.+.-+|   -|.|..||..|.
T Consensus        36 ~~Cp~C~~~--------~VkR~a~G---IW~C~kCg~~fA   64 (89)
T COG1997          36 HVCPFCGRT--------TVKRIATG---IWKCRKCGAKFA   64 (89)
T ss_pred             CcCCCCCCc--------ceeeeccC---eEEcCCCCCeec
Confidence            566666653        12334333   566766766654


No 87 
>smart00531 TFIIE Transcription initiation factor IIE.
Probab=91.78  E-value=0.11  Score=29.18  Aligned_cols=38  Identities=16%  Similarity=0.439  Sum_probs=24.8

Q ss_pred             CCCccCCCCCcccccchHHHHHhhhhhccCCcccccccCchhhhhh
Q psy12028         28 EPKFGCPQCPYRSRQKATLNRHLGWEQLQGNAHVMYACDVCGKVYQ   73 (118)
Q Consensus        28 ~~~~~C~~c~~~f~~~~~l~~h~~~~~~~~~~~~~~~c~~c~~~~~   73 (118)
                      ...|.||.|+..|.....+..-      ..  ...|.|+.|+....
T Consensus        97 ~~~Y~Cp~C~~~y~~~ea~~~~------d~--~~~f~Cp~Cg~~l~  134 (147)
T smart00531       97 NAYYKCPNCQSKYTFLEANQLL------DM--DGTFTCPRCGEELE  134 (147)
T ss_pred             CcEEECcCCCCEeeHHHHHHhc------CC--CCcEECCCCCCEEE
Confidence            4569999999888865433321      11  23389999987653


No 88 
>smart00614 ZnF_BED BED zinc finger. DNA-binding domain in chromatin-boundary-element-binding proteins and transposases
Probab=91.71  E-value=0.18  Score=22.74  Aligned_cols=24  Identities=29%  Similarity=0.602  Sum_probs=14.9

Q ss_pred             ccCCCCCCCCCCh-----hHHHHHHhhhc
Q psy12028         92 FECPHCPYRSKRK-----DTLDRHMKIIH  115 (118)
Q Consensus        92 ~~C~~C~~~f~~~-----~~l~~H~~~~~  115 (118)
                      -.|..|++.++..     +.|.+|+...+
T Consensus        19 a~C~~C~~~l~~~~~~gTs~L~rHl~~~h   47 (50)
T smart00614       19 AKCKYCGKKLSRSSKGGTSNLRRHLRRKH   47 (50)
T ss_pred             EEecCCCCEeeeCCCCCcHHHHHHHHhHC
Confidence            4577777665443     57777777433


No 89 
>PRK00398 rpoP DNA-directed RNA polymerase subunit P; Provisional
Probab=91.67  E-value=0.074  Score=23.55  Aligned_cols=11  Identities=45%  Similarity=1.259  Sum_probs=6.6

Q ss_pred             ccCCCCCcccc
Q psy12028          2 YACDVCGKEYQ   12 (118)
Q Consensus         2 ~~C~~C~~~~~   12 (118)
                      |.|+.||..+.
T Consensus         4 y~C~~CG~~~~   14 (46)
T PRK00398          4 YKCARCGREVE   14 (46)
T ss_pred             EECCCCCCEEE
Confidence            56666666553


No 90 
>KOG2186|consensus
Probab=91.34  E-value=0.13  Score=31.34  Aligned_cols=47  Identities=21%  Similarity=0.586  Sum_probs=29.3

Q ss_pred             CccCCCCCcccccchHHHHHhhhhhccCCcccccccCchhhhhhchHHHHHHHh
Q psy12028         30 KFGCPQCPYRSRQKATLNRHLGWEQLQGNAHVMYACDVCGKVYQHKQTLDRHKK   83 (118)
Q Consensus        30 ~~~C~~c~~~f~~~~~l~~h~~~~~~~~~~~~~~~c~~c~~~~~~~~~l~~h~~   83 (118)
                      .|.|..||....-. .+..|+    ..+.+ ..|.|..|+..|.+ ..+..|..
T Consensus         3 ~FtCnvCgEsvKKp-~vekH~----srCrn-~~fSCIDC~k~F~~-~sYknH~k   49 (276)
T KOG2186|consen    3 FFTCNVCGESVKKP-QVEKHM----SRCRN-AYFSCIDCGKTFER-VSYKNHTK   49 (276)
T ss_pred             EEehhhhhhhcccc-chHHHH----HhccC-CeeEEeeccccccc-chhhhhhh
Confidence            36788888777654 355564    34444 45778888888776 44455543


No 91 
>PRK06266 transcription initiation factor E subunit alpha; Validated
Probab=91.28  E-value=0.14  Score=29.84  Aligned_cols=33  Identities=24%  Similarity=0.621  Sum_probs=23.0

Q ss_pred             CCCccCCCCCcccccchHHHHHhhhhhccCCcccccccCchhhhhh
Q psy12028         28 EPKFGCPQCPYRSRQKATLNRHLGWEQLQGNAHVMYACDVCGKVYQ   73 (118)
Q Consensus        28 ~~~~~C~~c~~~f~~~~~l~~h~~~~~~~~~~~~~~~c~~c~~~~~   73 (118)
                      ...|.||.|+..|.....+..             .|.|+.||....
T Consensus       115 ~~~Y~Cp~C~~rytf~eA~~~-------------~F~Cp~Cg~~L~  147 (178)
T PRK06266        115 NMFFFCPNCHIRFTFDEAMEY-------------GFRCPQCGEMLE  147 (178)
T ss_pred             CCEEECCCCCcEEeHHHHhhc-------------CCcCCCCCCCCe
Confidence            356889888888877665432             178888886543


No 92 
>TIGR02300 FYDLN_acid conserved hypothetical protein TIGR02300. Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues. The function of members of this family is unknown.
Probab=91.07  E-value=0.18  Score=27.48  Aligned_cols=13  Identities=8%  Similarity=-0.205  Sum_probs=6.0

Q ss_pred             CCccCCCCCcccc
Q psy12028         29 PKFGCPQCPYRSR   41 (118)
Q Consensus        29 ~~~~C~~c~~~f~   41 (118)
                      .|..||.||..|.
T Consensus        25 ~p~vcP~cg~~~~   37 (129)
T TIGR02300        25 RPAVSPYTGEQFP   37 (129)
T ss_pred             CCccCCCcCCccC
Confidence            3444555554443


No 93 
>PF02892 zf-BED:  BED zinc finger;  InterPro: IPR003656 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents predicted BED-type zinc finger domains. The BED finger which was named after the Drosophila proteins BEAF and DREF, is found in one or more copies in cellular regulatory factors and transposases from plants, animals and fungi. The BED finger is an about 50 to 60 amino acid residues domain that contains a characteristic motif with two highly conserved aromatic positions, as well as a shared pattern of cysteines and histidines that is predicted to form a zinc finger. As diverse BED fingers are able to bind DNA, it has been suggested that DNA-binding is the general function of this domain []. Some proteins known to contain a BED domain include animal, plant and fungi AC1 and Hobo-like transposases; Caenorhabditis elegans Dpy-20 protein, a predicted cuticular gene transcriptional regulator; Drosophila BEAF (boundary element-associated factor), thought to be involved in chromatin insulation; Drosophila DREF, a transcriptional regulator for S-phase genes; and tobacco 3AF1 and tomato E4/E8-BP1, light- and ethylene-regulated DNA binding proteins that contain two BED fingers. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003677 DNA binding; PDB: 2DJR_A 2CT5_A.
Probab=91.00  E-value=0.14  Score=22.40  Aligned_cols=27  Identities=33%  Similarity=0.506  Sum_probs=14.9

Q ss_pred             CCCccCCCCCCCCCC----hhHHHHHHhhhc
Q psy12028         89 EPKFECPHCPYRSKR----KDTLDRHMKIIH  115 (118)
Q Consensus        89 ~~~~~C~~C~~~f~~----~~~l~~H~~~~~  115 (118)
                      .....|..|++.+..    .+.|.+|++..|
T Consensus        14 ~~~a~C~~C~~~~~~~~~~ts~l~~HL~~~h   44 (45)
T PF02892_consen   14 KKKAKCKYCGKVIKYSSGGTSNLKRHLKKKH   44 (45)
T ss_dssp             SS-EEETTTTEE-----SSTHHHHHHHHHTT
T ss_pred             cCeEEeCCCCeEEeeCCCcHHHHHHhhhhhC
Confidence            455677777765544    467777775443


No 94 
>PRK06266 transcription initiation factor E subunit alpha; Validated
Probab=90.95  E-value=0.19  Score=29.31  Aligned_cols=30  Identities=23%  Similarity=0.813  Sum_probs=18.9

Q ss_pred             cccccCchhhhhhchHHHHHHHhhhcCCCCCccCCCCCCC
Q psy12028         61 VMYACDVCGKVYQHKQTLDRHKKDECGQEPKFECPHCPYR  100 (118)
Q Consensus        61 ~~~~c~~c~~~~~~~~~l~~h~~~h~~~~~~~~C~~C~~~  100 (118)
                      .-|.|+.|+..|+.-.++.      .+    |.|+.||-.
T Consensus       116 ~~Y~Cp~C~~rytf~eA~~------~~----F~Cp~Cg~~  145 (178)
T PRK06266        116 MFFFCPNCHIRFTFDEAME------YG----FRCPQCGEM  145 (178)
T ss_pred             CEEECCCCCcEEeHHHHhh------cC----CcCCCCCCC
Confidence            3467777777776665542      24    677777754


No 95 
>smart00659 RPOLCX RNA polymerase subunit CX. present in RNA polymerase I, II and III
Probab=90.63  E-value=0.19  Score=22.14  Aligned_cols=26  Identities=38%  Similarity=0.966  Sum_probs=14.9

Q ss_pred             ccCCCCCccccchHHHHhhhhhhcCCCCCccCCCCCcc
Q psy12028          2 YACDVCGKEYQHKRTLYRHKKDECGQEPKFGCPQCPYR   39 (118)
Q Consensus         2 ~~C~~C~~~~~~~~~l~~h~~~~~~~~~~~~C~~c~~~   39 (118)
                      |.|..||..|...           . ..+..|+.||..
T Consensus         3 Y~C~~Cg~~~~~~-----------~-~~~irC~~CG~r   28 (44)
T smart00659        3 YICGECGRENEIK-----------S-KDVVRCRECGYR   28 (44)
T ss_pred             EECCCCCCEeecC-----------C-CCceECCCCCce
Confidence            5677777665432           1 334677777643


No 96 
>PF09845 DUF2072:  Zn-ribbon containing protein (DUF2072);  InterPro: IPR018645  This archaeal Zinc-ribbon containing proteins have no known function. 
Probab=90.62  E-value=0.13  Score=28.22  Aligned_cols=28  Identities=29%  Similarity=0.710  Sum_probs=19.2

Q ss_pred             CccCCCCCccccchHHHHhhhhhhcCCCCCccCCCCCcc
Q psy12028          1 MYACDVCGKEYQHKRTLYRHKKDECGQEPKFGCPQCPYR   39 (118)
Q Consensus         1 ~~~C~~C~~~~~~~~~l~~h~~~~~~~~~~~~C~~c~~~   39 (118)
                      |++|..||+.|.+-+.           +-.-.||.||-.
T Consensus         1 PH~Ct~Cg~~f~dgs~-----------eil~GCP~CGg~   28 (131)
T PF09845_consen    1 PHQCTKCGRVFEDGSK-----------EILSGCPECGGN   28 (131)
T ss_pred             CcccCcCCCCcCCCcH-----------HHHccCcccCCc
Confidence            7889999999976442           112468888843


No 97 
>PF05443 ROS_MUCR:  ROS/MUCR transcriptional regulator protein;  InterPro: IPR008807 This family consists of several ROS/MUCR transcriptional regulator proteins. The ros chromosomal gene is present in octopine and nopaline strains of Agrobacterium tumefaciens as well as in Rhizobium meliloti (Sinorhizobium meliloti). This gene encodes a 15.5 kDa protein that specifically represses the virC and virD operons in the virulence region of the Ti plasmid [] and is necessary for succinoglycan production []. S. meliloti can produce two types of acidic exopolysaccharides, succinoglycan and galactoglucan, that are interchangeable for infection of Medicago sativa (Alfalfa) nodules. MucR from S. meliloti acts as a transcriptional repressor that blocks the expression of the exp genes responsible for galactoglucan production therefore allowing the exclusive production of succinoglycan [].; GO: 0003677 DNA binding, 0008270 zinc ion binding, 0006355 regulation of transcription, DNA-dependent; PDB: 2JSP_A.
Probab=90.56  E-value=0.12  Score=28.48  Aligned_cols=25  Identities=28%  Similarity=0.454  Sum_probs=15.2

Q ss_pred             CCCccCCCCCCCCCChhHHHHHHhhhcC
Q psy12028         89 EPKFECPHCPYRSKRKDTLDRHMKIIHF  116 (118)
Q Consensus        89 ~~~~~C~~C~~~f~~~~~l~~H~~~~~~  116 (118)
                      .....|-+||+.|..   |.+|++.|||
T Consensus        70 ~d~i~clecGk~~k~---LkrHL~~~~g   94 (132)
T PF05443_consen   70 PDYIICLECGKKFKT---LKRHLRTHHG   94 (132)
T ss_dssp             SS-EE-TBT--EESB---HHHHHHHTT-
T ss_pred             cCeeEEccCCcccch---HHHHHHHccC
Confidence            345779999998864   4899988876


No 98 
>smart00734 ZnF_Rad18 Rad18-like CCHC zinc finger. Yeast Rad18p functions with Rad5p in error-free post-replicative DNA repair. This zinc finger is likely to bind nucleic-acids.
Probab=89.48  E-value=0.48  Score=18.26  Aligned_cols=19  Identities=21%  Similarity=0.691  Sum_probs=12.4

Q ss_pred             cCCCCCCCCCChhHHHHHHh
Q psy12028         93 ECPHCPYRSKRKDTLDRHMK  112 (118)
Q Consensus        93 ~C~~C~~~f~~~~~l~~H~~  112 (118)
                      .|++|++.. ....+..|+.
T Consensus         3 ~CPiC~~~v-~~~~in~HLD   21 (26)
T smart00734        3 QCPVCFREV-PENLINSHLD   21 (26)
T ss_pred             cCCCCcCcc-cHHHHHHHHH
Confidence            577777776 4556666654


No 99 
>COG3357 Predicted transcriptional regulator containing an HTH domain fused to a Zn-ribbon [Transcription]
Probab=88.94  E-value=0.26  Score=25.21  Aligned_cols=14  Identities=21%  Similarity=0.615  Sum_probs=11.1

Q ss_pred             CCccCCCCCccccc
Q psy12028         29 PKFGCPQCPYRSRQ   42 (118)
Q Consensus        29 ~~~~C~~c~~~f~~   42 (118)
                      .|..|..||..|..
T Consensus        57 ~Pa~CkkCGfef~~   70 (97)
T COG3357          57 RPARCKKCGFEFRD   70 (97)
T ss_pred             cChhhcccCccccc
Confidence            56788888888876


No 100
>KOG4167|consensus
Probab=88.73  E-value=0.069  Score=37.35  Aligned_cols=25  Identities=24%  Similarity=0.535  Sum_probs=23.1

Q ss_pred             ccCCCCCccccchHHHHhhhhhhcC
Q psy12028          2 YACDVCGKEYQHKRTLYRHKKDECG   26 (118)
Q Consensus         2 ~~C~~C~~~~~~~~~l~~h~~~~~~   26 (118)
                      |.|.+|+++|....++..||++|..
T Consensus       793 FpCreC~kvF~KiKSrNAHMK~Hr~  817 (907)
T KOG4167|consen  793 FPCRECGKVFFKIKSRNAHMKTHRQ  817 (907)
T ss_pred             eehHHHHHHHHHHhhhhHHHHHHHH
Confidence            7899999999999999999999864


No 101
>PF14353 CpXC:  CpXC protein
Probab=88.67  E-value=0.38  Score=26.29  Aligned_cols=48  Identities=27%  Similarity=0.442  Sum_probs=28.0

Q ss_pred             ccCCCCCccccchHHHHh--------hhhhhcCCCCCccCCCCCcccccchHHHHH
Q psy12028          2 YACDVCGKEYQHKRTLYR--------HKKDECGQEPKFGCPQCPYRSRQKATLNRH   49 (118)
Q Consensus         2 ~~C~~C~~~~~~~~~l~~--------h~~~~~~~~~~~~C~~c~~~f~~~~~l~~h   49 (118)
                      ..|+.|+..|........        -.+.-.+.-..+.||.||..|.-...+.-|
T Consensus         2 itCP~C~~~~~~~v~~~I~~~~~p~l~e~il~g~l~~~~CP~Cg~~~~~~~p~lY~   57 (128)
T PF14353_consen    2 ITCPHCGHEFEFEVWTSINADEDPELKEKILDGSLFSFTCPSCGHKFRLEYPLLYH   57 (128)
T ss_pred             cCCCCCCCeeEEEEEeEEcCcCCHHHHHHHHcCCcCEEECCCCCCceecCCCEEEE
Confidence            368999888754322111        112223334569999999988765544433


No 102
>KOG2893|consensus
Probab=88.56  E-value=0.09  Score=31.85  Aligned_cols=41  Identities=24%  Similarity=0.536  Sum_probs=18.8

Q ss_pred             cCchhhhhhchHHHHHHHhhhcCCCCCccCCCCCCCCCChhHHHHH
Q psy12028         65 CDVCGKVYQHKQTLDRHKKDECGQEPKFECPHCPYRSKRKDTLDRH  110 (118)
Q Consensus        65 c~~c~~~~~~~~~l~~h~~~h~~~~~~~~C~~C~~~f~~~~~l~~H  110 (118)
                      |=+|++.|.+...|..|+.     .+-|+|.+|.|..-+--.|..|
T Consensus        13 cwycnrefddekiliqhqk-----akhfkchichkkl~sgpglsih   53 (341)
T KOG2893|consen   13 CWYCNREFDDEKILIQHQK-----AKHFKCHICHKKLFSGPGLSIH   53 (341)
T ss_pred             eeecccccchhhhhhhhhh-----hccceeeeehhhhccCCCceee
Confidence            3345555555555544432     2345555555443333333333


No 103
>PF03604 DNA_RNApol_7kD:  DNA directed RNA polymerase, 7 kDa subunit;  InterPro: IPR006591 DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Each class of RNA polymerase is assembled from 9 to 15 different polypeptides. Rbp10 (RNA polymerase CX) is a domain found in RNA polymerase subunit 10; present in RNA polymerase I, II and III.; GO: 0003677 DNA binding, 0003899 DNA-directed RNA polymerase activity, 0006351 transcription, DNA-dependent; PDB: 2PMZ_Z 3HKZ_X 2NVX_L 3S1Q_L 2JA6_L 3S17_L 3HOW_L 3HOV_L 3PO2_L 3HOZ_L ....
Probab=88.55  E-value=0.34  Score=19.75  Aligned_cols=26  Identities=38%  Similarity=0.907  Sum_probs=14.3

Q ss_pred             ccCCCCCccccchHHHHhhhhhhcCCCCCccCCCCCcc
Q psy12028          2 YACDVCGKEYQHKRTLYRHKKDECGQEPKFGCPQCPYR   39 (118)
Q Consensus         2 ~~C~~C~~~~~~~~~l~~h~~~~~~~~~~~~C~~c~~~   39 (118)
                      |.|..|+..+...            ...+..|+.||..
T Consensus         1 Y~C~~Cg~~~~~~------------~~~~irC~~CG~R   26 (32)
T PF03604_consen    1 YICGECGAEVELK------------PGDPIRCPECGHR   26 (32)
T ss_dssp             EBESSSSSSE-BS------------TSSTSSBSSSS-S
T ss_pred             CCCCcCCCeeEcC------------CCCcEECCcCCCe
Confidence            5677777766411            1234678888754


No 104
>PF10571 UPF0547:  Uncharacterised protein family UPF0547;  InterPro: IPR018886  This domain may well be a type of zinc-finger as it carries two pairs of highly conserved cysteine residues though with no accompanying histidines. Several members are annotated as putative helicases. 
Probab=88.46  E-value=0.31  Score=18.83  Aligned_cols=10  Identities=50%  Similarity=1.231  Sum_probs=6.5

Q ss_pred             cCCCCCCCCC
Q psy12028         93 ECPHCPYRSK  102 (118)
Q Consensus        93 ~C~~C~~~f~  102 (118)
                      .|+.||+.|.
T Consensus        16 ~Cp~CG~~F~   25 (26)
T PF10571_consen   16 FCPHCGYDFE   25 (26)
T ss_pred             cCCCCCCCCc
Confidence            5677776664


No 105
>PF04959 ARS2:  Arsenite-resistance protein 2;  InterPro: IPR007042 This entry represents Arsenite-resistance protein 2 (also known as Serrate RNA effector molecule homolog) which is thought to play a role in arsenite resistance [], although does not directly confer arsenite resistance but rather modulates arsenic sensitivity []. Arsenite is a carcinogenic compound which can act as a comutagen by inhibiting DNA repair. It is also involved in cell cycle progression at S phase. ; PDB: 3AX1_A.
Probab=87.97  E-value=0.2  Score=30.07  Aligned_cols=29  Identities=28%  Similarity=0.450  Sum_probs=22.7

Q ss_pred             CCCccCCCCCCCCCChhHHHHHHhhhcCC
Q psy12028         89 EPKFECPHCPYRSKRKDTLDRHMKIIHFS  117 (118)
Q Consensus        89 ~~~~~C~~C~~~f~~~~~l~~H~~~~~~~  117 (118)
                      +..|.|..|+|.|.-..-..+|+...|.|
T Consensus        75 ~~K~~C~lc~KlFkg~eFV~KHI~nKH~e  103 (214)
T PF04959_consen   75 EDKWRCPLCGKLFKGPEFVRKHIFNKHPE  103 (214)
T ss_dssp             SEEEEE-SSS-EESSHHHHHHHHHHH-HH
T ss_pred             CCEECCCCCCcccCChHHHHHHHhhcCHH
Confidence            55699999999999999999999888865


No 106
>PF06524 NOA36:  NOA36 protein;  InterPro: IPR010531 This family consists of several NOA36 proteins which contain 29 highly conserved cysteine residues. The function of this protein is unknown.; GO: 0008270 zinc ion binding, 0005634 nucleus
Probab=87.23  E-value=0.27  Score=30.27  Aligned_cols=26  Identities=19%  Similarity=0.526  Sum_probs=18.8

Q ss_pred             CCCccCCCCCCCCCChhHHHHHHhhh
Q psy12028         89 EPKFECPHCPYRSKRKDTLDRHMKII  114 (118)
Q Consensus        89 ~~~~~C~~C~~~f~~~~~l~~H~~~~  114 (118)
                      .+++.|+.||+.......|..-.++|
T Consensus       207 ~k~~PCPKCg~et~eTkdLSmStR~h  232 (314)
T PF06524_consen  207 GKPIPCPKCGYETQETKDLSMSTRSH  232 (314)
T ss_pred             CCCCCCCCCCCcccccccceeeeecc
Confidence            56889999998877776666554443


No 107
>COG5188 PRP9 Splicing factor 3a, subunit 3 [RNA processing and modification]
Probab=86.29  E-value=0.54  Score=30.33  Aligned_cols=23  Identities=39%  Similarity=0.834  Sum_probs=18.7

Q ss_pred             CCCccCCCCC-CCCCChhHHHHHH
Q psy12028         89 EPKFECPHCP-YRSKRKDTLDRHM  111 (118)
Q Consensus        89 ~~~~~C~~C~-~~f~~~~~l~~H~  111 (118)
                      .+.|.|.+|| +.+.-+..+.+|.
T Consensus       372 d~ef~CEICgNyvy~GR~~FdrHF  395 (470)
T COG5188         372 DIEFECEICGNYVYYGRDRFDRHF  395 (470)
T ss_pred             CcceeeeecccccccchHHHHhhh
Confidence            6779999998 7777777787775


No 108
>PF08274 PhnA_Zn_Ribbon:  PhnA Zinc-Ribbon ;  InterPro: IPR013987 The PhnA protein family includes the uncharacterised Escherichia coli protein PhnA and its homologues. The E. coli phnA gene is part of a large operon associated with alkylphosphonate uptake and carbon-phosphorus bond cleavage []. The protein is not related to the characterised phosphonoacetate hydrolase designated PhnA []. This entry represents the N-terminal domain of PhnA, which is predicted to form a zinc-ribbon.; PDB: 2AKL_A.
Probab=86.24  E-value=0.32  Score=19.53  Aligned_cols=26  Identities=31%  Similarity=0.738  Sum_probs=10.8

Q ss_pred             cCCCCCccccchHHHHhhhhhhcCCCCCccCCCCCccc
Q psy12028          3 ACDVCGKEYQHKRTLYRHKKDECGQEPKFGCPQCPYRS   40 (118)
Q Consensus         3 ~C~~C~~~~~~~~~l~~h~~~~~~~~~~~~C~~c~~~f   40 (118)
                      +|+.|+..+.-           .. ...+.|+.|+..+
T Consensus         4 ~Cp~C~se~~y-----------~D-~~~~vCp~C~~ew   29 (30)
T PF08274_consen    4 KCPLCGSEYTY-----------ED-GELLVCPECGHEW   29 (30)
T ss_dssp             --TTT-----E-----------E--SSSEEETTTTEEE
T ss_pred             CCCCCCCccee-----------cc-CCEEeCCcccccC
Confidence            46666655543           12 4457777776543


No 109
>TIGR01206 lysW lysine biosynthesis protein LysW. This very small, poorly characterized protein has been shown essential in Thermus thermophilus for an unusual pathway of Lys biosynthesis from aspartate by way of alpha-aminoadipate (AAA) rather than diaminopimelate. It is found also in Deinococcus radiodurans and Pyrococcus horikoshii, which appear to share the AAA pathway.
Probab=86.16  E-value=0.33  Score=22.40  Aligned_cols=31  Identities=23%  Similarity=0.530  Sum_probs=15.4

Q ss_pred             ccCCCCCccccchHHHHhhhhhhcCCCCCccCCCCCcccc
Q psy12028          2 YACDVCGKEYQHKRTLYRHKKDECGQEPKFGCPQCPYRSR   41 (118)
Q Consensus         2 ~~C~~C~~~~~~~~~l~~h~~~~~~~~~~~~C~~c~~~f~   41 (118)
                      |+|+.||..+.-....       .+  -...|+.||..+.
T Consensus         3 ~~CP~CG~~iev~~~~-------~G--eiV~Cp~CGaele   33 (54)
T TIGR01206         3 FECPDCGAEIELENPE-------LG--ELVICDECGAELE   33 (54)
T ss_pred             cCCCCCCCEEecCCCc-------cC--CEEeCCCCCCEEE
Confidence            5677777655332211       01  2356777765543


No 110
>smart00440 ZnF_C2C2 C2C2 Zinc finger. Nucleic-acid-binding motif in transcriptional elongation factor TFIIS and RNA polymerases.
Probab=86.08  E-value=0.1  Score=22.41  Aligned_cols=11  Identities=27%  Similarity=0.627  Sum_probs=6.9

Q ss_pred             CccCCCCCccc
Q psy12028         30 KFGCPQCPYRS   40 (118)
Q Consensus        30 ~~~C~~c~~~f   40 (118)
                      .|.|..|+..|
T Consensus        28 fy~C~~C~~~w   38 (40)
T smart00440       28 FYVCTKCGHRW   38 (40)
T ss_pred             EEEeCCCCCEe
Confidence            36676676555


No 111
>COG1996 RPC10 DNA-directed RNA polymerase, subunit RPC10 (contains C4-type Zn-finger) [Transcription]
Probab=86.00  E-value=0.36  Score=21.77  Aligned_cols=10  Identities=50%  Similarity=1.328  Sum_probs=6.0

Q ss_pred             ccCCCCCccc
Q psy12028          2 YACDVCGKEY   11 (118)
Q Consensus         2 ~~C~~C~~~~   11 (118)
                      |.|..||+.|
T Consensus         7 Y~C~~Cg~~~   16 (49)
T COG1996           7 YKCARCGREV   16 (49)
T ss_pred             EEhhhcCCee
Confidence            5566666655


No 112
>PF13878 zf-C2H2_3:  zinc-finger of acetyl-transferase ESCO
Probab=85.46  E-value=1.1  Score=19.36  Aligned_cols=22  Identities=32%  Similarity=0.543  Sum_probs=12.7

Q ss_pred             cCCCCCcccc--chHHHHhhhhhh
Q psy12028          3 ACDVCGKEYQ--HKRTLYRHKKDE   24 (118)
Q Consensus         3 ~C~~C~~~~~--~~~~l~~h~~~~   24 (118)
                      +|+.||.+|.  ....-..|.+-|
T Consensus        15 ~C~~CgM~Y~~~~~eD~~~H~~yH   38 (41)
T PF13878_consen   15 TCPTCGMLYSPGSPEDEKLHKKYH   38 (41)
T ss_pred             CCCCCCCEECCCCHHHHHHHHHHH
Confidence            5777777764  444455555444


No 113
>PHA00626 hypothetical protein
Probab=85.36  E-value=0.5  Score=21.86  Aligned_cols=15  Identities=20%  Similarity=0.740  Sum_probs=12.1

Q ss_pred             CCCccCCCCCCCCCC
Q psy12028         89 EPKFECPHCPYRSKR  103 (118)
Q Consensus        89 ~~~~~C~~C~~~f~~  103 (118)
                      ...|+|+.||+.|+.
T Consensus        21 snrYkCkdCGY~ft~   35 (59)
T PHA00626         21 SDDYVCCDCGYNDSK   35 (59)
T ss_pred             CcceEcCCCCCeech
Confidence            457999999998864


No 114
>COG4957 Predicted transcriptional regulator [Transcription]
Probab=84.90  E-value=0.66  Score=25.64  Aligned_cols=22  Identities=23%  Similarity=0.206  Sum_probs=17.6

Q ss_pred             ccCCCCCCCCCChhHHHHHHhhhcC
Q psy12028         92 FECPHCPYRSKRKDTLDRHMKIIHF  116 (118)
Q Consensus        92 ~~C~~C~~~f~~~~~l~~H~~~~~~  116 (118)
                      +.|..+|+.|.   .|++|+.+|++
T Consensus        77 IicLEDGkkfK---SLKRHL~t~~g   98 (148)
T COG4957          77 IICLEDGKKFK---SLKRHLTTHYG   98 (148)
T ss_pred             EEEeccCcchH---HHHHHHhcccC
Confidence            67888998874   68899888765


No 115
>PF07754 DUF1610:  Domain of unknown function (DUF1610);  InterPro: IPR011668 This domain is found in archaeal species. It is likely to bind zinc via its four well-conserved cysteine residues.
Probab=84.29  E-value=0.51  Score=17.89  Aligned_cols=11  Identities=36%  Similarity=1.144  Sum_probs=8.5

Q ss_pred             CCCccCCCCCc
Q psy12028         28 EPKFGCPQCPY   38 (118)
Q Consensus        28 ~~~~~C~~c~~   38 (118)
                      ...|.||.||+
T Consensus        14 ~v~f~CPnCG~   24 (24)
T PF07754_consen   14 AVPFPCPNCGF   24 (24)
T ss_pred             CceEeCCCCCC
Confidence            35699999984


No 116
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only]
Probab=84.24  E-value=1.8  Score=28.08  Aligned_cols=21  Identities=24%  Similarity=0.422  Sum_probs=10.8

Q ss_pred             CCCCCccccchHHHHhhhhhh
Q psy12028          4 CDVCGKEYQHKRTLYRHKKDE   24 (118)
Q Consensus         4 C~~C~~~~~~~~~l~~h~~~~   24 (118)
                      |..|.+-|-+...|..|++..
T Consensus       223 C~FC~~~FYdDDEL~~HcR~~  243 (493)
T COG5236         223 CIFCKIYFYDDDELRRHCRLR  243 (493)
T ss_pred             hhhccceecChHHHHHHHHhh
Confidence            444555555555555555443


No 117
>KOG2893|consensus
Probab=84.17  E-value=0.28  Score=29.85  Aligned_cols=41  Identities=27%  Similarity=0.614  Sum_probs=29.8

Q ss_pred             CCCCCccccchHHHHhhhhhhcCCCCCccCCCCCcccccchHHHHH
Q psy12028          4 CDVCGKEYQHKRTLYRHKKDECGQEPKFGCPQCPYRSRQKATLNRH   49 (118)
Q Consensus         4 C~~C~~~~~~~~~l~~h~~~~~~~~~~~~C~~c~~~f~~~~~l~~h   49 (118)
                      |=.|+..|.+...|..|++     .+-|.|.+|-+...+--.|..|
T Consensus        13 cwycnrefddekiliqhqk-----akhfkchichkkl~sgpglsih   53 (341)
T KOG2893|consen   13 CWYCNREFDDEKILIQHQK-----AKHFKCHICHKKLFSGPGLSIH   53 (341)
T ss_pred             eeecccccchhhhhhhhhh-----hccceeeeehhhhccCCCceee
Confidence            4568888988888888875     3458888888776555555555


No 118
>PF09963 DUF2197:  Uncharacterized protein conserved in bacteria (DUF2197);  InterPro: IPR019241  This family represents various hypothetical bacterial proteins with no known function. 
Probab=83.98  E-value=0.27  Score=22.85  Aligned_cols=9  Identities=33%  Similarity=0.907  Sum_probs=4.5

Q ss_pred             CCCCCcccc
Q psy12028          4 CDVCGKEYQ   12 (118)
Q Consensus         4 C~~C~~~~~   12 (118)
                      |..|++.+.
T Consensus         5 C~lCdk~~~   13 (56)
T PF09963_consen    5 CILCDKKEE   13 (56)
T ss_pred             EEecCCEEE
Confidence            455555543


No 119
>KOG2785|consensus
Probab=83.68  E-value=1.6  Score=28.57  Aligned_cols=49  Identities=20%  Similarity=0.316  Sum_probs=39.1

Q ss_pred             cCCCCCccccchHHHHhhhhhhcCC----------------------CCCccCCCCC---cccccchHHHHHhh
Q psy12028          3 ACDVCGKEYQHKRTLYRHKKDECGQ----------------------EPKFGCPQCP---YRSRQKATLNRHLG   51 (118)
Q Consensus         3 ~C~~C~~~~~~~~~l~~h~~~~~~~----------------------~~~~~C~~c~---~~f~~~~~l~~h~~   51 (118)
                      .|-.|++.+.+...-..||..+++-                      ..-+.|-.|.   ..|.+....+.||.
T Consensus       168 ~CLfC~~~~k~~e~~~~HM~~~HgffIPdreYL~D~~GLl~YLgeKV~~~~~CL~CN~~~~~f~sleavr~HM~  241 (390)
T KOG2785|consen  168 DCLFCDKKSKSLEENLKHMFKEHGFFIPDREYLTDEKGLLKYLGEKVGIGFICLFCNELGRPFSSLEAVRAHMR  241 (390)
T ss_pred             ceeecCCCcccHHHHHHHHhhccCCcCCchHhhhchhHHHHHHHHHhccCceEEEeccccCcccccHHHHHHHh
Confidence            4778999999999999999988862                      1126777777   88888888888987


No 120
>TIGR00686 phnA alkylphosphonate utilization operon protein PhnA. The protein family includes an uncharacterized member designated phnA in Escherichia coli, part of a large operon associated with alkylphosphonate uptake and carbon-phosphorus bond cleavage. This protein is not related to the characterized phosphonoacetate hydrolase designated PhnA by Kulakova, et al. (2001, 1997).
Probab=83.61  E-value=0.7  Score=24.51  Aligned_cols=30  Identities=27%  Similarity=0.727  Sum_probs=21.8

Q ss_pred             cCCCCCccccchHHHHhhhhhhcCCCCCccCCCCCcccccch
Q psy12028          3 ACDVCGKEYQHKRTLYRHKKDECGQEPKFGCPQCPYRSRQKA   44 (118)
Q Consensus         3 ~C~~C~~~~~~~~~l~~h~~~~~~~~~~~~C~~c~~~f~~~~   44 (118)
                      .|+.|+..|....            ...|.||.|+..|....
T Consensus         4 ~CP~C~seytY~d------------g~~~iCpeC~~EW~~~~   33 (109)
T TIGR00686         4 PCPKCNSEYTYHD------------GTQLICPSCLYEWNENE   33 (109)
T ss_pred             cCCcCCCcceEec------------CCeeECccccccccccc
Confidence            5888887765432            34699999999987653


No 121
>PF15269 zf-C2H2_7:  Zinc-finger
Probab=83.42  E-value=0.88  Score=20.00  Aligned_cols=19  Identities=26%  Similarity=0.508  Sum_probs=8.6

Q ss_pred             cCCCCCccccchHHHHhhh
Q psy12028          3 ACDVCGKEYQHKRTLYRHK   21 (118)
Q Consensus         3 ~C~~C~~~~~~~~~l~~h~   21 (118)
                      +|-+|..+...++.|.+||
T Consensus        22 kcfqcpftc~~kshl~nhm   40 (54)
T PF15269_consen   22 KCFQCPFTCNEKSHLFNHM   40 (54)
T ss_pred             eeecCCcccchHHHHHHHH
Confidence            3444444444444444444


No 122
>COG3364 Zn-ribbon containing protein [General function prediction only]
Probab=83.10  E-value=0.86  Score=23.90  Aligned_cols=14  Identities=21%  Similarity=0.653  Sum_probs=9.4

Q ss_pred             CccCCCCCccccch
Q psy12028          1 MYACDVCGKEYQHK   14 (118)
Q Consensus         1 ~~~C~~C~~~~~~~   14 (118)
                      |+.|.-||.+|.+-
T Consensus         2 pH~CtrCG~vf~~g   15 (112)
T COG3364           2 PHQCTRCGEVFDDG   15 (112)
T ss_pred             Cceecccccccccc
Confidence            56677777777653


No 123
>PF13453 zf-TFIIB:  Transcription factor zinc-finger
Probab=82.87  E-value=0.63  Score=19.98  Aligned_cols=21  Identities=19%  Similarity=0.200  Sum_probs=13.5

Q ss_pred             CCCccCCCCCcccccchHHHH
Q psy12028         28 EPKFGCPQCPYRSRQKATLNR   48 (118)
Q Consensus        28 ~~~~~C~~c~~~f~~~~~l~~   48 (118)
                      .....|+.|+-.|.....|..
T Consensus        17 ~~id~C~~C~G~W~d~~el~~   37 (41)
T PF13453_consen   17 VEIDVCPSCGGIWFDAGELEK   37 (41)
T ss_pred             EEEEECCCCCeEEccHHHHHH
Confidence            345677777777766665543


No 124
>PRK09678 DNA-binding transcriptional regulator; Provisional
Probab=82.32  E-value=0.7  Score=22.72  Aligned_cols=40  Identities=15%  Similarity=0.404  Sum_probs=19.2

Q ss_pred             ccCCCCCccccchHHHHhhhhhhcCCCCCccCC--CCCcccccch
Q psy12028          2 YACDVCGKEYQHKRTLYRHKKDECGQEPKFGCP--QCPYRSRQKA   44 (118)
Q Consensus         2 ~~C~~C~~~~~~~~~l~~h~~~~~~~~~~~~C~--~c~~~f~~~~   44 (118)
                      +.|+.||.......+-.....  . .+.-+.|.  .||..|....
T Consensus         2 m~CP~Cg~~a~irtSr~~s~~--~-~~~Y~qC~N~eCg~tF~t~e   43 (72)
T PRK09678          2 FHCPLCQHAAHARTSRYITDT--T-KERYHQCQNVNCSATFITYE   43 (72)
T ss_pred             ccCCCCCCccEEEEChhcChh--h-heeeeecCCCCCCCEEEEEE
Confidence            467777665532222111111  1 13446676  6777766543


No 125
>PF07975 C1_4:  TFIIH C1-like domain;  InterPro: IPR004595 All proteins in this domain for which functions are known are components of the TFIIH complex which is involved in the initiation of transcription and nucleotide excision repair. It includes the yeast transcription factor Ssl1 (Suppressor of stem-loop protein 1) that is essential for translation initiation and affects UV resistance. The C-terminal region is essential for transcription activity. This regions binds three zinc atoms through two independent domain. The first contains a C4 zinc finger motif, whereas the second is characterised by a CX(2)CX(2-4)FCADCD motif. The solution structure of the second C-terminal domain revealed homology with the regulatory domain of protein kinase C [].; GO: 0006281 DNA repair, 0005634 nucleus; PDB: 1Z60_A.
Probab=81.80  E-value=1.4  Score=20.15  Aligned_cols=21  Identities=19%  Similarity=0.545  Sum_probs=10.4

Q ss_pred             CCccCCCCCcccccchHHHHH
Q psy12028         29 PKFGCPQCPYRSRQKATLNRH   49 (118)
Q Consensus        29 ~~~~C~~c~~~f~~~~~l~~h   49 (118)
                      ..|.|+.|...|-..-.+-.|
T Consensus        20 ~~y~C~~C~~~FC~dCD~fiH   40 (51)
T PF07975_consen   20 SRYRCPKCKNHFCIDCDVFIH   40 (51)
T ss_dssp             EEE--TTTT--B-HHHHHTTT
T ss_pred             CeEECCCCCCccccCcChhhh
Confidence            458888888887665555545


No 126
>KOG2593|consensus
Probab=81.78  E-value=0.98  Score=29.96  Aligned_cols=18  Identities=22%  Similarity=0.624  Sum_probs=10.2

Q ss_pred             CccCCCCCcccccchHHH
Q psy12028         30 KFGCPQCPYRSRQKATLN   47 (118)
Q Consensus        30 ~~~C~~c~~~f~~~~~l~   47 (118)
                      .|.||.|.+.|.....++
T Consensus       128 ~Y~Cp~C~kkyt~Lea~~  145 (436)
T KOG2593|consen  128 GYVCPNCQKKYTSLEALQ  145 (436)
T ss_pred             cccCCccccchhhhHHHH
Confidence            366666666666554433


No 127
>PF06524 NOA36:  NOA36 protein;  InterPro: IPR010531 This family consists of several NOA36 proteins which contain 29 highly conserved cysteine residues. The function of this protein is unknown.; GO: 0008270 zinc ion binding, 0005634 nucleus
Probab=81.20  E-value=0.72  Score=28.51  Aligned_cols=82  Identities=16%  Similarity=0.383  Sum_probs=42.5

Q ss_pred             ccCCCCCccccchHHHHhhhhh-hcCCCCCccCCCCCcccccchHH-------HHHhhhhhccCCcccccccCchhhhhh
Q psy12028          2 YACDVCGKEYQHKRTLYRHKKD-ECGQEPKFGCPQCPYRSRQKATL-------NRHLGWEQLQGNAHVMYACDVCGKVYQ   73 (118)
Q Consensus         2 ~~C~~C~~~~~~~~~l~~h~~~-~~~~~~~~~C~~c~~~f~~~~~l-------~~h~~~~~~~~~~~~~~~c~~c~~~~~   73 (118)
                      |+|..|+..+-....+ .|+.. ...+...|.|.-|++.-... -|       ..|++..-......+++.||.|+.-..
T Consensus       143 f~CsfC~~flCEDDQF-EHQAsCQvLe~E~~KC~SCNrlGq~s-CLRCK~cfCddHvrrKg~ky~k~k~~PCPKCg~et~  220 (314)
T PF06524_consen  143 FKCSFCDNFLCEDDQF-EHQASCQVLESETFKCQSCNRLGQYS-CLRCKICFCDDHVRRKGFKYEKGKPIPCPKCGYETQ  220 (314)
T ss_pred             EEeecCCCeeeccchh-hhhhhhhhhhcccccccccccccchh-hhheeeeehhhhhhhcccccccCCCCCCCCCCCccc
Confidence            5666666544333333 34332 22223446666665432111 11       224433222333457889999998777


Q ss_pred             chHHHHHHHhhh
Q psy12028         74 HKQTLDRHKKDE   85 (118)
Q Consensus        74 ~~~~l~~h~~~h   85 (118)
                      ....|....++|
T Consensus       221 eTkdLSmStR~h  232 (314)
T PF06524_consen  221 ETKDLSMSTRSH  232 (314)
T ss_pred             ccccceeeeecc
Confidence            777766655555


No 128
>KOG2907|consensus
Probab=80.63  E-value=0.95  Score=24.20  Aligned_cols=40  Identities=25%  Similarity=0.545  Sum_probs=21.9

Q ss_pred             CccCCCCCcccccchHHHHHhhhhhccCCcccccccCchhhhhh
Q psy12028         30 KFGCPQCPYRSRQKATLNRHLGWEQLQGNAHVMYACDVCGKVYQ   73 (118)
Q Consensus        30 ~~~C~~c~~~f~~~~~l~~h~~~~~~~~~~~~~~~c~~c~~~~~   73 (118)
                      ..+||.||-.=-.-..++..    .-..+...-|+|+.|+..|.
T Consensus        74 ~~kCpkCghe~m~Y~T~QlR----SADEGQTVFYTC~kC~~k~~  113 (116)
T KOG2907|consen   74 KHKCPKCGHEEMSYHTLQLR----SADEGQTVFYTCPKCKYKFT  113 (116)
T ss_pred             hccCcccCCchhhhhhhhcc----cccCCceEEEEcCccceeee
Confidence            36788888543222222221    22333445688888887764


No 129
>PRK10220 hypothetical protein; Provisional
Probab=80.40  E-value=1.3  Score=23.60  Aligned_cols=30  Identities=23%  Similarity=0.636  Sum_probs=21.6

Q ss_pred             cCCCCCccccchHHHHhhhhhhcCCCCCccCCCCCcccccch
Q psy12028          3 ACDVCGKEYQHKRTLYRHKKDECGQEPKFGCPQCPYRSRQKA   44 (118)
Q Consensus         3 ~C~~C~~~~~~~~~l~~h~~~~~~~~~~~~C~~c~~~f~~~~   44 (118)
                      .|+.|+..|....            ...|.||.|+..|....
T Consensus         5 ~CP~C~seytY~d------------~~~~vCpeC~hEW~~~~   34 (111)
T PRK10220          5 HCPKCNSEYTYED------------NGMYICPECAHEWNDAE   34 (111)
T ss_pred             cCCCCCCcceEcC------------CCeEECCcccCcCCccc
Confidence            5888887664422            34599999999887654


No 130
>PF01927 Mut7-C:  Mut7-C RNAse domain;  InterPro: IPR002782 This prokaryotic family of proteins have no known function. The proteins contain four conserved cysteines that may be involved in metal binding or disulphide bridges.
Probab=79.84  E-value=1.3  Score=24.99  Aligned_cols=11  Identities=45%  Similarity=1.355  Sum_probs=7.1

Q ss_pred             ccccCchhhhh
Q psy12028         62 MYACDVCGKVY   72 (118)
Q Consensus        62 ~~~c~~c~~~~   72 (118)
                      -+.|+.|++.|
T Consensus       124 f~~C~~C~kiy  134 (147)
T PF01927_consen  124 FWRCPGCGKIY  134 (147)
T ss_pred             EEECCCCCCEe
Confidence            45677777655


No 131
>COG4338 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=78.55  E-value=0.86  Score=20.36  Aligned_cols=18  Identities=22%  Similarity=0.349  Sum_probs=14.2

Q ss_pred             ccCCCCCcccccchHHHH
Q psy12028         31 FGCPQCPYRSRQKATLNR   48 (118)
Q Consensus        31 ~~C~~c~~~f~~~~~l~~   48 (118)
                      -+|++|+.+|.....+.+
T Consensus        13 KICpvCqRPFsWRkKW~~   30 (54)
T COG4338          13 KICPVCQRPFSWRKKWAR   30 (54)
T ss_pred             hhhhhhcCchHHHHHHHH
Confidence            579999999987766654


No 132
>COG1656 Uncharacterized conserved protein [Function unknown]
Probab=78.51  E-value=2.5  Score=24.35  Aligned_cols=18  Identities=17%  Similarity=0.447  Sum_probs=9.5

Q ss_pred             CccCCCCCcccccchHHH
Q psy12028         30 KFGCPQCPYRSRQKATLN   47 (118)
Q Consensus        30 ~~~C~~c~~~f~~~~~l~   47 (118)
                      .+.|+.||+.|...+.+.
T Consensus       130 f~~C~~CgkiYW~GsHw~  147 (165)
T COG1656         130 FYRCPKCGKIYWKGSHWR  147 (165)
T ss_pred             eeECCCCcccccCchHHH
Confidence            345666665555554443


No 133
>PRK03824 hypA hydrogenase nickel incorporation protein; Provisional
Probab=78.28  E-value=0.91  Score=25.23  Aligned_cols=15  Identities=20%  Similarity=0.397  Sum_probs=9.0

Q ss_pred             CCccCCCCCcccccc
Q psy12028         29 PKFGCPQCPYRSRQK   43 (118)
Q Consensus        29 ~~~~C~~c~~~f~~~   43 (118)
                      ..+.|+.||..|...
T Consensus        69 ~~~~C~~CG~~~~~~   83 (135)
T PRK03824         69 AVLKCRNCGNEWSLK   83 (135)
T ss_pred             eEEECCCCCCEEecc
Confidence            346677777666543


No 134
>PF01096 TFIIS_C:  Transcription factor S-II (TFIIS);  InterPro: IPR001222 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents a zinc finger motif found in transcription factor IIs (TFIIS). In eukaryotes the initiation of transcription of protein encoding genes by polymerase II (Pol II) is modulated by general and specific transcription factors. The general transcription factors operate through common promoters elements (such as the TATA box). At least eight different proteins associate to form the general transcription factors: TFIIA, -IIB, -IID, -IIE, -IIF, -IIG, -IIH and -IIS []. During mRNA elongation, Pol II can encounter DNA sequences that cause reverse movement of the enzyme. Such backtracking involves extrusion of the RNA 3'-end into the pore, and can lead to transcriptional arrest. Escape from arrest requires cleavage of the extruded RNA with the help of TFIIS, which induces mRNA cleavage by enhancing the intrinsic nuclease activity of RNA polymerase (Pol) II, past template-encoded pause sites []. TFIIS extends from the polymerase surface via a pore to the internal active site. Two essential and invariant acidic residues in a TFIIS loop complement the Pol II active site and could position a metal ion and a water molecule for hydrolytic RNA cleavage. TFIIS also induces extensive structural changes in Pol II that would realign nucleic acids in the active centre.  TFIIS is a protein of about 300 amino acids. It contains three regions: a variable N-terminal domain not required for TFIIS activity; a conserved central domain required for Pol II binding; and a conserved C-terminal C4-type zinc finger essential for RNA cleavage. The zinc finger folds in a conformation termed a zinc ribbon [] characterised by a three-stranded antiparallel beta-sheet and two beta-hairpins. A backbone model for Pol II-TFIIS complex was obtained from X-ray analysis. It shows that a beta hairpin protrudes from the zinc finger and complements the pol II active site [].  Some viral proteins also contain the TFIIS zinc ribbon C-terminal domain. The Vaccinia virus protein, unlike its eukaryotic homologue, is an integral RNA polymerase subunit rather than a readily separable transcription factor []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003676 nucleic acid binding, 0008270 zinc ion binding, 0006351 transcription, DNA-dependent; PDB: 3M4O_I 3S14_I 2E2J_I 4A3J_I 3HOZ_I 1TWA_I 3S1Q_I 3S1N_I 1TWG_I 3I4M_I ....
Probab=78.14  E-value=0.083  Score=22.58  Aligned_cols=10  Identities=30%  Similarity=0.666  Sum_probs=5.5

Q ss_pred             ccCCCCCccc
Q psy12028         31 FGCPQCPYRS   40 (118)
Q Consensus        31 ~~C~~c~~~f   40 (118)
                      |.|..|+..|
T Consensus        29 y~C~~C~~~w   38 (39)
T PF01096_consen   29 YVCCNCGHRW   38 (39)
T ss_dssp             EEESSSTEEE
T ss_pred             EEeCCCCCee
Confidence            5566665544


No 135
>PRK04023 DNA polymerase II large subunit; Validated
Probab=77.95  E-value=4.2  Score=30.40  Aligned_cols=10  Identities=30%  Similarity=0.863  Sum_probs=5.9

Q ss_pred             CccCCCCCcc
Q psy12028         30 KFGCPQCPYR   39 (118)
Q Consensus        30 ~~~C~~c~~~   39 (118)
                      ...|+.||..
T Consensus       626 ~RfCpsCG~~  635 (1121)
T PRK04023        626 RRKCPSCGKE  635 (1121)
T ss_pred             CccCCCCCCc
Confidence            3556666655


No 136
>PF07503 zf-HYPF:  HypF finger;  InterPro: IPR011125 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  Proteins of the HypF family are involved in the maturation and regulation of hydrogenase []. In the N terminus they appear to have two zinc finger domains that are similar to those found in the DnaJ chaperone []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 3TTD_A 3TSQ_A 3TTC_A 3TSP_A 3TTF_A 3TSU_A.
Probab=77.92  E-value=1.1  Score=18.66  Aligned_cols=31  Identities=26%  Similarity=0.497  Sum_probs=15.4

Q ss_pred             cCchhhhhhchHHHHHHHhhhcCCCCCccCCCCCCCCC
Q psy12028         65 CDVCGKVYQHKQTLDRHKKDECGQEPKFECPHCPYRSK  102 (118)
Q Consensus        65 c~~c~~~~~~~~~l~~h~~~h~~~~~~~~C~~C~~~f~  102 (118)
                      |+.|.+-+.++.+    .+.|   ..+..|..||..++
T Consensus         2 C~~C~~Ey~~p~~----RR~~---~~~isC~~CGPr~~   32 (35)
T PF07503_consen    2 CDDCLKEYFDPSN----RRFH---YQFISCTNCGPRYS   32 (35)
T ss_dssp             -HHHHHHHCSTTS----TTTT----TT--BTTCC-SCC
T ss_pred             CHHHHHHHcCCCC----Cccc---CcCccCCCCCCCEE
Confidence            4556665555443    3444   34677888987764


No 137
>PF14446 Prok-RING_1:  Prokaryotic RING finger family 1
Probab=77.83  E-value=0.75  Score=21.22  Aligned_cols=10  Identities=30%  Similarity=0.750  Sum_probs=5.4

Q ss_pred             ccCCCCCccc
Q psy12028         31 FGCPQCPYRS   40 (118)
Q Consensus        31 ~~C~~c~~~f   40 (118)
                      -.|+.|+.++
T Consensus        22 VvCp~Cgapy   31 (54)
T PF14446_consen   22 VVCPECGAPY   31 (54)
T ss_pred             EECCCCCCcc
Confidence            4566665544


No 138
>smart00154 ZnF_AN1 AN1-like Zinc finger. Zinc finger at the C-terminus of An1, a ubiquitin-like protein in Xenopus laevis.
Probab=77.44  E-value=1.2  Score=18.99  Aligned_cols=12  Identities=25%  Similarity=0.811  Sum_probs=7.2

Q ss_pred             CccCCCCCcccc
Q psy12028          1 MYACDVCGKEYQ   12 (118)
Q Consensus         1 ~~~C~~C~~~~~   12 (118)
                      ||+|..|++.|-
T Consensus        12 ~f~C~~C~~~FC   23 (39)
T smart00154       12 GFKCRHCGNLFC   23 (39)
T ss_pred             CeECCccCCccc
Confidence            456666666664


No 139
>COG0068 HypF Hydrogenase maturation factor [Posttranslational modification, protein turnover, chaperones]
Probab=76.66  E-value=0.46  Score=33.51  Aligned_cols=58  Identities=19%  Similarity=0.494  Sum_probs=34.4

Q ss_pred             ccCCCCCcccccchHHHHHhhhhhccCCccccc-ccCchhhhhhchHHHHHHHhhhcCCCCCccCCCCCCC
Q psy12028         31 FGCPQCPYRSRQKATLNRHLGWEQLQGNAHVMY-ACDVCGKVYQHKQTLDRHKKDECGQEPKFECPHCPYR  100 (118)
Q Consensus        31 ~~C~~c~~~f~~~~~l~~h~~~~~~~~~~~~~~-~c~~c~~~~~~~~~l~~h~~~h~~~~~~~~C~~C~~~  100 (118)
                      -.|+.||-.|..-..|=--    . ..+.=..| -|+.|.+-+.++.+    +|.|   ..|..|+.||..
T Consensus       124 ~~CT~CGPRfTIi~alPYD----R-~nTsM~~F~lC~~C~~EY~dP~n----RRfH---AQp~aCp~CGP~  182 (750)
T COG0068         124 INCTNCGPRFTIIEALPYD----R-ENTSMADFPLCPFCDKEYKDPLN----RRFH---AQPIACPKCGPH  182 (750)
T ss_pred             cccCCCCcceeeeccCCCC----c-ccCccccCcCCHHHHHHhcCccc----cccc---cccccCcccCCC
Confidence            3488899888765432100    0 00111112 58889888888755    3555   457889999863


No 140
>PF12907 zf-met2:  Zinc-binding
Probab=76.05  E-value=2  Score=18.53  Aligned_cols=22  Identities=18%  Similarity=0.694  Sum_probs=10.5

Q ss_pred             cccCchhhhhhc---hHHHHHHHhh
Q psy12028         63 YACDVCGKVYQH---KQTLDRHKKD   84 (118)
Q Consensus        63 ~~c~~c~~~~~~---~~~l~~h~~~   84 (118)
                      +.|.+|...|..   ...|..|...
T Consensus         2 i~C~iC~qtF~~t~~~~~L~eH~en   26 (40)
T PF12907_consen    2 IICKICRQTFMQTTNEPQLKEHAEN   26 (40)
T ss_pred             cCcHHhhHHHHhcCCHHHHHHHHHc
Confidence            356666644433   2345555443


No 141
>COG1675 TFA1 Transcription initiation factor IIE, alpha subunit [Transcription]
Probab=75.21  E-value=4.4  Score=23.73  Aligned_cols=33  Identities=18%  Similarity=0.594  Sum_probs=21.8

Q ss_pred             CCCccCCCCCcccccchHHHHHhhhhhccCCcccccccCchhhhhh
Q psy12028         28 EPKFGCPQCPYRSRQKATLNRHLGWEQLQGNAHVMYACDVCGKVYQ   73 (118)
Q Consensus        28 ~~~~~C~~c~~~f~~~~~l~~h~~~~~~~~~~~~~~~c~~c~~~~~   73 (118)
                      ...|.||.|...+..-..+..             .|.|+.||....
T Consensus       111 ~~~y~C~~~~~r~sfdeA~~~-------------~F~Cp~Cg~~L~  143 (176)
T COG1675         111 NNYYVCPNCHVKYSFDEAMEL-------------GFTCPKCGEDLE  143 (176)
T ss_pred             CCceeCCCCCCcccHHHHHHh-------------CCCCCCCCchhh
Confidence            456899888877765443221             278888887543


No 142
>PF02176 zf-TRAF:  TRAF-type zinc finger; PDB: 2EOD_A 2YUC_A 3HCU_A 3HCS_B 3HCT_A.
Probab=75.19  E-value=0.88  Score=21.07  Aligned_cols=41  Identities=22%  Similarity=0.383  Sum_probs=18.0

Q ss_pred             CCccCCC--CCcccccchHHHHHhhhhhccCCcccccccCc----hhhhhhc
Q psy12028         29 PKFGCPQ--CPYRSRQKATLNRHLGWEQLQGNAHVMYACDV----CGKVYQH   74 (118)
Q Consensus        29 ~~~~C~~--c~~~f~~~~~l~~h~~~~~~~~~~~~~~~c~~----c~~~~~~   74 (118)
                      .+..|+.  |...+. ...|..|+...+.    .++..|+.    |+..+..
T Consensus         8 ~~v~C~~~cc~~~i~-r~~l~~H~~~~C~----~~~v~C~~~~~GC~~~~~~   54 (60)
T PF02176_consen    8 RPVPCPNGCCNEMIP-RKELDDHLENECP----KRPVPCPYSPYGCKERVPR   54 (60)
T ss_dssp             SEEE-TT--S-BEEE-CCCHHHHHHTTST----TSEEE-SS----S--EEEH
T ss_pred             CEeeCCCCCccccee-HHHHHHHHHccCC----CCcEECCCCCCCCCCccch
Confidence            3456766  333333 3456777542222    24456776    6665544


No 143
>KOG0978|consensus
Probab=74.91  E-value=1.4  Score=31.32  Aligned_cols=20  Identities=25%  Similarity=0.491  Sum_probs=15.3

Q ss_pred             CccCCCCCCCCCChhHHHHH
Q psy12028         91 KFECPHCPYRSKRKDTLDRH  110 (118)
Q Consensus        91 ~~~C~~C~~~f~~~~~l~~H  110 (118)
                      .-+||.||.+|+..+-+..|
T Consensus       678 qRKCP~Cn~aFganDv~~I~  697 (698)
T KOG0978|consen  678 QRKCPKCNAAFGANDVHRIH  697 (698)
T ss_pred             cCCCCCCCCCCCcccccccC
Confidence            34799999999887766554


No 144
>TIGR00280 L37a ribosomal protein L37a. This model finds eukaryotic ribosomal protein L37a and its archaeal orthologs. The nomeclature is tricky because eukaryotes have proteins called both L37 and L37a.
Probab=74.76  E-value=0.76  Score=23.67  Aligned_cols=11  Identities=18%  Similarity=0.612  Sum_probs=6.1

Q ss_pred             CccCCCCCCCC
Q psy12028         91 KFECPHCPYRS  101 (118)
Q Consensus        91 ~~~C~~C~~~f  101 (118)
                      .|.|..|++.|
T Consensus        53 IW~C~~C~~~~   63 (91)
T TIGR00280        53 IWTCRKCGAKF   63 (91)
T ss_pred             EEEcCCCCCEE
Confidence            45565555544


No 145
>PF10013 DUF2256:  Uncharacterized protein conserved in bacteria (DUF2256);  InterPro: IPR017136 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function.
Probab=74.15  E-value=2.8  Score=18.26  Aligned_cols=16  Identities=19%  Similarity=0.410  Sum_probs=10.9

Q ss_pred             cCCCCCCCCCChhHHH
Q psy12028         93 ECPHCPYRSKRKDTLD  108 (118)
Q Consensus        93 ~C~~C~~~f~~~~~l~  108 (118)
                      .|.+||..|+....+.
T Consensus        10 ~C~~C~rpf~WRKKW~   25 (42)
T PF10013_consen   10 ICPVCGRPFTWRKKWA   25 (42)
T ss_pred             cCcccCCcchHHHHHH
Confidence            4888888887655443


No 146
>PF04780 DUF629:  Protein of unknown function (DUF629);  InterPro: IPR006865 This domain represents a region of several plant proteins of unknown function. A C2H2 zinc finger is predicted in this region in some family members, but the spacing between the cysteine residues is not conserved throughout the family.
Probab=74.01  E-value=2.8  Score=28.41  Aligned_cols=25  Identities=24%  Similarity=0.505  Sum_probs=15.5

Q ss_pred             CccCCCCCCCCCChhHHHHHHhhhc
Q psy12028         91 KFECPHCPYRSKRKDTLDRHMKIIH  115 (118)
Q Consensus        91 ~~~C~~C~~~f~~~~~l~~H~~~~~  115 (118)
                      -+.|+.|.+.|.....+..|+...|
T Consensus        57 FWiCp~CskkF~d~~~~~~H~~~eH   81 (466)
T PF04780_consen   57 FWICPRCSKKFSDAESCLSHMEQEH   81 (466)
T ss_pred             EeeCCcccceeCCHHHHHHHHHHhh
Confidence            4556666666666666666665444


No 147
>PRK12380 hydrogenase nickel incorporation protein HybF; Provisional
Probab=73.82  E-value=1.6  Score=23.50  Aligned_cols=13  Identities=15%  Similarity=0.191  Sum_probs=8.8

Q ss_pred             ccCCCCCcccccc
Q psy12028         31 FGCPQCPYRSRQK   43 (118)
Q Consensus        31 ~~C~~c~~~f~~~   43 (118)
                      +.|..|+..|...
T Consensus        71 ~~C~~Cg~~~~~~   83 (113)
T PRK12380         71 AWCWDCSQVVEIH   83 (113)
T ss_pred             EEcccCCCEEecC
Confidence            6677777666553


No 148
>KOG4167|consensus
Probab=73.66  E-value=1.7  Score=31.06  Aligned_cols=28  Identities=25%  Similarity=0.557  Sum_probs=24.3

Q ss_pred             ccccccCchhhhhhchHHHHHHHhhhcC
Q psy12028         60 HVMYACDVCGKVYQHKQTLDRHKKDECG   87 (118)
Q Consensus        60 ~~~~~c~~c~~~~~~~~~l~~h~~~h~~   87 (118)
                      ...|.|.+|++.|.-..++..||.+|.-
T Consensus       790 ~giFpCreC~kvF~KiKSrNAHMK~Hr~  817 (907)
T KOG4167|consen  790 TGIFPCRECGKVFFKIKSRNAHMKTHRQ  817 (907)
T ss_pred             CceeehHHHHHHHHHHhhhhHHHHHHHH
Confidence            3458999999999999999999999864


No 149
>PF04959 ARS2:  Arsenite-resistance protein 2;  InterPro: IPR007042 This entry represents Arsenite-resistance protein 2 (also known as Serrate RNA effector molecule homolog) which is thought to play a role in arsenite resistance [], although does not directly confer arsenite resistance but rather modulates arsenic sensitivity []. Arsenite is a carcinogenic compound which can act as a comutagen by inhibiting DNA repair. It is also involved in cell cycle progression at S phase. ; PDB: 3AX1_A.
Probab=73.54  E-value=2.2  Score=25.81  Aligned_cols=27  Identities=22%  Similarity=0.434  Sum_probs=19.9

Q ss_pred             CCCccCCCCCcccccchHHHHHhhhhh
Q psy12028         28 EPKFGCPQCPYRSRQKATLNRHLGWEQ   54 (118)
Q Consensus        28 ~~~~~C~~c~~~f~~~~~l~~h~~~~~   54 (118)
                      +..|.|+.|++.|+...-+..|+...+
T Consensus        75 ~~K~~C~lc~KlFkg~eFV~KHI~nKH  101 (214)
T PF04959_consen   75 EDKWRCPLCGKLFKGPEFVRKHIFNKH  101 (214)
T ss_dssp             SEEEEE-SSS-EESSHHHHHHHHHHH-
T ss_pred             CCEECCCCCCcccCChHHHHHHHhhcC
Confidence            344999999999999998999987443


No 150
>PF05191 ADK_lid:  Adenylate kinase, active site lid;  InterPro: IPR007862 Adenylate kinases (ADK; 2.7.4.3 from EC) are phosphotransferases that catalyse the Mg-dependent reversible conversion of ATP and AMP to two molecules of ADP, an essential reaction for many processes in living cells. In large variants of adenylate kinase, the AMP and ATP substrates are buried in a domain that undergoes conformational changes from an open to a closed state when bound to substrate; the ligand is then contained within a highly specific environment required for catalysis. Adenylate kinase is a 3-domain protein consisting of a large central CORE domain flanked by a LID domain on one side and the AMP-binding NMPbind domain on the other []. The LID domain binds ATP and covers the phosphates at the active site. The substrates first bind the CORE domain, followed by closure of the active site by the LID and NMPbind domains. Comparisons of adenylate kinases have revealed a particular divergence in the active site lid. In some organisms, particularly the Gram-positive bacteria, residues in the lid domain have been mutated to cysteines and these cysteine residues (two CX(n)C motifs) are responsible for the binding of a zinc ion. The bound zinc ion in the lid domain is clearly structurally homologous to Zinc-finger domains. However, it is unclear whether the adenylate kinase lid is a novel zinc-finger DNA/RNA binding domain, or that the lid bound zinc serves a purely structural function [].; GO: 0004017 adenylate kinase activity; PDB: 3BE4_A 2OSB_B 2ORI_A 2EU8_A 3DL0_A 1P3J_A 2QAJ_A 2OO7_A 2P3S_A 3DKV_A ....
Probab=72.87  E-value=0.74  Score=19.29  Aligned_cols=9  Identities=44%  Similarity=1.479  Sum_probs=4.0

Q ss_pred             ccCchhhhh
Q psy12028         64 ACDVCGKVY   72 (118)
Q Consensus        64 ~c~~c~~~~   72 (118)
                      .|+.|+.+|
T Consensus         3 ~C~~Cg~~Y   11 (36)
T PF05191_consen    3 ICPKCGRIY   11 (36)
T ss_dssp             EETTTTEEE
T ss_pred             CcCCCCCcc
Confidence            344444444


No 151
>KOG2636|consensus
Probab=72.50  E-value=3.3  Score=27.86  Aligned_cols=28  Identities=29%  Similarity=0.573  Sum_probs=21.9

Q ss_pred             hhhcCCCCCccCCCCC-CCCCChhHHHHHH
Q psy12028         83 KDECGQEPKFECPHCP-YRSKRKDTLDRHM  111 (118)
Q Consensus        83 ~~h~~~~~~~~C~~C~-~~f~~~~~l~~H~  111 (118)
                      +.|.- ...|.|.+|| +++.-+..+.+|.
T Consensus       394 KLHGL-~~ey~CEICGNy~Y~GrkaF~RHF  422 (497)
T KOG2636|consen  394 KLHGL-DIEYNCEICGNYVYKGRKAFDRHF  422 (497)
T ss_pred             hhcCC-CcccceeeccCccccCcHHHHHHh
Confidence            44443 7789999998 8888888888886


No 152
>COG1594 RPB9 DNA-directed RNA polymerase, subunit M/Transcription elongation factor TFIIS [Transcription]
Probab=72.46  E-value=0.87  Score=24.51  Aligned_cols=39  Identities=21%  Similarity=0.497  Sum_probs=21.7

Q ss_pred             ccCCCCCcccccchHHHHHhhhhhccCCcccccccCchhhhhh
Q psy12028         31 FGCPQCPYRSRQKATLNRHLGWEQLQGNAHVMYACDVCGKVYQ   73 (118)
Q Consensus        31 ~~C~~c~~~f~~~~~l~~h~~~~~~~~~~~~~~~c~~c~~~~~   73 (118)
                      ..||.|+..=.....++.-    ...-....-|.|..||..|.
T Consensus        73 ~~CpkCg~~ea~y~~~QtR----saDEp~T~Fy~C~~Cg~~wr  111 (113)
T COG1594          73 EKCPKCGNKEAYYWQLQTR----SADEPETRFYKCTRCGYRWR  111 (113)
T ss_pred             ccCCCCCCceeEEEeeehh----ccCCCceEEEEecccCCEee
Confidence            5688888654433333322    22333345578888887664


No 153
>PF13240 zinc_ribbon_2:  zinc-ribbon domain
Probab=71.53  E-value=2.2  Score=15.84  Aligned_cols=6  Identities=50%  Similarity=1.542  Sum_probs=3.4

Q ss_pred             CCCCCc
Q psy12028         33 CPQCPY   38 (118)
Q Consensus        33 C~~c~~   38 (118)
                      |+.||.
T Consensus        16 C~~CG~   21 (23)
T PF13240_consen   16 CPNCGT   21 (23)
T ss_pred             hhhhCC
Confidence            555554


No 154
>TIGR00100 hypA hydrogenase nickel insertion protein HypA. In Hpylori, hypA mutant abolished hydrogenase activity and decrease in urease activity. Nickel supplementation in media restored urease activity and partial hydrogenase activity. HypA probably involved in inserting Ni in enzymes.
Probab=71.40  E-value=1.7  Score=23.43  Aligned_cols=13  Identities=15%  Similarity=0.506  Sum_probs=8.9

Q ss_pred             ccCCCCCcccccc
Q psy12028         31 FGCPQCPYRSRQK   43 (118)
Q Consensus        31 ~~C~~c~~~f~~~   43 (118)
                      ..|..|+..|...
T Consensus        71 ~~C~~Cg~~~~~~   83 (115)
T TIGR00100        71 CECEDCSEEVSPE   83 (115)
T ss_pred             EEcccCCCEEecC
Confidence            6777777766554


No 155
>KOG1842|consensus
Probab=71.35  E-value=2.3  Score=28.52  Aligned_cols=25  Identities=20%  Similarity=0.323  Sum_probs=14.6

Q ss_pred             cccCchhhhhhchHHHHHHHhhhcC
Q psy12028         63 YACDVCGKVYQHKQTLDRHKKDECG   87 (118)
Q Consensus        63 ~~c~~c~~~~~~~~~l~~h~~~h~~   87 (118)
                      |.||+|...|.+.+.|..|.-..|+
T Consensus        16 flCPiC~~dl~~~~~L~~H~d~eH~   40 (505)
T KOG1842|consen   16 FLCPICLLDLPNLSALNDHLDVEHF   40 (505)
T ss_pred             ccCchHhhhhhhHHHHHHHHhhhcc
Confidence            5566666666666666666554443


No 156
>PF13824 zf-Mss51:  Zinc-finger of mitochondrial splicing suppressor 51
Probab=71.26  E-value=5.7  Score=18.45  Aligned_cols=15  Identities=27%  Similarity=0.747  Sum_probs=11.0

Q ss_pred             CCCccCCCCCccccc
Q psy12028         28 EPKFGCPQCPYRSRQ   42 (118)
Q Consensus        28 ~~~~~C~~c~~~f~~   42 (118)
                      ...|.||.||.++--
T Consensus        12 ~v~~~Cp~cGipthc   26 (55)
T PF13824_consen   12 HVNFECPDCGIPTHC   26 (55)
T ss_pred             ccCCcCCCCCCcCcc
Confidence            456899999977544


No 157
>PF08790 zf-LYAR:  LYAR-type C2HC zinc finger ;  InterPro: IPR014898 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This C2HC zinc finger domain is found in LYAR proteins such as Q08288 from SWISSPROT, which are involved in cell growth regulation.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 1WJV_A.
Probab=71.23  E-value=0.9  Score=17.91  Aligned_cols=9  Identities=22%  Similarity=0.626  Sum_probs=4.5

Q ss_pred             cCCCCCccc
Q psy12028         32 GCPQCPYRS   40 (118)
Q Consensus        32 ~C~~c~~~f   40 (118)
                      .|-.|++.|
T Consensus         2 sCiDC~~~F   10 (28)
T PF08790_consen    2 SCIDCSKDF   10 (28)
T ss_dssp             EETTTTEEE
T ss_pred             eeecCCCCc
Confidence            344555555


No 158
>PRK03976 rpl37ae 50S ribosomal protein L37Ae; Reviewed
Probab=71.10  E-value=1  Score=23.17  Aligned_cols=11  Identities=27%  Similarity=0.724  Sum_probs=6.1

Q ss_pred             CccCCCCCCCC
Q psy12028         91 KFECPHCPYRS  101 (118)
Q Consensus        91 ~~~C~~C~~~f  101 (118)
                      .|.|..|++.|
T Consensus        54 IW~C~~C~~~~   64 (90)
T PRK03976         54 IWECRKCGAKF   64 (90)
T ss_pred             EEEcCCCCCEE
Confidence            45566665544


No 159
>PF07282 OrfB_Zn_ribbon:  Putative transposase DNA-binding domain;  InterPro: IPR010095 This entry represents a region of a sequence similarity between a family of putative transposases of Thermoanaerobacter tengcongensis, smaller related proteins from Bacillus anthracis, putative transposes described by IPR001959 from INTERPRO, and other proteins. More information about these proteins can be found at Protein of the Month: Transposase [].
Probab=69.82  E-value=3.8  Score=19.60  Aligned_cols=29  Identities=24%  Similarity=0.714  Sum_probs=16.4

Q ss_pred             ccCCCCCcccccchHHHHHhhhhhccCCcccccccCchhhhhh
Q psy12028         31 FGCPQCPYRSRQKATLNRHLGWEQLQGNAHVMYACDVCGKVYQ   73 (118)
Q Consensus        31 ~~C~~c~~~f~~~~~l~~h~~~~~~~~~~~~~~~c~~c~~~~~   73 (118)
                      -.|+.||..-...  +            ..+.|.|+.||..+.
T Consensus        29 q~C~~CG~~~~~~--~------------~~r~~~C~~Cg~~~~   57 (69)
T PF07282_consen   29 QTCPRCGHRNKKR--R------------SGRVFTCPNCGFEMD   57 (69)
T ss_pred             cCccCcccccccc--c------------ccceEEcCCCCCEEC
Confidence            4577777665540  0            123477777776543


No 160
>KOG1280|consensus
Probab=69.77  E-value=5.3  Score=26.00  Aligned_cols=24  Identities=21%  Similarity=0.408  Sum_probs=13.8

Q ss_pred             ccCCCCCccccchHHHHhhhhhhc
Q psy12028          2 YACDVCGKEYQHKRTLYRHKKDEC   25 (118)
Q Consensus         2 ~~C~~C~~~~~~~~~l~~h~~~~~   25 (118)
                      |.|+.|+..-.+...|..|....+
T Consensus        80 ftCPyC~~~Gfte~~f~~Hv~s~H  103 (381)
T KOG1280|consen   80 FTCPYCGIMGFTERQFGTHVLSQH  103 (381)
T ss_pred             ccCCcccccccchhHHHHHhhhcC
Confidence            556666666656666666654433


No 161
>COG1655 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=69.61  E-value=1  Score=27.39  Aligned_cols=20  Identities=15%  Similarity=0.527  Sum_probs=9.8

Q ss_pred             cCCCCCccccchHHHHhhhh
Q psy12028          3 ACDVCGKEYQHKRTLYRHKK   22 (118)
Q Consensus         3 ~C~~C~~~~~~~~~l~~h~~   22 (118)
                      .|++|+..|.....+..-++
T Consensus        21 eCPvC~tkFkkeev~tgsiR   40 (267)
T COG1655          21 ECPVCNTKFKKEEVKTGSIR   40 (267)
T ss_pred             ccCcccchhhhhheecccee
Confidence            45555555555444443333


No 162
>COG2331 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=68.94  E-value=1.1  Score=22.23  Aligned_cols=10  Identities=30%  Similarity=0.933  Sum_probs=5.5

Q ss_pred             ccCCCCCccc
Q psy12028         31 FGCPQCPYRS   40 (118)
Q Consensus        31 ~~C~~c~~~f   40 (118)
                      |.|..|+..|
T Consensus        13 Y~c~~cg~~~   22 (82)
T COG2331          13 YECTECGNRF   22 (82)
T ss_pred             EeecccchHH
Confidence            5555555544


No 163
>COG4896 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=68.61  E-value=1.8  Score=20.41  Aligned_cols=38  Identities=21%  Similarity=0.472  Sum_probs=16.8

Q ss_pred             cCCCCCcc-ccchHHHHhhhhhhcCCCCCccCCCCCcccc
Q psy12028          3 ACDVCGKE-YQHKRTLYRHKKDECGQEPKFGCPQCPYRSR   41 (118)
Q Consensus         3 ~C~~C~~~-~~~~~~l~~h~~~~~~~~~~~~C~~c~~~f~   41 (118)
                      +|..|+.. +.+...+..-+ ......+.|.|+.|.-...
T Consensus         4 kCiiCd~v~~iD~rt~~tKr-LrN~PIrtymC~eC~~Rva   42 (68)
T COG4896           4 KCIICDRVDEIDNRTFKTKR-LRNKPIRTYMCPECEHRVA   42 (68)
T ss_pred             eEEEecceeeecchhHHHHH-hhCCCceeEechhhHhhhc
Confidence            45666543 33333333222 2222234467777654443


No 164
>smart00661 RPOL9 RNA polymerase subunit 9.
Probab=67.88  E-value=2.8  Score=18.74  Aligned_cols=13  Identities=31%  Similarity=0.871  Sum_probs=9.5

Q ss_pred             CccCCCCCccccc
Q psy12028         30 KFGCPQCPYRSRQ   42 (118)
Q Consensus        30 ~~~C~~c~~~f~~   42 (118)
                      .+.|+.|+..+..
T Consensus        20 ~~vC~~Cg~~~~~   32 (52)
T smart00661       20 RFVCRKCGYEEPI   32 (52)
T ss_pred             EEECCcCCCeEEC
Confidence            5788888876554


No 165
>KOG3408|consensus
Probab=66.05  E-value=4.7  Score=22.02  Aligned_cols=24  Identities=21%  Similarity=0.466  Sum_probs=20.7

Q ss_pred             cccccCchhhhhhchHHHHHHHhh
Q psy12028         61 VMYACDVCGKVYQHKQTLDRHKKD   84 (118)
Q Consensus        61 ~~~~c~~c~~~~~~~~~l~~h~~~   84 (118)
                      ..|.|..|.+.|.+...|..|.++
T Consensus        56 GqfyCi~CaRyFi~~~~l~~H~kt   79 (129)
T KOG3408|consen   56 GQFYCIECARYFIDAKALKTHFKT   79 (129)
T ss_pred             ceeehhhhhhhhcchHHHHHHHhc
Confidence            348899999999999999999765


No 166
>PF13451 zf-trcl:  Probable zinc-binding domain
Probab=65.60  E-value=3  Score=18.88  Aligned_cols=41  Identities=15%  Similarity=0.331  Sum_probs=20.2

Q ss_pred             CCCccCCCCCcccccchHHHHHhhhhhccCCcccccccCchhhh
Q psy12028         28 EPKFGCPQCPYRSRQKATLNRHLGWEQLQGNAHVMYACDVCGKV   71 (118)
Q Consensus        28 ~~~~~C~~c~~~f~~~~~l~~h~~~~~~~~~~~~~~~c~~c~~~   71 (118)
                      .+.+.|..||..|.....=+.-..  . ..-...|-.|+.|...
T Consensus         2 Dk~l~C~dCg~~FvfTa~EQ~fy~--e-Kgf~n~p~RC~~CR~~   42 (49)
T PF13451_consen    2 DKTLTCKDCGAEFVFTAGEQKFYA--E-KGFDNEPKRCPSCRQA   42 (49)
T ss_pred             CeeEEcccCCCeEEEehhHHHHHH--h-cCCcCCCccCHHHHHH
Confidence            345778888877755432221111  1 1112235567777653


No 167
>PHA02998 RNA polymerase subunit; Provisional
Probab=65.53  E-value=1.5  Score=25.59  Aligned_cols=42  Identities=19%  Similarity=0.409  Sum_probs=21.2

Q ss_pred             CccCCCCCcccccchHHHHHhhhhhccCCcccccccCchhhhhhch
Q psy12028         30 KFGCPQCPYRSRQKATLNRHLGWEQLQGNAHVMYACDVCGKVYQHK   75 (118)
Q Consensus        30 ~~~C~~c~~~f~~~~~l~~h~~~~~~~~~~~~~~~c~~c~~~~~~~   75 (118)
                      ...|+.|+..=.....++  ++  ........-|.|..|+..|..+
T Consensus       143 ~v~CPkCg~~~A~f~qlQ--TR--SADEPmT~FYkC~~CG~~wkpp  184 (195)
T PHA02998        143 NTPCPNCKSKNTTPMMIQ--TR--AADEPPLVRHACRDCKKHFKPP  184 (195)
T ss_pred             CCCCCCCCCCceEEEEEe--ec--cCCCCceEEEEcCCCCCccCCc
Confidence            367777775433322222  11  1222223456787788776554


No 168
>KOG2071|consensus
Probab=65.24  E-value=5.7  Score=27.71  Aligned_cols=27  Identities=22%  Similarity=0.501  Sum_probs=22.8

Q ss_pred             CCCccCCCCCCCCCChhHHHHHHhhhc
Q psy12028         89 EPKFECPHCPYRSKRKDTLDRHMKIIH  115 (118)
Q Consensus        89 ~~~~~C~~C~~~f~~~~~l~~H~~~~~  115 (118)
                      ..|-.|..||.+|.+......||-.|-
T Consensus       416 ~~pnqC~~CG~R~~~~ee~sk~md~H~  442 (579)
T KOG2071|consen  416 DSPNQCKSCGLRFDDSEERSKHMDIHD  442 (579)
T ss_pred             CCcchhcccccccccchhhhhHhhhhh
Confidence            567899999999999998888887664


No 169
>COG1571 Predicted DNA-binding protein containing a Zn-ribbon domain [General function prediction only]
Probab=64.32  E-value=4.6  Score=27.02  Aligned_cols=29  Identities=28%  Similarity=0.763  Sum_probs=18.9

Q ss_pred             ccCchhhhhhchHHHHHHHhhhcCCCCCccCCCCCCCCCCh
Q psy12028         64 ACDVCGKVYQHKQTLDRHKKDECGQEPKFECPHCPYRSKRK  104 (118)
Q Consensus        64 ~c~~c~~~~~~~~~l~~h~~~h~~~~~~~~C~~C~~~f~~~  104 (118)
                      .|+.||....+           .| .+-|+|+.||..+...
T Consensus       352 ~Cp~Cg~~m~S-----------~G-~~g~rC~kCg~~~~~~  380 (421)
T COG1571         352 VCPRCGGRMKS-----------AG-RNGFRCKKCGTRARET  380 (421)
T ss_pred             CCCccCCchhh-----------cC-CCCcccccccccCCcc
Confidence            68888865332           34 3378888888876543


No 170
>PRK00564 hypA hydrogenase nickel incorporation protein; Provisional
Probab=64.27  E-value=3  Score=22.58  Aligned_cols=13  Identities=15%  Similarity=0.544  Sum_probs=8.1

Q ss_pred             ccCCCCCcccccc
Q psy12028         31 FGCPQCPYRSRQK   43 (118)
Q Consensus        31 ~~C~~c~~~f~~~   43 (118)
                      +.|..|+..|...
T Consensus        72 ~~C~~Cg~~~~~~   84 (117)
T PRK00564         72 LECKDCSHVFKPN   84 (117)
T ss_pred             EEhhhCCCccccC
Confidence            6677777666543


No 171
>PRK03681 hypA hydrogenase nickel incorporation protein; Validated
Probab=64.03  E-value=3.5  Score=22.23  Aligned_cols=12  Identities=17%  Similarity=0.312  Sum_probs=7.9

Q ss_pred             ccCCCCCccccc
Q psy12028         31 FGCPQCPYRSRQ   42 (118)
Q Consensus        31 ~~C~~c~~~f~~   42 (118)
                      +.|..|+..|..
T Consensus        71 ~~C~~Cg~~~~~   82 (114)
T PRK03681         71 CWCETCQQYVTL   82 (114)
T ss_pred             EEcccCCCeeec
Confidence            667777766654


No 172
>PF04423 Rad50_zn_hook:  Rad50 zinc hook motif;  InterPro: IPR007517 The Mre11 complex (Mre11 Rad50 Nbs1) is central to chromosomal maintenance and functions in homologous recombination, telomere maintenance and sister chromatid association. The Rad50 coiled-coil region contains a dimer interface at the apex of the coiled coils in which pairs of conserved Cys-X-X-Cys motifs form interlocking hooks that bind one Zn ion. This alignment includes the zinc hook motif and a short stretch of coiled-coil on either side.; GO: 0004518 nuclease activity, 0005524 ATP binding, 0008270 zinc ion binding, 0006281 DNA repair; PDB: 1L8D_B.
Probab=63.86  E-value=2.7  Score=19.17  Aligned_cols=12  Identities=25%  Similarity=0.645  Sum_probs=6.8

Q ss_pred             cCCCCCcccccc
Q psy12028         32 GCPQCPYRSRQK   43 (118)
Q Consensus        32 ~C~~c~~~f~~~   43 (118)
                      .||+|+..|...
T Consensus        22 ~CPlC~r~l~~e   33 (54)
T PF04423_consen   22 CCPLCGRPLDEE   33 (54)
T ss_dssp             E-TTT--EE-HH
T ss_pred             cCCCCCCCCCHH
Confidence            999999998764


No 173
>KOG4124|consensus
Probab=63.03  E-value=1.3  Score=28.66  Aligned_cols=22  Identities=41%  Similarity=0.794  Sum_probs=15.2

Q ss_pred             CccCCC--CCccccchHHHHhhhh
Q psy12028          1 MYACDV--CGKEYQHKRTLYRHKK   22 (118)
Q Consensus         1 ~~~C~~--C~~~~~~~~~l~~h~~   22 (118)
                      ||+|++  |.+.+.....|..|..
T Consensus       349 ~~~~~vp~~~~~~~n~ng~~~~~~  372 (442)
T KOG4124|consen  349 PYKCPVPNCDKAYKNQNGLKYHKL  372 (442)
T ss_pred             CCCCCCCcchhhcccCcceeeccc
Confidence            466665  7888877777776644


No 174
>PF01428 zf-AN1:  AN1-like Zinc finger;  InterPro: IPR000058 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents the AN1-type zinc finger domain, which has a dimetal (zinc)-bound alpha/beta fold. This domain was first identified as a zinc finger at the C terminus of AN1 Q91889 from SWISSPROT, a ubiquitin-like protein in Xenopus laevis []. The AN1-type zinc finger contains six conserved cysteines and two histidines that could potentially coordinate 2 zinc atoms. Certain stress-associated proteins (SAP) contain AN1 domain, often in combination with A20 zinc finger domains (SAP8) or C2H2 domains (SAP16) []. For example, the human protein Znf216 has an A20 zinc-finger at the N terminus and an AN1 zinc-finger at the C terminus, acting to negatively regulate the NFkappaB activation pathway and to interact with components of the immune response like RIP, IKKgamma and TRAF6. The interact of Znf216 with IKK-gamma and RIP is mediated by the A20 zinc-finger domain, while its interaction with TRAF6 is mediated by the AN1 zinc-finger domain; therefore, both zinc-finger domains are involved in regulating the immune response []. The AN1 zinc finger domain is also found in proteins containing a ubiquitin-like domain, which are involved in the ubiquitination pathway []. Proteins containing an AN1-type zinc finger include:   Ascidian posterior end mark 6 (pem-6) protein []. Human AWP1 protein (associated with PRK1), which is expressed during early embryogenesis []. Human immunoglobulin mu binding protein 2 (SMUBP-2), mutations in which cause muscular atrophy with respiratory distress type 1 [].   More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 1WFP_A 1WYS_A 1WG2_A 1WFH_A 1X4W_A 1WFE_A 1WFL_A 1X4V_A.
Probab=61.95  E-value=2.2  Score=18.52  Aligned_cols=12  Identities=33%  Similarity=0.750  Sum_probs=7.3

Q ss_pred             CCccCCCCCCCC
Q psy12028         90 PKFECPHCPYRS  101 (118)
Q Consensus        90 ~~~~C~~C~~~f  101 (118)
                      .|+.|..|+..|
T Consensus        12 ~~~~C~~C~~~F   23 (43)
T PF01428_consen   12 LPFKCKHCGKSF   23 (43)
T ss_dssp             SHEE-TTTS-EE
T ss_pred             CCeECCCCCccc
Confidence            467788888766


No 175
>PTZ00255 60S ribosomal protein L37a; Provisional
Probab=60.99  E-value=3.9  Score=21.11  Aligned_cols=33  Identities=21%  Similarity=0.520  Sum_probs=19.7

Q ss_pred             CCCccCCCCCcccccchHHHHHhhhhhccCCcccccccCchhhhhhc
Q psy12028         28 EPKFGCPQCPYRSRQKATLNRHLGWEQLQGNAHVMYACDVCGKVYQH   74 (118)
Q Consensus        28 ~~~~~C~~c~~~f~~~~~l~~h~~~~~~~~~~~~~~~c~~c~~~~~~   74 (118)
                      ...|.||+|++.-....          ..    ..|.|..|+..|..
T Consensus        34 ~a~y~CpfCgk~~vkR~----------a~----GIW~C~~C~~~~AG   66 (90)
T PTZ00255         34 HAKYFCPFCGKHAVKRQ----------AV----GIWRCKGCKKTVAG   66 (90)
T ss_pred             hCCccCCCCCCCceeee----------ee----EEEEcCCCCCEEeC
Confidence            34699999985432211          11    23788888776654


No 176
>PF15135 UPF0515:  Uncharacterised protein UPF0515
Probab=60.54  E-value=8.1  Score=23.99  Aligned_cols=14  Identities=21%  Similarity=0.565  Sum_probs=10.1

Q ss_pred             CCccCCCCCccccc
Q psy12028         29 PKFGCPQCPYRSRQ   42 (118)
Q Consensus        29 ~~~~C~~c~~~f~~   42 (118)
                      +.|.|..|...|..
T Consensus       111 rqFaC~~Cd~~WwR  124 (278)
T PF15135_consen  111 RQFACSSCDHMWWR  124 (278)
T ss_pred             eeeeccccchHHHh
Confidence            56889999766543


No 177
>PTZ00448 hypothetical protein; Provisional
Probab=59.83  E-value=8.5  Score=25.35  Aligned_cols=23  Identities=13%  Similarity=0.446  Sum_probs=20.2

Q ss_pred             CccCCCCCCCCCChhHHHHHHhh
Q psy12028         91 KFECPHCPYRSKRKDTLDRHMKI  113 (118)
Q Consensus        91 ~~~C~~C~~~f~~~~~l~~H~~~  113 (118)
                      .|.|..|+..|.+....+.|+++
T Consensus       314 ~~tC~~C~v~F~~~~~qR~H~KS  336 (373)
T PTZ00448        314 MLLCRKCNIQLMDHNAFKQHYRS  336 (373)
T ss_pred             CccccccccccCCHHHHHHHhhh
Confidence            58899999999988888889875


No 178
>cd00730 rubredoxin Rubredoxin; nonheme iron binding domains containing a [Fe(SCys)4] center. Rubredoxins are small nonheme iron proteins. The iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), but iron can also be replaced by cobalt, nickel or zinc. They are believed to be involved in electron transfer.
Probab=59.46  E-value=4.7  Score=18.30  Aligned_cols=12  Identities=42%  Similarity=1.193  Sum_probs=9.2

Q ss_pred             ccCCCCCccccc
Q psy12028          2 YACDVCGKEYQH   13 (118)
Q Consensus         2 ~~C~~C~~~~~~   13 (118)
                      |+|..||.+|.-
T Consensus         2 y~C~~CgyiYd~   13 (50)
T cd00730           2 YECRICGYIYDP   13 (50)
T ss_pred             cCCCCCCeEECC
Confidence            678888888764


No 179
>PF01155 HypA:  Hydrogenase expression/synthesis hypA family;  InterPro: IPR000688 Bacterial membrane-bound nickel-dependent hydrogenases requires a number of accessory proteins which are involved in their maturation. The exact role of these proteins is not yet clear, but some seem to be required for the incorporation of the nickel ions []. One of these proteins is generally known as hypA. It is a protein of about 12 to 14 kDa that contains, in its C-terminal region, four conserved cysteines that form a zinc-finger like motif. Escherichia coli has two proteins that belong to this family, hypA and hybF. A homologue, MJ0214, has also been found in a number of archaeal species, including the genome of Methanocaldococcus jannaschii (Methanococcus jannaschii).; GO: 0016151 nickel ion binding, 0006464 protein modification process; PDB: 2KDX_A 3A44_D 3A43_B.
Probab=58.90  E-value=3.2  Score=22.30  Aligned_cols=12  Identities=17%  Similarity=0.382  Sum_probs=5.5

Q ss_pred             ccCCCCCccccc
Q psy12028         31 FGCPQCPYRSRQ   42 (118)
Q Consensus        31 ~~C~~c~~~f~~   42 (118)
                      +.|..|+..|..
T Consensus        71 ~~C~~Cg~~~~~   82 (113)
T PF01155_consen   71 ARCRDCGHEFEP   82 (113)
T ss_dssp             EEETTTS-EEEC
T ss_pred             EECCCCCCEEec
Confidence            445555555543


No 180
>PTZ00448 hypothetical protein; Provisional
Probab=57.40  E-value=9.2  Score=25.20  Aligned_cols=21  Identities=14%  Similarity=0.452  Sum_probs=9.6

Q ss_pred             ccCCCCCcccccchHHHHHhh
Q psy12028         31 FGCPQCPYRSRQKATLNRHLG   51 (118)
Q Consensus        31 ~~C~~c~~~f~~~~~l~~h~~   51 (118)
                      |.|..|+..|.+....+.|++
T Consensus       315 ~tC~~C~v~F~~~~~qR~H~K  335 (373)
T PTZ00448        315 LLCRKCNIQLMDHNAFKQHYR  335 (373)
T ss_pred             ccccccccccCCHHHHHHHhh
Confidence            344445444444444444443


No 181
>COG1773 Rubredoxin [Energy production and conversion]
Probab=57.34  E-value=3.8  Score=19.03  Aligned_cols=12  Identities=42%  Similarity=1.126  Sum_probs=8.5

Q ss_pred             ccCCCCCccccc
Q psy12028          2 YACDVCGKEYQH   13 (118)
Q Consensus         2 ~~C~~C~~~~~~   13 (118)
                      |+|..||.+|.-
T Consensus         4 ~~C~~CG~vYd~   15 (55)
T COG1773           4 WRCSVCGYVYDP   15 (55)
T ss_pred             eEecCCceEecc
Confidence            567888877753


No 182
>PRK00762 hypA hydrogenase nickel incorporation protein; Provisional
Probab=57.29  E-value=5.1  Score=21.95  Aligned_cols=11  Identities=27%  Similarity=0.860  Sum_probs=6.9

Q ss_pred             ccCCCCCccccc
Q psy12028         31 FGCPQCPYRSRQ   42 (118)
Q Consensus        31 ~~C~~c~~~f~~   42 (118)
                      +.| .|+..|..
T Consensus        71 ~~C-~Cg~~~~~   81 (124)
T PRK00762         71 IEC-ECGYEGVV   81 (124)
T ss_pred             EEe-eCcCcccc
Confidence            667 67766554


No 183
>PRK05978 hypothetical protein; Provisional
Probab=57.28  E-value=3.7  Score=23.29  Aligned_cols=9  Identities=33%  Similarity=0.700  Sum_probs=6.1

Q ss_pred             ccCCCCCcc
Q psy12028         31 FGCPQCPYR   39 (118)
Q Consensus        31 ~~C~~c~~~   39 (118)
                      -.||.|++.
T Consensus        34 grCP~CG~G   42 (148)
T PRK05978         34 GRCPACGEG   42 (148)
T ss_pred             CcCCCCCCC
Confidence            567777765


No 184
>PF06397 Desulfoferrod_N:  Desulfoferrodoxin, N-terminal domain;  InterPro: IPR004462 This domain is found as essentially the full length of desulforedoxin, a 37-residue homodimeric non-haem iron protein. It is also found as the N-terminal domain of desulfoferrodoxin (rbo), a homodimeric non-haem iron protein with 2 Fe atoms per monomer in different oxidation states. This domain binds the ferric rather than the ferrous Fe of desulfoferrodoxin. Neelaredoxin, a monomeric blue non-haem iron protein, lacks this domain.; GO: 0005506 iron ion binding; PDB: 1DFX_A 1VZI_B 2JI2_D 1VZH_B 2JI3_C 2JI1_C 1VZG_A 1CFW_A 2LK5_B 1DHG_B ....
Probab=56.78  E-value=3.2  Score=17.46  Aligned_cols=10  Identities=40%  Similarity=1.155  Sum_probs=4.5

Q ss_pred             ccCCCCCccc
Q psy12028          2 YACDVCGKEY   11 (118)
Q Consensus         2 ~~C~~C~~~~   11 (118)
                      |+|..||...
T Consensus         7 YkC~~CGniV   16 (36)
T PF06397_consen    7 YKCEHCGNIV   16 (36)
T ss_dssp             EE-TTT--EE
T ss_pred             EEccCCCCEE
Confidence            6677777654


No 185
>PF01780 Ribosomal_L37ae:  Ribosomal L37ae protein family;  InterPro: IPR002674 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms. The codons of the mRNA are exposed on the ribosome to allow tRNA binding. This leads to the incorporation of amino acids into the growing polypeptide chain in accordance with the genetic information. Incoming amino acid monomers enter the ribosomal A site in the form of aminoacyl-tRNAs complexed with elongation factor Tu (EF-Tu) and GTP. The growing polypeptide chain, situated in the P site as peptidyl-tRNA, is then transferred to aminoacyl-tRNA and the new peptidyl-tRNA, extended by one residue, is translocated to the P site with the aid the elongation factor G (EF-G) and GTP as the deacylated tRNA is released from the ribosome through one or more exit sites [, ]. About 2/3 of the mass of the ribosome consists of RNA and 1/3 of protein. The proteins are named in accordance with the subunit of the ribosome which they belong to - the small (S1 to S31) and the large (L1 to L44). Usually they decorate the rRNA cores of the subunits.  Many ribosomal proteins, particularly those of the large subunit, are composed of a globular, surfaced-exposed domain with long finger-like projections that extend into the rRNA core to stabilise its structure. Most of the proteins interact with multiple RNA elements, often from different domains. In the large subunit, about 1/3 of the 23S rRNA nucleotides are at least in van der Waal's contact with protein, and L22 interacts with all six domains of the 23S rRNA. Proteins S4 and S7, which initiate assembly of the 16S rRNA, are located at junctions of five and four RNA helices, respectively. In this way proteins serve to organise and stabilise the rRNA tertiary structure. While the crucial activities of decoding and peptide transfer are RNA based, proteins play an active role in functions that may have evolved to streamline the process of protein synthesis. In addition to their function in the ribosome, many ribosomal proteins have some function 'outside' the ribosome [, ]. This ribosomal protein is found in archaebacteria and eukaryotes []. Ribosomal protein L37 has a single zinc finger-like motif of the C2-C2 type [].; GO: 0003735 structural constituent of ribosome, 0006412 translation, 0005622 intracellular, 0005840 ribosome; PDB: 4A1E_Y 4A17_Y 4A1C_Y 4A1A_Y 3O58_g 3IZS_m 3O5H_g 1S1I_9 3IZR_m 1YSH_D ....
Probab=56.62  E-value=2  Score=22.14  Aligned_cols=32  Identities=28%  Similarity=0.742  Sum_probs=18.1

Q ss_pred             CCccCCCCCcccccchHHHHHhhhhhccCCcccccccCchhhhhhc
Q psy12028         29 PKFGCPQCPYRSRQKATLNRHLGWEQLQGNAHVMYACDVCGKVYQH   74 (118)
Q Consensus        29 ~~~~C~~c~~~f~~~~~l~~h~~~~~~~~~~~~~~~c~~c~~~~~~   74 (118)
                      ..|.||.|++.-....          ..    ..|.|..|+..|..
T Consensus        34 ~ky~Cp~Cgk~~vkR~----------a~----GIW~C~~C~~~~AG   65 (90)
T PF01780_consen   34 AKYTCPFCGKTSVKRV----------AT----GIWKCKKCGKKFAG   65 (90)
T ss_dssp             S-BEESSSSSSEEEEE----------ET----TEEEETTTTEEEE-
T ss_pred             CCCcCCCCCCceeEEe----------ee----EEeecCCCCCEEeC
Confidence            3588999987653221          11    22777777776543


No 186
>PF04780 DUF629:  Protein of unknown function (DUF629);  InterPro: IPR006865 This domain represents a region of several plant proteins of unknown function. A C2H2 zinc finger is predicted in this region in some family members, but the spacing between the cysteine residues is not conserved throughout the family.
Probab=56.60  E-value=8.1  Score=26.37  Aligned_cols=23  Identities=17%  Similarity=0.440  Sum_probs=20.8

Q ss_pred             CCccCCCCCcccccchHHHHHhh
Q psy12028         29 PKFGCPQCPYRSRQKATLNRHLG   51 (118)
Q Consensus        29 ~~~~C~~c~~~f~~~~~l~~h~~   51 (118)
                      +.+.|+.|.+.|.....+..|+.
T Consensus        56 rFWiCp~CskkF~d~~~~~~H~~   78 (466)
T PF04780_consen   56 RFWICPRCSKKFSDAESCLSHME   78 (466)
T ss_pred             eEeeCCcccceeCCHHHHHHHHH
Confidence            34889999999999999999986


No 187
>TIGR01384 TFS_arch transcription factor S, archaeal. There has been an apparent duplication event in the Halobacteriaceae lineage (Haloarcula, Haloferax, Haloquadratum, Halobacterium and Natromonas). There appears to be a separate duplication in Methanosphaera stadtmanae.
Probab=56.30  E-value=2.1  Score=22.46  Aligned_cols=40  Identities=23%  Similarity=0.561  Sum_probs=22.8

Q ss_pred             CccCCCCCcccccchHHHHHhhhhhccCCcccccccCchhhhhh
Q psy12028         30 KFGCPQCPYRSRQKATLNRHLGWEQLQGNAHVMYACDVCGKVYQ   73 (118)
Q Consensus        30 ~~~C~~c~~~f~~~~~l~~h~~~~~~~~~~~~~~~c~~c~~~~~   73 (118)
                      ...|+.||..-.....++  ++  ........-|.|..|+..+.
T Consensus        62 ~~~Cp~Cg~~~a~f~~~Q--~R--sadE~~T~fy~C~~C~~~w~  101 (104)
T TIGR01384        62 RVECPKCGHKEAYYWLLQ--TR--RADEPETRFYKCTKCGYVWR  101 (104)
T ss_pred             cCCCCCCCCCeeEEEEec--cC--CCCCCcEEEEEeCCCCCeeE
Confidence            478999986544333222  11  12223345688988887654


No 188
>COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair]
Probab=55.84  E-value=4.9  Score=29.02  Aligned_cols=12  Identities=25%  Similarity=0.648  Sum_probs=7.0

Q ss_pred             CCCccCCCCCcc
Q psy12028         28 EPKFGCPQCPYR   39 (118)
Q Consensus        28 ~~~~~C~~c~~~   39 (118)
                      ..|..||.||..
T Consensus       473 ~~p~~Cp~Cgs~  484 (730)
T COG1198         473 PIPQSCPECGSE  484 (730)
T ss_pred             CCCCCCCCCCCC
Confidence            455666666644


No 189
>PLN02294 cytochrome c oxidase subunit Vb
Probab=55.04  E-value=7.2  Score=22.71  Aligned_cols=16  Identities=25%  Similarity=0.580  Sum_probs=12.6

Q ss_pred             CCCccCCCCCcccccc
Q psy12028         28 EPKFGCPQCPYRSRQK   43 (118)
Q Consensus        28 ~~~~~C~~c~~~f~~~   43 (118)
                      .++..|+.||..|.-.
T Consensus       139 Gkp~RCpeCG~~fkL~  154 (174)
T PLN02294        139 GKSFECPVCTQYFELE  154 (174)
T ss_pred             CCceeCCCCCCEEEEE
Confidence            4678999999888643


No 190
>PRK14714 DNA polymerase II large subunit; Provisional
Probab=54.87  E-value=14  Score=28.68  Aligned_cols=32  Identities=25%  Similarity=0.585  Sum_probs=19.1

Q ss_pred             ccCCCCCcccccchHHHHHhhhhhccCCcc--cccccCchhhh
Q psy12028         31 FGCPQCPYRSRQKATLNRHLGWEQLQGNAH--VMYACDVCGKV   71 (118)
Q Consensus        31 ~~C~~c~~~f~~~~~l~~h~~~~~~~~~~~--~~~~c~~c~~~   71 (118)
                      +.||.||..-...      .   |..|+..  .+|.|+.|+..
T Consensus       668 rkCPkCG~~t~~~------f---CP~CGs~te~vy~CPsCGae  701 (1337)
T PRK14714        668 RRCPSCGTETYEN------R---CPDCGTHTEPVYVCPDCGAE  701 (1337)
T ss_pred             EECCCCCCccccc------c---CcccCCcCCCceeCccCCCc
Confidence            7888888753221      1   4444432  35788888874


No 191
>PF05290 Baculo_IE-1:  Baculovirus immediate-early protein (IE-0);  InterPro: IPR007954 This entry contains the Baculovirus immediate-early protein IE-0.
Probab=54.31  E-value=4.5  Score=22.52  Aligned_cols=16  Identities=19%  Similarity=0.465  Sum_probs=12.2

Q ss_pred             CCCccCCCCCcccccc
Q psy12028         28 EPKFGCPQCPYRSRQK   43 (118)
Q Consensus        28 ~~~~~C~~c~~~f~~~   43 (118)
                      .+.|+|.+|......+
T Consensus        78 ~~lYeCnIC~etS~ee   93 (140)
T PF05290_consen   78 PKLYECNICKETSAEE   93 (140)
T ss_pred             CCceeccCcccccchh
Confidence            4679999998877554


No 192
>KOG2593|consensus
Probab=53.84  E-value=16  Score=24.68  Aligned_cols=34  Identities=26%  Similarity=0.597  Sum_probs=19.1

Q ss_pred             cccccCchhhhhhchHHHHHHHhhhcCCCCCccCCCCC
Q psy12028         61 VMYACDVCGKVYQHKQTLDRHKKDECGQEPKFECPHCP   98 (118)
Q Consensus        61 ~~~~c~~c~~~~~~~~~l~~h~~~h~~~~~~~~C~~C~   98 (118)
                      ..|.|+.|.+.|+....++   -.-.. .-.|.|..|+
T Consensus       127 ~~Y~Cp~C~kkyt~Lea~~---L~~~~-~~~F~C~~C~  160 (436)
T KOG2593|consen  127 AGYVCPNCQKKYTSLEALQ---LLDNE-TGEFHCENCG  160 (436)
T ss_pred             ccccCCccccchhhhHHHH---hhccc-CceEEEecCC
Confidence            3477777777776654432   22211 2357777776


No 193
>TIGR00416 sms DNA repair protein RadA. The gene protuct codes for a probable ATP-dependent protease involved in both DNA repair and degradation of proteins, peptides, glycopeptides. Also known as sms. Residues 11-28 of the SEED alignment contain a putative Zn binding domain. Residues 110-117 of the seed contain a putative ATP binding site both documented in Haemophilus and in Listeria monocytogenes. for E.coli see ( J. BACTERIOL. 178:5045-5048(1996)).
Probab=53.51  E-value=6.7  Score=26.62  Aligned_cols=10  Identities=40%  Similarity=0.860  Sum_probs=5.0

Q ss_pred             ccCCCCCccc
Q psy12028         31 FGCPQCPYRS   40 (118)
Q Consensus        31 ~~C~~c~~~f   40 (118)
                      |.|..||..+
T Consensus         8 y~C~~Cg~~~   17 (454)
T TIGR00416         8 FVCQHCGADS   17 (454)
T ss_pred             EECCcCCCCC
Confidence            5555555443


No 194
>KOG0717|consensus
Probab=53.47  E-value=7.3  Score=26.49  Aligned_cols=22  Identities=27%  Similarity=0.699  Sum_probs=18.5

Q ss_pred             ccCCCCCccccchHHHHhhhhh
Q psy12028          2 YACDVCGKEYQHKRTLYRHKKD   23 (118)
Q Consensus         2 ~~C~~C~~~~~~~~~l~~h~~~   23 (118)
                      +-|.+|++.|.+...+.+|..+
T Consensus       293 lyC~vCnKsFKseKq~kNHEnS  314 (508)
T KOG0717|consen  293 LYCVVCNKSFKSEKQLKNHENS  314 (508)
T ss_pred             eEEeeccccccchHHHHhhHHH
Confidence            4589999999999999888654


No 195
>PF01286 XPA_N:  XPA protein N-terminal;  InterPro: IPR022652 Xeroderma pigmentosum (XP) [] is a human autosomal recessive disease, characterised by a high incidence of sunlight-induced skin cancer. Skin cells of individual's with this condition are hypersensitive to ultraviolet light, due to defects in the incision step of DNA excision repair. There are a minimum of seven genetic complementation groups involved in this pathway: XP-A to XP-G. XP-A is the most severe form of the disease and is due to defects in a 30 kDa nuclear protein called XPA (or XPAC) []. The sequence of the XPA protein is conserved from higher eukaryotes [] to yeast (gene RAD14) []. XPA is a hydrophilic protein of 247 to 296 amino-acid residues which has a C4-type zinc finger motif in its central section. This entry contains the zinc-finger containing region in the XPA protein. It is found N-terminal to PF05181 from PFAM ; PDB: 1D4U_A 1XPA_A.
Probab=53.19  E-value=4.7  Score=16.69  Aligned_cols=14  Identities=14%  Similarity=0.199  Sum_probs=6.6

Q ss_pred             ccCCCCCCCCCChh
Q psy12028         92 FECPHCPYRSKRKD  105 (118)
Q Consensus        92 ~~C~~C~~~f~~~~  105 (118)
                      -.|..|++.|..+.
T Consensus         4 ~~C~eC~~~f~dSy   17 (34)
T PF01286_consen    4 PKCDECGKPFMDSY   17 (34)
T ss_dssp             EE-TTT--EES-SS
T ss_pred             chHhHhCCHHHHHH
Confidence            35788888876553


No 196
>PF08209 Sgf11:  Sgf11 (transcriptional regulation protein);  InterPro: IPR013246 The Sgf11 family is a SAGA complex subunit in Saccharomyces cerevisiae (Baker's yeast). The SAGA complex is a multisubunit protein complex involved in transcriptional regulation. SAGA combines proteins involved in interactions with DNA-bound activators and TATA-binding protein (TBP), as well as enzymes for histone acetylation and deubiquitylation [].; PDB: 3M99_B 2LO2_A 3MHH_C 3MHS_C.
Probab=52.79  E-value=14  Score=15.12  Aligned_cols=20  Identities=25%  Similarity=0.569  Sum_probs=12.5

Q ss_pred             CccCCCCCcccccchHHHHHh
Q psy12028         30 KFGCPQCPYRSRQKATLNRHL   50 (118)
Q Consensus        30 ~~~C~~c~~~f~~~~~l~~h~   50 (118)
                      .+.|+.|++.... ..+..|+
T Consensus         4 ~~~C~nC~R~v~a-~RfA~HL   23 (33)
T PF08209_consen    4 YVECPNCGRPVAA-SRFAPHL   23 (33)
T ss_dssp             EEE-TTTSSEEEG-GGHHHHH
T ss_pred             eEECCCCcCCcch-hhhHHHH
Confidence            4678888887654 3466665


No 197
>PRK00420 hypothetical protein; Validated
Probab=52.30  E-value=12  Score=20.27  Aligned_cols=10  Identities=30%  Similarity=0.660  Sum_probs=4.9

Q ss_pred             ccCCCCCccc
Q psy12028         31 FGCPQCPYRS   40 (118)
Q Consensus        31 ~~C~~c~~~f   40 (118)
                      -.||.||..+
T Consensus        24 ~~CP~Cg~pL   33 (112)
T PRK00420         24 KHCPVCGLPL   33 (112)
T ss_pred             CCCCCCCCcc
Confidence            3455555443


No 198
>cd00924 Cyt_c_Oxidase_Vb Cytochrome c oxidase subunit Vb.  Cytochrome c oxidase (CcO), the terminal oxidase in the respiratory chains of eukaryotes and most bacteria, is a multi-chain transmembrane protein located in the inner membrane of mitochondria and the cell membrane of prokaryotes.  It catalyzes the reduction of O2 and simultaneously pumps protons across the membrane.  The number of subunits varies from three to five in bacteria and up to 13 in mammalian mitochondria. Subunits I, II, and III of mammalian CcO are encoded within the mitochondrial genome and the remaining 10 subunits are encoded within the nuclear genome.  Found only in eukaryotes, subunit Vb is one of three mammalian subunits that lacks a transmembrane region.  Subunit Vb is located on the matrix side of the membrane and binds the regulatory subunit of protein kinase A.  The abnormally extended conformation is stable only in the CcO assembly.
Probab=51.96  E-value=8.8  Score=20.15  Aligned_cols=15  Identities=20%  Similarity=0.412  Sum_probs=11.9

Q ss_pred             CCCccCCCCCccccc
Q psy12028         28 EPKFGCPQCPYRSRQ   42 (118)
Q Consensus        28 ~~~~~C~~c~~~f~~   42 (118)
                      .++..|+.||..|.-
T Consensus        77 g~~~rC~eCG~~fkL   91 (97)
T cd00924          77 GKPKRCPECGHVFKL   91 (97)
T ss_pred             CCceeCCCCCcEEEE
Confidence            368999999988853


No 199
>COG5216 Uncharacterized conserved protein [Function unknown]
Probab=51.39  E-value=11  Score=17.73  Aligned_cols=11  Identities=36%  Similarity=0.911  Sum_probs=5.9

Q ss_pred             ccCCCCCccccc
Q psy12028         31 FGCPQCPYRSRQ   42 (118)
Q Consensus        31 ~~C~~c~~~f~~   42 (118)
                      |.|| ||..|..
T Consensus        23 yPCP-CGDRFeI   33 (67)
T COG5216          23 YPCP-CGDRFEI   33 (67)
T ss_pred             ecCC-CCCEeEE
Confidence            4455 6655544


No 200
>PF00301 Rubredoxin:  Rubredoxin;  InterPro: IPR004039 Rubredoxin is a low molecular weight iron-containing bacterial protein involved in electron transfer [, ], sometimes replacing ferredoxin as an electron carrier []. The 3-D structures of a number of rubredoxins have been solved [, ]. The fold belongs to the alpha+beta class, with 2 alpha-helices and 2-3 beta-strands. Its active site contains an iron ion which is co-ordinated by the sulphurs of four conserved cysteine residues forming an almost regular tetrahedron. The conserved cysteines reside on two loops, which are the most conserved regions of the protein. In addition, a ring of acidic residues in the proximity of the [Fe(Cys)4] centre is also well-conserved []. ; GO: 0009055 electron carrier activity, 0046872 metal ion binding; PDB: 2RDV_C 1RDV_A 1S24_A 1T9O_B 1B2J_A 1SMW_A 2PVE_B 1BFY_A 1T9P_C 1C09_C ....
Probab=50.75  E-value=4.5  Score=18.09  Aligned_cols=13  Identities=46%  Similarity=1.145  Sum_probs=8.6

Q ss_pred             ccCCCCCccccch
Q psy12028          2 YACDVCGKEYQHK   14 (118)
Q Consensus         2 ~~C~~C~~~~~~~   14 (118)
                      |+|..|+.+|.-.
T Consensus         2 y~C~~CgyvYd~~   14 (47)
T PF00301_consen    2 YQCPVCGYVYDPE   14 (47)
T ss_dssp             EEETTTSBEEETT
T ss_pred             cCCCCCCEEEcCC
Confidence            5677777776543


No 201
>COG4530 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=50.73  E-value=16  Score=19.61  Aligned_cols=14  Identities=7%  Similarity=-0.074  Sum_probs=10.1

Q ss_pred             CCCccCCCCCCCCC
Q psy12028         89 EPKFECPHCPYRSK  102 (118)
Q Consensus        89 ~~~~~C~~C~~~f~  102 (118)
                      ..|..|++||++|.
T Consensus        24 rdPiVsPytG~s~P   37 (129)
T COG4530          24 RDPIVSPYTGKSYP   37 (129)
T ss_pred             CCccccCcccccch
Confidence            45777888888773


No 202
>CHL00174 accD acetyl-CoA carboxylase beta subunit; Reviewed
Probab=50.71  E-value=8.8  Score=24.54  Aligned_cols=10  Identities=20%  Similarity=0.464  Sum_probs=4.5

Q ss_pred             ccCCCCCccc
Q psy12028         31 FGCPQCPYRS   40 (118)
Q Consensus        31 ~~C~~c~~~f   40 (118)
                      .+|+.|+...
T Consensus        39 ~kc~~C~~~~   48 (296)
T CHL00174         39 VQCENCYGLN   48 (296)
T ss_pred             eECCCccchh
Confidence            3445554443


No 203
>PF12760 Zn_Tnp_IS1595:  Transposase zinc-ribbon domain;  InterPro: IPR024442 This zinc binding domain is found in a range of transposase proteins such as ISSPO8, ISSOD11, ISRSSP2 etc. It may be a zinc-binding beta ribbon domain that could bind DNA.
Probab=50.07  E-value=6.9  Score=17.17  Aligned_cols=9  Identities=44%  Similarity=1.176  Sum_probs=7.3

Q ss_pred             ccCCCCCcc
Q psy12028         31 FGCPQCPYR   39 (118)
Q Consensus        31 ~~C~~c~~~   39 (118)
                      +.||.||..
T Consensus        19 ~~CP~Cg~~   27 (46)
T PF12760_consen   19 FVCPHCGST   27 (46)
T ss_pred             CCCCCCCCe
Confidence            779999865


No 204
>PRK11823 DNA repair protein RadA; Provisional
Probab=49.26  E-value=8.6  Score=26.05  Aligned_cols=9  Identities=56%  Similarity=1.468  Sum_probs=4.7

Q ss_pred             ccCCCCCcc
Q psy12028          2 YACDVCGKE   10 (118)
Q Consensus         2 ~~C~~C~~~   10 (118)
                      |.|..||..
T Consensus         8 y~C~~Cg~~   16 (446)
T PRK11823          8 YVCQECGAE   16 (446)
T ss_pred             EECCcCCCC
Confidence            455555543


No 205
>COG3091 SprT Zn-dependent metalloprotease, SprT family [General function prediction only]
Probab=48.79  E-value=6.7  Score=22.37  Aligned_cols=35  Identities=29%  Similarity=0.669  Sum_probs=23.2

Q ss_pred             ccccccCchhhhhhchHHHHHHHhhhcCCCCCccCCCCCCC
Q psy12028         60 HVMYACDVCGKVYQHKQTLDRHKKDECGQEPKFECPHCPYR  100 (118)
Q Consensus        60 ~~~~~c~~c~~~~~~~~~l~~h~~~h~~~~~~~~C~~C~~~  100 (118)
                      ..+|.|. |+..+...   .+|-..-.| + .|.|..|+-.
T Consensus       115 ~~~Y~C~-C~q~~l~~---RRhn~~~~g-~-~YrC~~C~gk  149 (156)
T COG3091         115 TYPYRCQ-CQQHYLRI---RRHNTVRRG-E-VYRCGKCGGK  149 (156)
T ss_pred             ceeEEee-cCCccchh---hhccccccc-c-eEEeccCCce
Confidence            4578888 98876543   334444445 5 7999999753


No 206
>PF14311 DUF4379:  Domain of unknown function (DUF4379)
Probab=48.30  E-value=17  Score=16.54  Aligned_cols=15  Identities=20%  Similarity=0.603  Sum_probs=11.5

Q ss_pred             CccCCCCCcccccch
Q psy12028         30 KFGCPQCPYRSRQKA   44 (118)
Q Consensus        30 ~~~C~~c~~~f~~~~   44 (118)
                      -+.|+.|+..|...-
T Consensus        28 ~W~C~~Cgh~w~~~v   42 (55)
T PF14311_consen   28 WWKCPKCGHEWKASV   42 (55)
T ss_pred             EEECCCCCCeeEccH
Confidence            488999988887654


No 207
>COG1326 Uncharacterized archaeal Zn-finger protein [General function prediction only]
Probab=48.29  E-value=17  Score=21.73  Aligned_cols=14  Identities=29%  Similarity=0.615  Sum_probs=9.9

Q ss_pred             CCCccCCCCCcccc
Q psy12028         28 EPKFGCPQCPYRSR   41 (118)
Q Consensus        28 ~~~~~C~~c~~~f~   41 (118)
                      +..+.|..||..+.
T Consensus        28 ~~lvrC~eCG~V~~   41 (201)
T COG1326          28 EPLVRCEECGTVHP   41 (201)
T ss_pred             ceEEEccCCCcEee
Confidence            44577888887774


No 208
>TIGR00515 accD acetyl-CoA carboxylase, carboxyl transferase, beta subunit. The enzyme acetyl-CoA carboxylase contains a biotin carboxyl carrier protein or domain, a biotin carboxylase, and a carboxyl transferase. This model represents the beta chain of the carboxyl transferase for cases in which the architecture of the protein is as in E. coli, in which the carboxyltransferase portion consists of two non-identical subnits, alpha and beta.
Probab=47.83  E-value=15  Score=23.37  Aligned_cols=10  Identities=30%  Similarity=0.713  Sum_probs=4.6

Q ss_pred             ccCCCCCccc
Q psy12028         31 FGCPQCPYRS   40 (118)
Q Consensus        31 ~~C~~c~~~f   40 (118)
                      ..|+.|+...
T Consensus        27 ~~c~~c~~~~   36 (285)
T TIGR00515        27 TKCPKCGQVL   36 (285)
T ss_pred             eECCCCcchh
Confidence            3455554443


No 209
>TIGR01385 TFSII transcription elongation factor S-II. This model represents eukaryotic transcription elongation factor S-II. This protein allows stalled RNA transcription complexes to perform a cleavage of the nascent RNA and restart at the newly generated 3-prime end.
Probab=47.80  E-value=4.7  Score=25.74  Aligned_cols=41  Identities=17%  Similarity=0.452  Sum_probs=22.0

Q ss_pred             CCccCCCCCcccccchHHHHHhhhhhccCCcccccccCchhhhhh
Q psy12028         29 PKFGCPQCPYRSRQKATLNRHLGWEQLQGNAHVMYACDVCGKVYQ   73 (118)
Q Consensus        29 ~~~~C~~c~~~f~~~~~l~~h~~~~~~~~~~~~~~~c~~c~~~~~   73 (118)
                      ..+.|+.|+..=.....++  .+  .........|.|..|+..+.
T Consensus       257 ~~~~C~~C~~~~~~~~q~Q--tr--saDEpmT~f~~C~~Cg~~w~  297 (299)
T TIGR01385       257 DLFTCGKCKQKKCTYYQLQ--TR--SADEPMTTFVTCEECGNRWK  297 (299)
T ss_pred             ccccCCCCCCccceEEEec--cc--CCCCCCeEEEEcCCCCCeee
Confidence            3589999985433322221  11  12222235578988887653


No 210
>PF01363 FYVE:  FYVE zinc finger;  InterPro: IPR000306 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The FYVE zinc finger is named after four proteins that it has been found in: Fab1, YOTB/ZK632.12, Vac1, and EEA1. The FYVE finger has been shown to bind two zinc ions []. The FYVE finger has eight potential zinc coordinating cysteine positions. Many members of this family also include two histidines in a motif R+HHC+XCG, where + represents a charged residue and X any residue. FYVE-type domains are divided into two known classes: FYVE domains that specifically bind to phosphatidylinositol 3-phosphate in lipid bilayers and FYVE-related domains of undetermined function []. Those that bind to phosphatidylinositol 3-phosphate are often found in proteins targeted to lipid membranes that are involved in regulating membrane traffic [, , ]. Most FYVE domains target proteins to endosomes by binding specifically to phosphatidylinositol-3-phosphate at the membrane surface. By contrast, the CARP2 FYVE-like domain is not optimized to bind to phosphoinositides or insert into lipid bilayers. FYVE domains are distinguished from other zinc fingers by three signature sequences: an N-terminal WxxD motif, a basic R(R/K)HHCR patch, and a C-terminal RVC motif. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0046872 metal ion binding; PDB: 1HYI_A 1JOC_B 1HYJ_A 1DVP_A 3ZYQ_A 4AVX_A 1VFY_A 3T7L_A 1X4U_A 1WFK_A ....
Probab=47.67  E-value=8.9  Score=18.28  Aligned_cols=11  Identities=18%  Similarity=0.374  Sum_probs=3.9

Q ss_pred             ccCCCCCcccc
Q psy12028         31 FGCPQCPYRSR   41 (118)
Q Consensus        31 ~~C~~c~~~f~   41 (118)
                      -.|..|++.|.
T Consensus        10 ~~C~~C~~~F~   20 (69)
T PF01363_consen   10 SNCMICGKKFS   20 (69)
T ss_dssp             SB-TTT--B-B
T ss_pred             CcCcCcCCcCC
Confidence            35666666663


No 211
>PF11931 DUF3449:  Domain of unknown function (DUF3449);  InterPro: IPR024598 This presumed domain is functionally uncharacterised. It has two conserved sequence motifs: PIP and CEICG and contains a zinc-finger of the C2H2-type.; PDB: 4DGW_A.
Probab=46.47  E-value=6.6  Score=23.46  Aligned_cols=22  Identities=18%  Similarity=0.599  Sum_probs=0.0

Q ss_pred             CCCccCCCCCC-CCCChhHHHHH
Q psy12028         89 EPKFECPHCPY-RSKRKDTLDRH  110 (118)
Q Consensus        89 ~~~~~C~~C~~-~f~~~~~l~~H  110 (118)
                      ...|.|.+||- +|.-+..+.+|
T Consensus        99 ~~ey~CEICGN~~Y~GrkaFekH  121 (196)
T PF11931_consen   99 GVEYKCEICGNQSYKGRKAFEKH  121 (196)
T ss_dssp             -----------------------
T ss_pred             CCeeeeEeCCCcceecHHHHHHh
Confidence            34455666552 33334444444


No 212
>PF10276 zf-CHCC:  Zinc-finger domain;  InterPro: IPR019401 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.   This entry represents a short conserved zinc-finger domain. It contains the sequence motif Cx8Hx14Cx2C. ; PDB: 2JVM_A 2JRR_A 2JZ8_A.
Probab=46.37  E-value=4.6  Score=17.41  Aligned_cols=11  Identities=36%  Similarity=0.766  Sum_probs=5.9

Q ss_pred             CccCCCCCCCC
Q psy12028         91 KFECPHCPYRS  101 (118)
Q Consensus        91 ~~~C~~C~~~f  101 (118)
                      +-.|++||..|
T Consensus        29 ~~~CpYCg~~y   39 (40)
T PF10276_consen   29 PVVCPYCGTRY   39 (40)
T ss_dssp             EEEETTTTEEE
T ss_pred             eEECCCCCCEE
Confidence            34566666544


No 213
>TIGR00143 hypF [NiFe] hydrogenase maturation protein HypF. A previously described regulatory effect of HypF mutatation is attributable to loss of activity of a regulatory hydrogenase. A zinc finger-like region CXXCX(18)CXXCX(24)CXXCX(18)CXXC region further supported the regulatory hypothesis. However, more recent work (PUBMED:11375153) shows the direct effect is on the activity of expressed hydrogenases with nickel/iron centers, rather than on expression.
Probab=46.29  E-value=2.7  Score=30.14  Aligned_cols=58  Identities=21%  Similarity=0.403  Sum_probs=30.9

Q ss_pred             cCCCCCcccccchHHHHHhhhhhccCCcccccccCchhhhhhchHHHHHHHhhhcCCCCCccCCCCCCC
Q psy12028         32 GCPQCPYRSRQKATLNRHLGWEQLQGNAHVMYACDVCGKVYQHKQTLDRHKKDECGQEPKFECPHCPYR  100 (118)
Q Consensus        32 ~C~~c~~~f~~~~~l~~h~~~~~~~~~~~~~~~c~~c~~~~~~~~~l~~h~~~h~~~~~~~~C~~C~~~  100 (118)
                      .|+.||-.|.....|---..  .... .+. --|+.|.+-+.++.+    .+.|   ..+..|+.||..
T Consensus        92 nCt~CGPr~~i~~~lpydr~--~t~m-~~f-~~C~~C~~ey~~p~~----rr~h---~~~~~C~~Cgp~  149 (711)
T TIGR00143        92 SCTHCGPRFTIIEALPYDRE--NTSM-ADF-PLCPDCAKEYKDPLD----RRFH---AQPIACPRCGPQ  149 (711)
T ss_pred             cccCCCCCeEEeecCCCCCC--CcCC-CCC-cCCHHHHHHhcCCcc----ccCC---CCCccCCCCCcE
Confidence            48888887765443211100  1111 111 257778777766643    3444   346778888854


No 214
>PF13821 DUF4187:  Domain of unknown function (DUF4187)
Probab=46.21  E-value=12  Score=17.36  Aligned_cols=18  Identities=22%  Similarity=0.551  Sum_probs=12.0

Q ss_pred             cCCCCCCCCCChhHHHHH
Q psy12028         93 ECPHCPYRSKRKDTLDRH  110 (118)
Q Consensus        93 ~C~~C~~~f~~~~~l~~H  110 (118)
                      =|-+||..|.....|..+
T Consensus        29 YC~~Cg~~Y~d~~dL~~~   46 (55)
T PF13821_consen   29 YCFWCGTKYDDEEDLERN   46 (55)
T ss_pred             eeeeeCCccCCHHHHHhC
Confidence            377777777777666543


No 215
>COG3677 Transposase and inactivated derivatives [DNA replication, recombination, and repair]
Probab=46.02  E-value=9.9  Score=21.05  Aligned_cols=36  Identities=14%  Similarity=0.317  Sum_probs=20.9

Q ss_pred             cccCchhhhhhchHHHHHHHhhhcCCCCCccCCCCCCCCCCh
Q psy12028         63 YACDVCGKVYQHKQTLDRHKKDECGQEPKFECPHCPYRSKRK  104 (118)
Q Consensus        63 ~~c~~c~~~~~~~~~l~~h~~~h~~~~~~~~C~~C~~~f~~~  104 (118)
                      -.||.|+... .    ...-..-.| ...|.|..|++.|...
T Consensus        31 ~~cP~C~s~~-~----~k~g~~~~~-~qRyrC~~C~~tf~~~   66 (129)
T COG3677          31 VNCPRCKSSN-V----VKIGGIRRG-HQRYKCKSCGSTFTVE   66 (129)
T ss_pred             CcCCCCCccc-e----eeECCcccc-ccccccCCcCcceeee
Confidence            4677777543 1    111122223 5569999999988643


No 216
>cd00974 DSRD Desulforedoxin (DSRD) domain; a small non-heme iron domain present in the desulforedoxin (rubredoxin oxidoreductase) and desulfoferrodoxin proteins of some archeael and bacterial methanogens and sulfate/sulfur reducers. Desulforedoxin is a small, single-domain homodimeric protein; each subunit contains an iron atom bound to four cysteinyl sulfur atoms, Fe(S-Cys)4, in a distorted tetrahedral coordination. Its metal center is similar to that found in rubredoxin type proteins. Desulforedoxin is regarded as a potential redox partner for rubredoxin. Desulfoferrodoxin forms a homodimeric protein, with each protomer comprised of two domains, the N-terminal DSRD domain and C-terminal superoxide reductase-like (SORL) domain. Each domain has a distinct iron center: the DSRD iron center I, Fe(S-Cys)4; and the SORL iron center II, Fe[His4Cys(Glu)].
Probab=45.63  E-value=8  Score=15.69  Aligned_cols=10  Identities=40%  Similarity=1.325  Sum_probs=6.8

Q ss_pred             ccCCCCCccc
Q psy12028          2 YACDVCGKEY   11 (118)
Q Consensus         2 ~~C~~C~~~~   11 (118)
                      |+|..||...
T Consensus         5 ykC~~CGniv   14 (34)
T cd00974           5 YKCEICGNIV   14 (34)
T ss_pred             EEcCCCCcEE
Confidence            6677777665


No 217
>PF14787 zf-CCHC_5:  GAG-polyprotein viral zinc-finger; PDB: 1CL4_A 1DSV_A.
Probab=45.63  E-value=14  Score=15.53  Aligned_cols=15  Identities=20%  Similarity=0.328  Sum_probs=8.5

Q ss_pred             ccCCCCCCCCCChhH
Q psy12028         92 FECPHCPYRSKRKDT  106 (118)
Q Consensus        92 ~~C~~C~~~f~~~~~  106 (118)
                      -.|+.|++.|-..++
T Consensus         3 ~~CprC~kg~Hwa~~   17 (36)
T PF14787_consen    3 GLCPRCGKGFHWASE   17 (36)
T ss_dssp             -C-TTTSSSCS-TTT
T ss_pred             ccCcccCCCcchhhh
Confidence            358888888765443


No 218
>TIGR00319 desulf_FeS4 desulfoferrodoxin FeS4 iron-binding domain. Neelaredoxin, a monomeric blue non-heme iron protein, lacks this domain.
Probab=45.39  E-value=7.8  Score=15.70  Aligned_cols=10  Identities=50%  Similarity=1.335  Sum_probs=6.7

Q ss_pred             ccCCCCCccc
Q psy12028          2 YACDVCGKEY   11 (118)
Q Consensus         2 ~~C~~C~~~~   11 (118)
                      |+|..|+..+
T Consensus         8 ykC~~Cgniv   17 (34)
T TIGR00319         8 YKCEVCGNIV   17 (34)
T ss_pred             EEcCCCCcEE
Confidence            5677777665


No 219
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism]
Probab=45.18  E-value=20  Score=23.59  Aligned_cols=14  Identities=21%  Similarity=1.049  Sum_probs=10.1

Q ss_pred             CCCccCCCCCcccc
Q psy12028         28 EPKFGCPQCPYRSR   41 (118)
Q Consensus        28 ~~~~~C~~c~~~f~   41 (118)
                      ...|.|..||..-.
T Consensus       352 ~~~YRC~~CGF~a~  365 (389)
T COG2956         352 KPRYRCQNCGFTAH  365 (389)
T ss_pred             cCCceecccCCcce
Confidence            45699999986543


No 220
>PF10537 WAC_Acf1_DNA_bd:  ATP-utilising chromatin assembly and remodelling N-terminal;  InterPro: IPR013136 ACF (for ATP-utilising chromatin assembly and remodeling factor) is a chromatin-remodeling complex that catalyzes the ATP-dependent assembly of periodic nucleosome arrays. This reaction utilises the energy of ATP hydrolysis by ISWI, the smaller of the two subunits of ACF. Acf1, the large subunit of ACF, is essential for the full activity of the complex. The WAC (WSTF/Acf1/cbp146) domain is an ~110-residue module present at the N-termini of Acf1-related proteins in a variety of organisms. It is found in association with other domains such as the bromodomain, the PHD-type zinc finger, DDT or WAKS. The DNA-binding region of Acf1 includes the WAC domain, which is necessary for the efficient binding of ACF complex to DNA. It seems probable that the WAC domain will be involved in DNA binding in other related factors [, ].   Some proteins known to contain a WAC domain are the Drosophila melanogaster (Fruit fly) ATP-dependent chromatin assembly factor large subunit Acf1, human WSTF (Williams syndrome transcription factor), mouse cbp146, yeast imitation switch two complex protein 1 (ITC1 or YGL133w), and yeast protein YPL216w. 
Probab=45.11  E-value=28  Score=18.46  Aligned_cols=37  Identities=5%  Similarity=0.088  Sum_probs=29.0

Q ss_pred             ccCCCCCccccchHHHHhhhhhhcCCCCCccCCCCCccc
Q psy12028          2 YACDVCGKEYQHKRTLYRHKKDECGQEPKFGCPQCPYRS   40 (118)
Q Consensus         2 ~~C~~C~~~~~~~~~l~~h~~~~~~~~~~~~C~~c~~~f   40 (118)
                      |.|+.-|.+|.+.......+....  .+.+.|...|+.-
T Consensus         4 f~i~~T~EiF~dYe~Y~~R~~~y~--~~vwtC~~TGk~~   40 (102)
T PF10537_consen    4 FYIPFTGEIFRDYEEYLKRMILYN--QRVWTCEITGKSN   40 (102)
T ss_pred             EEeCCCCcccCCHHHHHHHHHHHh--CCeeEEecCCCCC
Confidence            567777888999998888887764  4779998888753


No 221
>KOG1280|consensus
Probab=45.09  E-value=24  Score=23.22  Aligned_cols=29  Identities=21%  Similarity=0.399  Sum_probs=18.9

Q ss_pred             CCCccCCCCCCCCCChhHHHHHHhhhcCC
Q psy12028         89 EPKFECPHCPYRSKRKDTLDRHMKIIHFS  117 (118)
Q Consensus        89 ~~~~~C~~C~~~f~~~~~l~~H~~~~~~~  117 (118)
                      ...|.|++|+..--+-..|..|....|.+
T Consensus        77 ~qSftCPyC~~~Gfte~~f~~Hv~s~Hpd  105 (381)
T KOG1280|consen   77 PQSFTCPYCGIMGFTERQFGTHVLSQHPE  105 (381)
T ss_pred             cccccCCcccccccchhHHHHHhhhcCcc
Confidence            34677777777655666677777666543


No 222
>cd01121 Sms Sms (bacterial radA) DNA repair protein. This protein is not related to archael radA any more than is to other RecA-like NTPases. Sms has a role in recombination and recombinational repair and is responsible for the stabilization or processing of branched DNA molecules.
Probab=44.25  E-value=13  Score=24.65  Aligned_cols=23  Identities=30%  Similarity=0.641  Sum_probs=15.3

Q ss_pred             ccCCCCCccccchHHHHhhhhhhcCCCCCccCCCCCcc
Q psy12028          2 YACDVCGKEYQHKRTLYRHKKDECGQEPKFGCPQCPYR   39 (118)
Q Consensus         2 ~~C~~C~~~~~~~~~l~~h~~~~~~~~~~~~C~~c~~~   39 (118)
                      |.|..||....               .-..+||.|+.+
T Consensus         1 ~~c~~cg~~~~---------------~~~g~cp~c~~w   23 (372)
T cd01121           1 YVCSECGYVSP---------------KWLGKCPECGEW   23 (372)
T ss_pred             CCCCCCCCCCC---------------CccEECcCCCCc
Confidence            67888887542               223678988754


No 223
>COG4391 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=44.04  E-value=15  Score=17.49  Aligned_cols=14  Identities=43%  Similarity=0.831  Sum_probs=9.4

Q ss_pred             CCCccCCCCCcccc
Q psy12028         28 EPKFGCPQCPYRSR   41 (118)
Q Consensus        28 ~~~~~C~~c~~~f~   41 (118)
                      +..-.||.|+..|.
T Consensus        46 ~gev~CPYC~t~y~   59 (62)
T COG4391          46 EGEVVCPYCSTRYR   59 (62)
T ss_pred             CCcEecCccccEEE
Confidence            44567888877764


No 224
>PF11672 DUF3268:  Protein of unknown function (DUF3268);  InterPro: IPR021686 This entry is represented by Listeria phage P100, Gp150. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches.
Probab=43.99  E-value=13  Score=19.77  Aligned_cols=8  Identities=25%  Similarity=0.908  Sum_probs=5.6

Q ss_pred             ccCCCCCc
Q psy12028         31 FGCPQCPY   38 (118)
Q Consensus        31 ~~C~~c~~   38 (118)
                      |.|+.|+-
T Consensus        32 y~C~~C~A   39 (102)
T PF11672_consen   32 YVCTPCDA   39 (102)
T ss_pred             EECCCCCc
Confidence            77877763


No 225
>PRK05654 acetyl-CoA carboxylase subunit beta; Validated
Probab=43.92  E-value=13  Score=23.80  Aligned_cols=12  Identities=25%  Similarity=0.412  Sum_probs=6.4

Q ss_pred             CccCCCCCcccc
Q psy12028         30 KFGCPQCPYRSR   41 (118)
Q Consensus        30 ~~~C~~c~~~f~   41 (118)
                      ..+|+.|+....
T Consensus        27 ~~~c~~c~~~~~   38 (292)
T PRK05654         27 WTKCPSCGQVLY   38 (292)
T ss_pred             eeECCCccchhh
Confidence            345666665443


No 226
>PLN02748 tRNA dimethylallyltransferase
Probab=43.44  E-value=23  Score=24.34  Aligned_cols=24  Identities=13%  Similarity=0.364  Sum_probs=20.1

Q ss_pred             CCccCCCCCC-CCCChhHHHHHHhh
Q psy12028         90 PKFECPHCPY-RSKRKDTLDRHMKI  113 (118)
Q Consensus        90 ~~~~C~~C~~-~f~~~~~l~~H~~~  113 (118)
                      +.|.|.+|++ .+.....+..|++.
T Consensus       417 ~~~~Ce~C~~~~~~G~~eW~~Hlks  441 (468)
T PLN02748        417 TQYVCEACGNKVLRGAHEWEQHKQG  441 (468)
T ss_pred             ccccccCCCCcccCCHHHHHHHhcc
Confidence            5678999997 79889999999854


No 227
>TIGR01562 FdhE formate dehydrogenase accessory protein FdhE. The only sequence scoring between trusted and noise is that from Aquifex aeolicus, which shows certain structural differences from the proteobacterial forms in the alignment. However it is notable that A. aeolicus also has a sequence scoring above trusted to the alpha subunit of formate dehydrogenase (TIGR01553).
Probab=43.38  E-value=18  Score=23.27  Aligned_cols=8  Identities=25%  Similarity=0.850  Sum_probs=5.8

Q ss_pred             cccCchhh
Q psy12028         63 YACDVCGK   70 (118)
Q Consensus        63 ~~c~~c~~   70 (118)
                      ..|+.|+.
T Consensus       225 ~~C~~Cg~  232 (305)
T TIGR01562       225 VKCSHCEE  232 (305)
T ss_pred             ccCCCCCC
Confidence            47888875


No 228
>PF14447 Prok-RING_4:  Prokaryotic RING finger family 4
Probab=43.18  E-value=13  Score=17.26  Aligned_cols=16  Identities=31%  Similarity=0.484  Sum_probs=11.9

Q ss_pred             CCCccCCCCCcccccc
Q psy12028         28 EPKFGCPQCPYRSRQK   43 (118)
Q Consensus        28 ~~~~~C~~c~~~f~~~   43 (118)
                      ++--.||+|+..|...
T Consensus        37 ~rYngCPfC~~~~~~~   52 (55)
T PF14447_consen   37 ERYNGCPFCGTPFEFD   52 (55)
T ss_pred             hhccCCCCCCCcccCC
Confidence            4556799999988653


No 229
>COG4306 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=43.07  E-value=11  Score=20.70  Aligned_cols=25  Identities=24%  Similarity=0.513  Sum_probs=11.4

Q ss_pred             HHHhhhhhhcCCCCCccCCCCCccc
Q psy12028         16 TLYRHKKDECGQEPKFGCPQCPYRS   40 (118)
Q Consensus        16 ~l~~h~~~~~~~~~~~~C~~c~~~f   40 (118)
                      .|..-...+.++.....||.|....
T Consensus        25 el~eafcskcgeati~qcp~csasi   49 (160)
T COG4306          25 ELMEAFCSKCGEATITQCPICSASI   49 (160)
T ss_pred             HHHHHHHhhhchHHHhcCCccCCcc
Confidence            3333344444433445555555443


No 230
>PF04810 zf-Sec23_Sec24:  Sec23/Sec24 zinc finger;  InterPro: IPR006895 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  COPII (coat protein complex II)-coated vesicles carry proteins from the endoplasmic reticulum (ER) to the Golgi complex []. COPII-coated vesicles form on the ER by the stepwise recruitment of three cytosolic components: Sar1-GTP to initiate coat formation, Sec23/24 heterodimer to select SNARE and cargo molecules, and Sec13/31 to induce coat polymerisation and membrane deformation [].  Sec23 p and Sec24p are structurally related, folding into five distinct domains: a beta-barrel, a zinc-finger, an alpha/beta trunk domain (IPR006896 from INTERPRO), an all-helical region (IPR006900 from INTERPRO), and a C-terminal gelsolin-like domain (IPR007123 from INTERPRO). This entry describes an approximately 55-residue Sec23/24 zinc-binding domain, which lies against the beta-barrel at the periphery of the complex. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0006886 intracellular protein transport, 0006888 ER to Golgi vesicle-mediated transport, 0030127 COPII vesicle coat; PDB: 3EFO_B 3EG9_B 3EGD_A 2YRC_A 2NUP_A 2YRD_A 3EGX_A 2NUT_A 3EH1_A 1PD0_A ....
Probab=42.98  E-value=4.6  Score=17.21  Aligned_cols=10  Identities=20%  Similarity=0.487  Sum_probs=4.1

Q ss_pred             CCccCCCCCc
Q psy12028         29 PKFGCPQCPY   38 (118)
Q Consensus        29 ~~~~C~~c~~   38 (118)
                      +.+.|++|+.
T Consensus        23 ~~w~C~~C~~   32 (40)
T PF04810_consen   23 KTWICNFCGT   32 (40)
T ss_dssp             TEEEETTT--
T ss_pred             CEEECcCCCC
Confidence            3455555543


No 231
>KOG2071|consensus
Probab=42.94  E-value=18  Score=25.47  Aligned_cols=26  Identities=15%  Similarity=0.353  Sum_probs=20.7

Q ss_pred             CccCCCCCccccchHHHHhhhhhhcC
Q psy12028          1 MYACDVCGKEYQHKRTLYRHKKDECG   26 (118)
Q Consensus         1 ~~~C~~C~~~~~~~~~l~~h~~~~~~   26 (118)
                      |-+|..||..|.+......||..|..
T Consensus       418 pnqC~~CG~R~~~~ee~sk~md~H~d  443 (579)
T KOG2071|consen  418 PNQCKSCGLRFDDSEERSKHMDIHDD  443 (579)
T ss_pred             cchhcccccccccchhhhhHhhhhhh
Confidence            35799999999988888888777753


No 232
>PF02891 zf-MIZ:  MIZ/SP-RING zinc finger;  InterPro: IPR004181 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents MIZ-type zinc finger domains. Miz1 (Msx-interacting-zinc finger) is a zinc finger-containing protein with homology to the yeast protein, Nfi-1. Miz1 is a sequence specific DNA binding protein that can function as a positive-acting transcription factor. Miz1 binds to the homeobox protein Msx2, enhancing the specific DNA-binding ability of Msx2 []. Other proteins containing this domain include the human pias family (protein inhibitor of activated STAT protein). More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 3I2D_A.
Probab=42.20  E-value=10  Score=17.05  Aligned_cols=8  Identities=38%  Similarity=1.173  Sum_probs=2.8

Q ss_pred             ccCCCCCc
Q psy12028         31 FGCPQCPY   38 (118)
Q Consensus        31 ~~C~~c~~   38 (118)
                      +.||.|++
T Consensus        42 W~CPiC~~   49 (50)
T PF02891_consen   42 WKCPICNK   49 (50)
T ss_dssp             -B-TTT--
T ss_pred             eECcCCcC
Confidence            66776654


No 233
>KOG2857|consensus
Probab=41.55  E-value=18  Score=20.43  Aligned_cols=21  Identities=24%  Similarity=0.569  Sum_probs=19.0

Q ss_pred             CccCCCCCcccccchHHHHHh
Q psy12028         30 KFGCPQCPYRSRQKATLNRHL   50 (118)
Q Consensus        30 ~~~C~~c~~~f~~~~~l~~h~   50 (118)
                      .|.||.|...+-+..-|+.|.
T Consensus        17 KYKCpkC~vPYCSl~CfKiHk   37 (157)
T KOG2857|consen   17 KYKCPKCSVPYCSLPCFKIHK   37 (157)
T ss_pred             hccCCCCCCccccchhhhhcc
Confidence            599999999999999999884


No 234
>PF12773 DZR:  Double zinc ribbon
Probab=41.43  E-value=20  Score=15.75  Aligned_cols=10  Identities=30%  Similarity=0.640  Sum_probs=4.3

Q ss_pred             cCCCCCcccc
Q psy12028         32 GCPQCPYRSR   41 (118)
Q Consensus        32 ~C~~c~~~f~   41 (118)
                      -|+.||....
T Consensus        14 fC~~CG~~l~   23 (50)
T PF12773_consen   14 FCPHCGTPLP   23 (50)
T ss_pred             CChhhcCChh
Confidence            3444444433


No 235
>PF11789 zf-Nse:  Zinc-finger of the MIZ type in Nse subunit; PDB: 2YU4_A 3HTK_C.
Probab=41.41  E-value=12  Score=17.44  Aligned_cols=16  Identities=13%  Similarity=0.187  Sum_probs=8.2

Q ss_pred             CCccCCCCCcccccch
Q psy12028         29 PKFGCPQCPYRSRQKA   44 (118)
Q Consensus        29 ~~~~C~~c~~~f~~~~   44 (118)
                      .|.....|+-.|....
T Consensus        23 ~PV~s~~C~H~fek~a   38 (57)
T PF11789_consen   23 DPVKSKKCGHTFEKEA   38 (57)
T ss_dssp             SEEEESSS--EEEHHH
T ss_pred             CCcCcCCCCCeecHHH
Confidence            4555666777776543


No 236
>KOG2807|consensus
Probab=41.28  E-value=32  Score=22.50  Aligned_cols=19  Identities=26%  Similarity=0.581  Sum_probs=11.5

Q ss_pred             CccCCCCCcccccchHHHH
Q psy12028         30 KFGCPQCPYRSRQKATLNR   48 (118)
Q Consensus        30 ~~~C~~c~~~f~~~~~l~~   48 (118)
                      |..||.|+........|.+
T Consensus       290 P~eCpiC~ltLVss~hLAR  308 (378)
T KOG2807|consen  290 PIECPICSLTLVSSPHLAR  308 (378)
T ss_pred             CccCCccceeEecchHHHH
Confidence            4666667766665555544


No 237
>TIGR03829 YokU_near_AblA uncharacterized protein, YokU family. Members of this protein family occur in various species of the genus Bacillus, always next to the gene (kamA or ablA) for lysine 2,3-aminomutase. Members have a pair of CXXC motifs, and share homology to the amino-terminal region of a family of putative transcription factors for which the C-terminal is modeled by pfam01381, a helix-turn-helix domain model. This family, however, is shorter and lacks the helix-turn-helix region. The function of this protein family is unknown, but a regulatory role in compatible solute biosynthesis is suggested by local genome context.
Probab=41.26  E-value=20  Score=18.50  Aligned_cols=14  Identities=50%  Similarity=1.073  Sum_probs=7.2

Q ss_pred             cCCCCCccccchHH
Q psy12028          3 ACDVCGKEYQHKRT   16 (118)
Q Consensus         3 ~C~~C~~~~~~~~~   16 (118)
                      .|+.||..|.+...
T Consensus        37 ~C~~CGe~y~~dev   50 (89)
T TIGR03829        37 SCSHCGMEYQDDTT   50 (89)
T ss_pred             cccCCCcEeecHHH
Confidence            45555555554443


No 238
>PRK14892 putative transcription elongation factor Elf1; Provisional
Probab=41.03  E-value=8  Score=20.38  Aligned_cols=8  Identities=50%  Similarity=1.439  Sum_probs=4.3

Q ss_pred             CccCCCCC
Q psy12028         30 KFGCPQCP   37 (118)
Q Consensus        30 ~~~C~~c~   37 (118)
                      .|.||.|+
T Consensus        21 ~f~CP~Cg   28 (99)
T PRK14892         21 IFECPRCG   28 (99)
T ss_pred             EeECCCCC
Confidence            35555555


No 239
>PF02591 DUF164:  Putative zinc ribbon domain;  InterPro: IPR003743 This entry describes proteins of unknown function.
Probab=40.87  E-value=29  Score=15.86  Aligned_cols=33  Identities=15%  Similarity=0.402  Sum_probs=17.2

Q ss_pred             ccCCCCCcccccchHHHHHhhhhhccCCcccccccCchhhh
Q psy12028         31 FGCPQCPYRSRQKATLNRHLGWEQLQGNAHVMYACDVCGKV   71 (118)
Q Consensus        31 ~~C~~c~~~f~~~~~l~~h~~~~~~~~~~~~~~~c~~c~~~   71 (118)
                      -.|.-|........-....        .++....|+.|++.
T Consensus        23 ~~C~gC~~~l~~~~~~~i~--------~~~~i~~Cp~CgRi   55 (56)
T PF02591_consen   23 GTCSGCHMELPPQELNEIR--------KGDEIVFCPNCGRI   55 (56)
T ss_pred             CccCCCCEEcCHHHHHHHH--------cCCCeEECcCCCcc
Confidence            4677777666543322211        12344678877764


No 240
>PF14255 Cys_rich_CPXG:  Cysteine-rich CPXCG
Probab=40.86  E-value=15  Score=16.81  Aligned_cols=11  Identities=27%  Similarity=0.588  Sum_probs=7.0

Q ss_pred             cCCCCCccccc
Q psy12028         32 GCPQCPYRSRQ   42 (118)
Q Consensus        32 ~C~~c~~~f~~   42 (118)
                      .||.||..+..
T Consensus         2 ~CPyCge~~~~   12 (52)
T PF14255_consen    2 QCPYCGEPIEI   12 (52)
T ss_pred             CCCCCCCeeEE
Confidence            57777766543


No 241
>TIGR00244 transcriptional regulator NrdR. Members of this almost entirely bacterial family contain an ATP cone domain (PFAM:PF03477). There is never more than one member per genome. Common gene symbols given include nrdR, ybaD, ribX and ytcG. The member from Streptomyces coelicolor is found upstream in the operon of the class II oxygen-independent ribonucleotide reductase gene nrdJ and was shown to repress nrdJ expression. Many members of this family are found near genes for riboflavin biosynthesis in Gram-negative bacteria, suggesting a role in that pathway. However, a phylogenetic profiling study associates members of this family with the presence of a palindromic signal with consensus acaCwAtATaTwGtgt, termed the NrdR-box, an upstream element for most operons for ribonucleotide reductase of all three classes in bacterial genomes.
Probab=40.66  E-value=14  Score=20.98  Aligned_cols=16  Identities=25%  Similarity=0.432  Sum_probs=12.0

Q ss_pred             CCccCCCCCCCCCChh
Q psy12028         90 PKFECPHCPYRSKRKD  105 (118)
Q Consensus        90 ~~~~C~~C~~~f~~~~  105 (118)
                      +.-.|..||+.|++..
T Consensus        27 RRReC~~C~~RFTTyE   42 (147)
T TIGR00244        27 RRRECLECHERFTTFE   42 (147)
T ss_pred             ecccCCccCCccceee
Confidence            3457999999997754


No 242
>PF14803 Nudix_N_2:  Nudix N-terminal; PDB: 3CNG_C.
Probab=40.52  E-value=8.6  Score=15.86  Aligned_cols=8  Identities=38%  Similarity=1.356  Sum_probs=4.1

Q ss_pred             ccCCCCCc
Q psy12028         31 FGCPQCPY   38 (118)
Q Consensus        31 ~~C~~c~~   38 (118)
                      +.|+.|+.
T Consensus        23 ~vC~~Cg~   30 (34)
T PF14803_consen   23 LVCPACGF   30 (34)
T ss_dssp             EEETTTTE
T ss_pred             eECCCCCC
Confidence            45555543


No 243
>PF14369 zf-RING_3:  zinc-finger
Probab=40.48  E-value=16  Score=15.09  Aligned_cols=10  Identities=30%  Similarity=0.723  Sum_probs=8.5

Q ss_pred             cCCCCCcccc
Q psy12028         32 GCPQCPYRSR   41 (118)
Q Consensus        32 ~C~~c~~~f~   41 (118)
                      .||.|+..|.
T Consensus        23 ~CP~C~~gFv   32 (35)
T PF14369_consen   23 ACPRCHGGFV   32 (35)
T ss_pred             CCcCCCCcEe
Confidence            6999998885


No 244
>PRK08222 hydrogenase 4 subunit H; Validated
Probab=40.35  E-value=22  Score=20.86  Aligned_cols=17  Identities=18%  Similarity=0.602  Sum_probs=9.2

Q ss_pred             ccCCCCCccccchHHHH
Q psy12028          2 YACDVCGKEYQHKRTLY   18 (118)
Q Consensus         2 ~~C~~C~~~~~~~~~l~   18 (118)
                      ..|..||+.|.....+.
T Consensus       115 ~~C~~Cg~~f~~~k~i~  131 (181)
T PRK08222        115 QRCSRCERPFAPQKTVA  131 (181)
T ss_pred             CcCcccCCccCcHhHHH
Confidence            34666666666544433


No 245
>KOG1842|consensus
Probab=39.97  E-value=26  Score=23.92  Aligned_cols=22  Identities=36%  Similarity=0.635  Sum_probs=19.7

Q ss_pred             CCccCCCCCcccccchHHHHHh
Q psy12028         29 PKFGCPQCPYRSRQKATLNRHL   50 (118)
Q Consensus        29 ~~~~C~~c~~~f~~~~~l~~h~   50 (118)
                      ..|.||+|...|.+...|.-|.
T Consensus        14 egflCPiC~~dl~~~~~L~~H~   35 (505)
T KOG1842|consen   14 EGFLCPICLLDLPNLSALNDHL   35 (505)
T ss_pred             hcccCchHhhhhhhHHHHHHHH
Confidence            3499999999999999999996


No 246
>PF13005 zf-IS66:  zinc-finger binding domain of transposase IS66 ;  InterPro: IPR024474 This entry represents a predicted helix-turn-helix domain from insertion element IS66 transposases [].
Probab=39.64  E-value=6.1  Score=17.24  Aligned_cols=9  Identities=44%  Similarity=1.110  Sum_probs=4.5

Q ss_pred             CCCCCcccc
Q psy12028          4 CDVCGKEYQ   12 (118)
Q Consensus         4 C~~C~~~~~   12 (118)
                      |+.||..+.
T Consensus         5 C~~Cg~~l~   13 (47)
T PF13005_consen    5 CPDCGGELK   13 (47)
T ss_pred             CCCCCceee
Confidence            555555443


No 247
>KOG2272|consensus
Probab=38.78  E-value=41  Score=21.18  Aligned_cols=14  Identities=21%  Similarity=0.496  Sum_probs=10.7

Q ss_pred             CccCCCCCCCCCCh
Q psy12028         91 KFECPHCPYRSKRK  104 (118)
Q Consensus        91 ~~~C~~C~~~f~~~  104 (118)
                      -|.|..|.+.|--.
T Consensus       221 HFvCa~CekPFlGH  234 (332)
T KOG2272|consen  221 HFVCAKCEKPFLGH  234 (332)
T ss_pred             heeehhcCCcccch
Confidence            48899999888544


No 248
>PF07800 DUF1644:  Protein of unknown function (DUF1644);  InterPro: IPR012866 This family consists of sequences found in a number of hypothetical plant proteins of unknown function. The region of interest contains nine highly conserved cysteine residues and is approximately 160 amino acids in length, which probably represent a zinc-binding domain. 
Probab=38.15  E-value=43  Score=19.42  Aligned_cols=51  Identities=18%  Similarity=0.375  Sum_probs=26.6

Q ss_pred             cccCchhhhhhchHHHHHHHhhhcCCCCCccCCC--CCCCCCChhHHHHHHhhhcC
Q psy12028         63 YACDVCGKVYQHKQTLDRHKKDECGQEPKFECPH--CPYRSKRKDTLDRHMKIIHF  116 (118)
Q Consensus        63 ~~c~~c~~~~~~~~~l~~h~~~h~~~~~~~~C~~--C~~~f~~~~~l~~H~~~~~~  116 (118)
                      ..|+.|.-.......... .+.+-. .++-.|..  |... .+-..|.+|.+..|.
T Consensus        81 L~CPLCRG~V~GWtvve~-AR~~LN-~K~RsC~~e~C~F~-GtY~eLrKHar~~HP  133 (162)
T PF07800_consen   81 LACPLCRGEVKGWTVVEP-ARRFLN-AKKRSCSQESCSFS-GTYSELRKHARSEHP  133 (162)
T ss_pred             ccCccccCceeceEEchH-HHHHhc-cCCccCcccccccc-cCHHHHHHHHHhhCC
Confidence            467777654444433222 233333 44445543  5543 345677788877664


No 249
>PF10071 DUF2310:  Zn-ribbon-containing, possibly nucleic-acid-binding protein (DUF2310);  InterPro: IPR016908 This group represents uncharacterised conserved proteins.
Probab=37.65  E-value=11  Score=23.66  Aligned_cols=30  Identities=33%  Similarity=0.605  Sum_probs=16.6

Q ss_pred             ccCCCCCcccccchHHHHHhhhhhccCCcccccccCchhhh
Q psy12028         31 FGCPQCPYRSRQKATLNRHLGWEQLQGNAHVMYACDVCGKV   71 (118)
Q Consensus        31 ~~C~~c~~~f~~~~~l~~h~~~~~~~~~~~~~~~c~~c~~~   71 (118)
                      -.||.||..+.-...|..           -..|+|..|.-+
T Consensus       221 r~CP~Cg~~W~L~~plh~-----------iFdFKCD~CRLV  250 (258)
T PF10071_consen  221 RKCPSCGGDWRLKEPLHD-----------IFDFKCDPCRLV  250 (258)
T ss_pred             CCCCCCCCccccCCchhh-----------ceeccCCcceee
Confidence            457777776665544411           134666666544


No 250
>PRK05452 anaerobic nitric oxide reductase flavorubredoxin; Provisional
Probab=37.50  E-value=14  Score=25.32  Aligned_cols=16  Identities=19%  Similarity=0.640  Sum_probs=11.3

Q ss_pred             CCCccCCCCCcccccc
Q psy12028         28 EPKFGCPQCPYRSRQK   43 (118)
Q Consensus        28 ~~~~~C~~c~~~f~~~   43 (118)
                      ...|.|..|+..+-..
T Consensus       423 ~~~~~c~~c~~~yd~~  438 (479)
T PRK05452        423 GPRMQCSVCQWIYDPA  438 (479)
T ss_pred             CCeEEECCCCeEECCC
Confidence            4568888888776543


No 251
>smart00132 LIM Zinc-binding domain present in Lin-11, Isl-1, Mec-3. Zinc-binding domain family. Some LIM domains bind protein partners via tyrosine-containing motifs. LIM domains are found in many key regulators of developmental pathways.
Probab=37.44  E-value=20  Score=14.28  Aligned_cols=10  Identities=40%  Similarity=1.192  Sum_probs=5.0

Q ss_pred             ccCCCCCccc
Q psy12028          2 YACDVCGKEY   11 (118)
Q Consensus         2 ~~C~~C~~~~   11 (118)
                      |.|..|++.+
T Consensus        28 f~C~~C~~~L   37 (39)
T smart00132       28 FKCSKCGKPL   37 (39)
T ss_pred             CCCcccCCcC
Confidence            4455555543


No 252
>PRK12722 transcriptional activator FlhC; Provisional
Probab=37.36  E-value=29  Score=20.69  Aligned_cols=30  Identities=17%  Similarity=0.359  Sum_probs=18.2

Q ss_pred             CCccCCCCCcccccchHHHHHhhhhhccCCcccccccCchhh
Q psy12028         29 PKFGCPQCPYRSRQKATLNRHLGWEQLQGNAHVMYACDVCGK   70 (118)
Q Consensus        29 ~~~~C~~c~~~f~~~~~l~~h~~~~~~~~~~~~~~~c~~c~~   70 (118)
                      ....|..|+-.|..... .           ....|.|+.|..
T Consensus       133 ~l~~C~~Cgg~fv~~~~-e-----------~~~~f~CplC~~  162 (187)
T PRK12722        133 QLSSCNCCGGHFVTHAH-D-----------PVGSFVCGLCQP  162 (187)
T ss_pred             eeccCCCCCCCeecccc-c-----------cCCCCcCCCCCC
Confidence            44668888888775432 1           113478888765


No 253
>PTZ00043 cytochrome c oxidase subunit; Provisional
Probab=37.26  E-value=20  Score=22.04  Aligned_cols=16  Identities=13%  Similarity=0.166  Sum_probs=13.4

Q ss_pred             CCCccCCCCCcccccc
Q psy12028         28 EPKFGCPQCPYRSRQK   43 (118)
Q Consensus        28 ~~~~~C~~c~~~f~~~   43 (118)
                      .++.+|+.||..|.-.
T Consensus       179 GkpqRCpECGqVFKLV  194 (268)
T PTZ00043        179 GFLYRCGECDQIFMLV  194 (268)
T ss_pred             CCCccCCCCCcEEEEE
Confidence            5689999999999753


No 254
>PRK01343 zinc-binding protein; Provisional
Probab=37.23  E-value=25  Score=16.50  Aligned_cols=12  Identities=33%  Similarity=0.697  Sum_probs=8.5

Q ss_pred             CccCCCCCCCCC
Q psy12028         91 KFECPHCPYRSK  102 (118)
Q Consensus        91 ~~~C~~C~~~f~  102 (118)
                      ...|+.|++.+.
T Consensus         9 ~~~CP~C~k~~~   20 (57)
T PRK01343          9 TRPCPECGKPST   20 (57)
T ss_pred             CCcCCCCCCcCc
Confidence            456888888764


No 255
>PRK06260 threonine synthase; Validated
Probab=37.19  E-value=25  Score=23.40  Aligned_cols=29  Identities=34%  Similarity=0.700  Sum_probs=19.0

Q ss_pred             ccCCCCCccccchHHHHhhhhhhcCCCCCccCCCCCcccccc
Q psy12028          2 YACDVCGKEYQHKRTLYRHKKDECGQEPKFGCPQCPYRSRQK   43 (118)
Q Consensus         2 ~~C~~C~~~~~~~~~l~~h~~~~~~~~~~~~C~~c~~~f~~~   43 (118)
                      ++|..||..|..             ....+.|+.|+..+...
T Consensus         4 ~~C~~cg~~~~~-------------~~~~~~Cp~cg~~l~~~   32 (397)
T PRK06260          4 LKCIECGKEYDP-------------DEIIYTCPECGGLLEVI   32 (397)
T ss_pred             EEECCCCCCCCC-------------CCccccCCCCCCeEEEE
Confidence            568888887642             13457898887655444


No 256
>KOG4727|consensus
Probab=36.64  E-value=17  Score=21.24  Aligned_cols=21  Identities=29%  Similarity=0.596  Sum_probs=16.8

Q ss_pred             ccCCCCCccccchHHHHhhhh
Q psy12028          2 YACDVCGKEYQHKRTLYRHKK   22 (118)
Q Consensus         2 ~~C~~C~~~~~~~~~l~~h~~   22 (118)
                      |-|.+|+-++.+.-++..|+.
T Consensus        76 yyCdVCdcvvKDSinflDHiN   96 (193)
T KOG4727|consen   76 YYCDVCDCVVKDSINFLDHIN   96 (193)
T ss_pred             eeeeecceeehhhHHHHHHhc
Confidence            568888888888888887764


No 257
>KOG2923|consensus
Probab=36.47  E-value=32  Score=16.55  Aligned_cols=6  Identities=33%  Similarity=0.584  Sum_probs=2.7

Q ss_pred             CCcccc
Q psy12028         36 CPYRSR   41 (118)
Q Consensus        36 c~~~f~   41 (118)
                      ||-.|.
T Consensus        27 CGDrf~   32 (67)
T KOG2923|consen   27 CGDRFQ   32 (67)
T ss_pred             CCCeee
Confidence            444443


No 258
>PF11023 DUF2614:  Protein of unknown function (DUF2614);  InterPro: IPR020912 This entry describes proteins of unknown function, which are thought to be membrane proteins.; GO: 0005887 integral to plasma membrane
Probab=36.19  E-value=13  Score=20.03  Aligned_cols=15  Identities=20%  Similarity=0.696  Sum_probs=10.3

Q ss_pred             CCCccCCCCCccccc
Q psy12028         28 EPKFGCPQCPYRSRQ   42 (118)
Q Consensus        28 ~~~~~C~~c~~~f~~   42 (118)
                      .....||.|++..+-
T Consensus        67 av~V~CP~C~K~TKm   81 (114)
T PF11023_consen   67 AVQVECPNCGKQTKM   81 (114)
T ss_pred             ceeeECCCCCChHhh
Confidence            455778888876653


No 259
>PF14354 Lar_restr_allev:  Restriction alleviation protein Lar
Probab=36.15  E-value=26  Score=16.17  Aligned_cols=11  Identities=27%  Similarity=0.528  Sum_probs=6.5

Q ss_pred             CccCCCCCccc
Q psy12028         30 KFGCPQCPYRS   40 (118)
Q Consensus        30 ~~~C~~c~~~f   40 (118)
                      ...||+||...
T Consensus         3 LkPCPFCG~~~   13 (61)
T PF14354_consen    3 LKPCPFCGSAD   13 (61)
T ss_pred             CcCCCCCCCcc
Confidence            34577776544


No 260
>COG1885 Uncharacterized protein conserved in archaea [Function unknown]
Probab=36.11  E-value=21  Score=18.97  Aligned_cols=15  Identities=20%  Similarity=0.468  Sum_probs=11.6

Q ss_pred             CCccCCCCCcccccc
Q psy12028         29 PKFGCPQCPYRSRQK   43 (118)
Q Consensus        29 ~~~~C~~c~~~f~~~   43 (118)
                      ....||.||..|...
T Consensus        48 G~t~CP~Cg~~~e~~   62 (115)
T COG1885          48 GSTSCPKCGEPFESA   62 (115)
T ss_pred             ccccCCCCCCcccee
Confidence            347899999987654


No 261
>COG5112 UFD2 U1-like Zn-finger-containing protein [General function prediction only]
Probab=35.62  E-value=30  Score=18.53  Aligned_cols=23  Identities=26%  Similarity=0.495  Sum_probs=19.3

Q ss_pred             ccccCchhhhhhchHHHHHHHhh
Q psy12028         62 MYACDVCGKVYQHKQTLDRHKKD   84 (118)
Q Consensus        62 ~~~c~~c~~~~~~~~~l~~h~~~   84 (118)
                      .+-|..|.+.|.....|..|.+.
T Consensus        55 qhYCieCaryf~t~~aL~~Hkkg   77 (126)
T COG5112          55 QHYCIECARYFITEKALMEHKKG   77 (126)
T ss_pred             eeeeehhHHHHHHHHHHHHHhcc
Confidence            36799999999999999888653


No 262
>PRK12387 formate hydrogenlyase complex iron-sulfur subunit; Provisional
Probab=34.98  E-value=26  Score=20.45  Aligned_cols=16  Identities=25%  Similarity=0.914  Sum_probs=9.3

Q ss_pred             ccCCCCCccccchHHH
Q psy12028          2 YACDVCGKEYQHKRTL   17 (118)
Q Consensus         2 ~~C~~C~~~~~~~~~l   17 (118)
                      +.|..||+.|.....+
T Consensus       115 ~~C~~CG~~f~~~~~i  130 (180)
T PRK12387        115 CNCRVCGRPFAVQKEI  130 (180)
T ss_pred             ccchhhCCccccHHHH
Confidence            4566677766654433


No 263
>PF09332 Mcm10:  Mcm10 replication factor;  InterPro: IPR015411 Mcm10 is a eukaryotic DNA replication factor that regulates the stability and chromatin association of DNA polymerase alpha []. ; PDB: 2KWQ_A.
Probab=34.79  E-value=4.5  Score=26.38  Aligned_cols=12  Identities=33%  Similarity=0.847  Sum_probs=4.5

Q ss_pred             ccCCCCCccccc
Q psy12028         31 FGCPQCPYRSRQ   42 (118)
Q Consensus        31 ~~C~~c~~~f~~   42 (118)
                      +.|..|.+.+..
T Consensus       253 v~C~~C~yt~~~  264 (344)
T PF09332_consen  253 VTCKQCKYTAFK  264 (344)
T ss_dssp             EEETTT--EESS
T ss_pred             EEcCCCCCcccC
Confidence            444555444333


No 264
>PRK12860 transcriptional activator FlhC; Provisional
Probab=34.35  E-value=34  Score=20.44  Aligned_cols=29  Identities=17%  Similarity=0.430  Sum_probs=17.6

Q ss_pred             CCccCCCCCcccccchHHHHHhhhhhccCCcccccccCchh
Q psy12028         29 PKFGCPQCPYRSRQKATLNRHLGWEQLQGNAHVMYACDVCG   69 (118)
Q Consensus        29 ~~~~C~~c~~~f~~~~~l~~h~~~~~~~~~~~~~~~c~~c~   69 (118)
                      ....|..|+-.|..... .           ....|.|+.|.
T Consensus       133 ~l~~C~~Cgg~fv~~~~-e-----------~~~~f~CplC~  161 (189)
T PRK12860        133 QLARCCRCGGKFVTHAH-D-----------LRHNFVCGLCQ  161 (189)
T ss_pred             eeccCCCCCCCeecccc-c-----------cCCCCcCCCCC
Confidence            45678888888775432 1           11337788776


No 265
>KOG3214|consensus
Probab=34.30  E-value=19  Score=19.03  Aligned_cols=13  Identities=23%  Similarity=0.813  Sum_probs=8.8

Q ss_pred             cccCchhhhhhch
Q psy12028         63 YACDVCGKVYQHK   75 (118)
Q Consensus        63 ~~c~~c~~~~~~~   75 (118)
                      ..|.+|+..|...
T Consensus        48 ~sC~iC~esFqt~   60 (109)
T KOG3214|consen   48 ASCRICEESFQTT   60 (109)
T ss_pred             eeeeehhhhhccc
Confidence            4677777777654


No 266
>PF08271 TF_Zn_Ribbon:  TFIIB zinc-binding;  InterPro: IPR013137 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents a zinc finger motif found in transcription factor IIB (TFIIB). In eukaryotes the initiation of transcription of protein encoding genes by the polymerase II complexe (Pol II) is modulated by general and specific transcription factors. The general transcription factors operate through common promoters elements (such as the TATA box). At least seven different proteins associate to form the general transcription factors: TFIIA, -IIB, -IID, -IIE, -IIF, -IIG, and -IIH [].  TFIIB and TFIID are responsible for promoter recognition and interaction with pol II; together with Pol II, they form a minimal initiation complex capable of transcription under certain conditions. The TATA box of a Pol II promoter is bound in the initiation complex by the TBP subunit of TFIID, which bends the DNA around the C-terminal domain of TFIIB whereas the N-terminal zinc finger of TFIIB interacts with Pol II [, ]. The TFIIB zinc finger adopts a zinc ribbon fold characterised by two beta-hairpins forming two structurally similar zinc-binding sub-sites []. The zinc finger contacts the rbp1 subunit of Pol II through its dock domain, a conserved region of about 70 amino acids located close to the polymerase active site []. In the Pol II complex this surface is located near the RNA exit groove. Interestingly this sequence is best conserved in the three polymerases that utilise a TFIIB-like general transcription factor (Pol II, Pol III, and archaeal RNA polymerase) but not in Pol I [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0006355 regulation of transcription, DNA-dependent; PDB: 1VD4_A 1PFT_A 3K1F_M 3K7A_M 1RO4_A 1RLY_A 1DL6_A.
Probab=34.16  E-value=24  Score=15.10  Aligned_cols=9  Identities=33%  Similarity=1.250  Sum_probs=5.3

Q ss_pred             ccCCCCCCC
Q psy12028         92 FECPHCPYR  100 (118)
Q Consensus        92 ~~C~~C~~~  100 (118)
                      |.|+.||..
T Consensus         1 m~Cp~Cg~~    9 (43)
T PF08271_consen    1 MKCPNCGSK    9 (43)
T ss_dssp             ESBTTTSSS
T ss_pred             CCCcCCcCC
Confidence            456666653


No 267
>PF09855 DUF2082:  Nucleic-acid-binding protein containing Zn-ribbon domain (DUF2082);  InterPro: IPR018652  This family of proteins contains various hypothetical prokaryotic proteins as well as some Zn-ribbon nucleic-acid-binding proteins.
Probab=34.12  E-value=22  Score=17.12  Aligned_cols=8  Identities=38%  Similarity=1.435  Sum_probs=4.5

Q ss_pred             ccCCCCCC
Q psy12028         92 FECPHCPY   99 (118)
Q Consensus        92 ~~C~~C~~   99 (118)
                      |.|+.||-
T Consensus         1 y~C~KCg~    8 (64)
T PF09855_consen    1 YKCPKCGN    8 (64)
T ss_pred             CCCCCCCC
Confidence            45666653


No 268
>TIGR03831 YgiT_finger YgiT-type zinc finger domain. This domain model describes a small domain with two copies of a putative zinc-binding motif CXXC (usually CXXCG). Most member proteins consist largely of this domain or else carry an additional C-terminal helix-turn-helix domain, resembling that of the phage protein Cro and modeled by pfam01381.
Probab=33.77  E-value=22  Score=15.10  Aligned_cols=14  Identities=36%  Similarity=0.764  Sum_probs=10.6

Q ss_pred             CCccCCCCCccccc
Q psy12028         29 PKFGCPQCPYRSRQ   42 (118)
Q Consensus        29 ~~~~C~~c~~~f~~   42 (118)
                      ..+.|+.||..+.+
T Consensus        31 p~~~C~~CGE~~~~   44 (46)
T TIGR03831        31 PALVCPQCGEEYLD   44 (46)
T ss_pred             CccccccCCCEeeC
Confidence            44789999987654


No 269
>cd00065 FYVE FYVE domain; Zinc-binding domain; targets proteins to membrane lipids via interaction with phosphatidylinositol-3-phosphate, PI3P; present in Fab1, YOTB, Vac1, and EEA1;
Probab=33.65  E-value=24  Score=15.93  Aligned_cols=9  Identities=22%  Similarity=0.445  Sum_probs=4.2

Q ss_pred             CCCCCcccc
Q psy12028         33 CPQCPYRSR   41 (118)
Q Consensus        33 C~~c~~~f~   41 (118)
                      |..|++.|.
T Consensus         5 C~~C~~~F~   13 (57)
T cd00065           5 CMGCGKPFT   13 (57)
T ss_pred             CcccCcccc
Confidence            444544444


No 270
>PRK06450 threonine synthase; Validated
Probab=33.44  E-value=30  Score=22.59  Aligned_cols=27  Identities=26%  Similarity=0.461  Sum_probs=17.3

Q ss_pred             ccCCCCCccccchHHHHhhhhhhcCCCCCccCCCCCccccc
Q psy12028          2 YACDVCGKEYQHKRTLYRHKKDECGQEPKFGCPQCPYRSRQ   42 (118)
Q Consensus         2 ~~C~~C~~~~~~~~~l~~h~~~~~~~~~~~~C~~c~~~f~~   42 (118)
                      ++|..||+.|..              ...+.|+.|+..+..
T Consensus         4 ~~C~~Cg~~~~~--------------~~~~~C~~cg~~l~~   30 (338)
T PRK06450          4 EVCMKCGKERES--------------IYEIRCKKCGGPFEI   30 (338)
T ss_pred             eEECCcCCcCCC--------------cccccCCcCCCEeEE
Confidence            578888887621              223688888755443


No 271
>COG5151 SSL1 RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, subunit SSL1 [Transcription / DNA replication, recombination, and repair]
Probab=33.34  E-value=1e+02  Score=20.26  Aligned_cols=24  Identities=13%  Similarity=0.267  Sum_probs=13.3

Q ss_pred             CCccCCCCCCCCCChhHHHHHHhh
Q psy12028         90 PKFECPHCPYRSKRKDTLDRHMKI  113 (118)
Q Consensus        90 ~~~~C~~C~~~f~~~~~l~~H~~~  113 (118)
                      ..|.|+.|...|-..-+...|...
T Consensus       387 ~rY~Ce~CK~~FC~dCdvfiHe~L  410 (421)
T COG5151         387 GRYQCELCKSTFCSDCDVFIHETL  410 (421)
T ss_pred             cceechhhhhhhhhhhHHHHHHHH
Confidence            346666666666555555555443


No 272
>PLN03238 probable histone acetyltransferase MYST; Provisional
Probab=32.89  E-value=43  Score=21.51  Aligned_cols=24  Identities=25%  Similarity=0.501  Sum_probs=19.7

Q ss_pred             CCCccCCCCCCCCCChhHHHHHHh
Q psy12028         89 EPKFECPHCPYRSKRKDTLDRHMK  112 (118)
Q Consensus        89 ~~~~~C~~C~~~f~~~~~l~~H~~  112 (118)
                      ..-|.|..|-+-|.....|.+|+.
T Consensus        46 ~~lyiCe~Clky~~~~~~l~~H~~   69 (290)
T PLN03238         46 TKLYICEYCLKYMRKKKSLLRHLA   69 (290)
T ss_pred             CeEEEcCCCcchhCCHHHHHHHHH
Confidence            567888888888888888888875


No 273
>TIGR02159 PA_CoA_Oxy4 phenylacetate-CoA oxygenase, PaaJ subunit. Phenylacetate-CoA oxygenase is comprised of a five gene complex responsible for the hydroxylation of phenylacetate-CoA (PA-CoA) as the second catabolic step in phenylacetic acid (PA) degradation. Although the exact function of this enzyme has not been determined, it has been shown to be required for phenylacetic acid degradation and has been proposed to function in a multicomponent oxygenase acting on phenylacetate-CoA.
Probab=32.66  E-value=12  Score=21.29  Aligned_cols=38  Identities=16%  Similarity=0.489  Sum_probs=19.3

Q ss_pred             CccCCCCCcccccchHHHHHhhhhhccCCcccccccCchhhhhhc
Q psy12028         30 KFGCPQCPYRSRQKATLNRHLGWEQLQGNAHVMYACDVCGKVYQH   74 (118)
Q Consensus        30 ~~~C~~c~~~f~~~~~l~~h~~~~~~~~~~~~~~~c~~c~~~~~~   74 (118)
                      .-.||.||-......+.-.-  +.+     +-.|.|..|...|..
T Consensus       105 ~~~cp~c~s~~t~~~s~fg~--t~c-----ka~~~c~~c~epf~~  142 (146)
T TIGR02159       105 SVQCPRCGSADTTITSIFGP--TAC-----KALYRCRACKEPFEY  142 (146)
T ss_pred             CCcCCCCCCCCcEeecCCCC--hhh-----HHHhhhhhhCCcHhh
Confidence            36788888654332210000  001     123778888877653


No 274
>COG1327 Predicted transcriptional regulator, consists of a Zn-ribbon and ATP-cone domains [Transcription]
Probab=32.47  E-value=22  Score=20.34  Aligned_cols=16  Identities=25%  Similarity=0.422  Sum_probs=11.8

Q ss_pred             CCccCCCCCCCCCChh
Q psy12028         90 PKFECPHCPYRSKRKD  105 (118)
Q Consensus        90 ~~~~C~~C~~~f~~~~  105 (118)
                      +.-.|+.||..|++..
T Consensus        27 RRReC~~C~~RFTTfE   42 (156)
T COG1327          27 RRRECLECGERFTTFE   42 (156)
T ss_pred             hhhcccccccccchhh
Confidence            3457999999987753


No 275
>PF14690 zf-ISL3:  zinc-finger of transposase IS204/IS1001/IS1096/IS1165
Probab=32.04  E-value=32  Score=14.80  Aligned_cols=10  Identities=40%  Similarity=0.939  Sum_probs=7.2

Q ss_pred             CccCCCCCCC
Q psy12028         91 KFECPHCPYR  100 (118)
Q Consensus        91 ~~~C~~C~~~  100 (118)
                      |..|+.||..
T Consensus         2 ~~~Cp~Cg~~   11 (47)
T PF14690_consen    2 PPRCPHCGSP   11 (47)
T ss_pred             CccCCCcCCC
Confidence            5678888843


No 276
>PF04438 zf-HIT:  HIT zinc finger;  InterPro: IPR007529 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents the HIT-type zinc finger, which contains 7 conserved cysteines and one histidine that can potentially coordinate two zinc atoms. It has been named after the first protein that originally defined the domain: the yeast HIT1 protein (P46973 from SWISSPROT) []. The HIT-type zinc finger displays some sequence similarities to the MYND-type zinc finger. The function of this domain is unknown but it is mainly found in nuclear proteins involved in gene regulation and chromatin remodeling. This domain is also found in the thyroid receptor interacting protein 3 (TRIP-3) Q15649 from SWISSPROT, that specifically interacts with the ligand binding domain of the thyroid receptor. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 2YQP_A 2YQQ_A 1X4S_A.
Probab=31.73  E-value=18  Score=14.35  Aligned_cols=13  Identities=38%  Similarity=0.933  Sum_probs=6.7

Q ss_pred             CccCCCCCccccc
Q psy12028         30 KFGCPQCPYRSRQ   42 (118)
Q Consensus        30 ~~~C~~c~~~f~~   42 (118)
                      .|.|+.|+..+=+
T Consensus        13 kY~Cp~C~~~~CS   25 (30)
T PF04438_consen   13 KYRCPRCGARYCS   25 (30)
T ss_dssp             SEE-TTT--EESS
T ss_pred             EEECCCcCCceeC
Confidence            4888888776543


No 277
>PF03107 C1_2:  C1 domain;  InterPro: IPR004146 This short domain is rich in cysteines and histidines. The pattern of conservation is similar to that found in DAG_PE-bind (IPR002219 from INTERPRO), therefore we have termed this domain DC1 for divergent C1 domain. This domain probably also binds to two zinc ions. The function of proteins with this domain is uncertain, however this domain may bind to molecules such as diacylglycerol. This family are found in plant proteins.
Probab=31.62  E-value=39  Score=13.16  Aligned_cols=9  Identities=33%  Similarity=0.852  Sum_probs=4.9

Q ss_pred             ccCCCCCCC
Q psy12028         92 FECPHCPYR  100 (118)
Q Consensus        92 ~~C~~C~~~  100 (118)
                      |.|.+|++.
T Consensus         1 ~~C~~C~~~    9 (30)
T PF03107_consen    1 FWCDVCRRK    9 (30)
T ss_pred             CCCCCCCCC
Confidence            356666554


No 278
>PF08792 A2L_zn_ribbon:  A2L zinc ribbon domain;  InterPro: IPR014900 This zinc ribbon protein is found associated with some viral A2L transcription factors []. 
Probab=31.54  E-value=22  Score=14.48  Aligned_cols=8  Identities=25%  Similarity=0.613  Sum_probs=3.4

Q ss_pred             cCCCCCCC
Q psy12028         93 ECPHCPYR  100 (118)
Q Consensus        93 ~C~~C~~~  100 (118)
                      .|..||..
T Consensus        23 ~C~~Cg~~   30 (33)
T PF08792_consen   23 VCIFCGSS   30 (33)
T ss_pred             EcccCCcE
Confidence            34444443


No 279
>COG2824 PhnA Uncharacterized Zn-ribbon-containing protein involved in phosphonate metabolism [Inorganic ion transport and metabolism]
Probab=31.51  E-value=16  Score=19.49  Aligned_cols=29  Identities=24%  Similarity=0.671  Sum_probs=18.7

Q ss_pred             cCCCCCccccchHHHHhhhhhhcCCCCCccCCCCCcccccc
Q psy12028          3 ACDVCGKEYQHKRTLYRHKKDECGQEPKFGCPQCPYRSRQK   43 (118)
Q Consensus         3 ~C~~C~~~~~~~~~l~~h~~~~~~~~~~~~C~~c~~~f~~~   43 (118)
                      .|+.|+..|....            ...|.||.|...|...
T Consensus         5 ~cp~c~sEytYed------------~~~~~cpec~~ew~~~   33 (112)
T COG2824           5 PCPKCNSEYTYED------------GGQLICPECAHEWNEN   33 (112)
T ss_pred             CCCccCCceEEec------------CceEeCchhccccccc
Confidence            4667765553322            2368999999888743


No 280
>KOG1940|consensus
Probab=30.62  E-value=63  Score=20.65  Aligned_cols=18  Identities=22%  Similarity=0.610  Sum_probs=10.9

Q ss_pred             ccCCCCCcccccchHHHHH
Q psy12028         31 FGCPQCPYRSRQKATLNRH   49 (118)
Q Consensus        31 ~~C~~c~~~f~~~~~l~~h   49 (118)
                      |.||.|.+ -.....+-++
T Consensus       197 y~CP~C~~-~~d~~~~~~~  214 (276)
T KOG1940|consen  197 YTCPICSK-PGDMSHYFRK  214 (276)
T ss_pred             CCCCcccc-hHHHHHHHHH
Confidence            88888877 4444444433


No 281
>PRK05580 primosome assembly protein PriA; Validated
Probab=30.26  E-value=23  Score=25.51  Aligned_cols=12  Identities=25%  Similarity=0.614  Sum_probs=7.7

Q ss_pred             CCCccCCCCCcc
Q psy12028         28 EPKFGCPQCPYR   39 (118)
Q Consensus        28 ~~~~~C~~c~~~   39 (118)
                      ..+..||.|+..
T Consensus       419 ~~~~~Cp~Cg~~  430 (679)
T PRK05580        419 PIPKACPECGST  430 (679)
T ss_pred             CCCCCCCCCcCC
Confidence            346677877654


No 282
>PF01215 COX5B:  Cytochrome c oxidase subunit Vb This family consists of chains F and S ;  InterPro: IPR002124 Cytochrome c oxidase (1.9.3.1 from EC) is an oligomeric enzymatic complex which is a component of the respiratory chain complex and is involved in the transfer of electrons from cytochrome c to oxygen []. In eukaryotes this enzyme complex is located in the mitochondrial inner membrane; in aerobic prokaryotes it is found in the plasma membrane.  In eukaryotes, in addition to the three large subunits, I, II and III, that form the catalytic centre of the enzyme complex, there are a variable number of small polypeptidic subunits. One of these subunits, which is known as Vb in mammals, V in Dictyostelium discoideum (Slime mold) and IV in yeast, binds a zinc atom. The sequence of subunit Vb is well conserved and includes three conserved cysteines that coordinate the zinc ion [, ]. Two of these cysteines are clustered in the C-terminal section of the subunit.; GO: 0004129 cytochrome-c oxidase activity, 0005740 mitochondrial envelope; PDB: 2EIL_S 2ZXW_S 3ASN_S 1OCO_S 3AG4_S 3ABK_S 1OCZ_S 1OCC_F 3ASO_S 3ABL_S ....
Probab=29.59  E-value=15  Score=20.63  Aligned_cols=16  Identities=25%  Similarity=0.478  Sum_probs=12.2

Q ss_pred             CCCccCCCCCcccccc
Q psy12028         28 EPKFGCPQCPYRSRQK   43 (118)
Q Consensus        28 ~~~~~C~~c~~~f~~~   43 (118)
                      .++.+|+.||..|.-.
T Consensus       110 g~~~RCpeCG~~fkL~  125 (136)
T PF01215_consen  110 GKPQRCPECGQVFKLK  125 (136)
T ss_dssp             TSEEEETTTEEEEEEE
T ss_pred             CCccCCCCCCeEEEEE
Confidence            3578999999888643


No 283
>PF14375 Cys_rich_CWC:  Cysteine-rich CWC
Probab=29.14  E-value=37  Score=15.20  Aligned_cols=6  Identities=33%  Similarity=0.833  Sum_probs=2.4

Q ss_pred             CCCCCC
Q psy12028         95 PHCPYR  100 (118)
Q Consensus        95 ~~C~~~  100 (118)
                      +.||..
T Consensus         2 P~Cg~~    7 (50)
T PF14375_consen    2 PRCGAP    7 (50)
T ss_pred             CCCCCc
Confidence            334433


No 284
>KOG4317|consensus
Probab=29.13  E-value=21  Score=23.15  Aligned_cols=20  Identities=20%  Similarity=0.565  Sum_probs=13.5

Q ss_pred             CccCCCCCcccccchHHHHH
Q psy12028         30 KFGCPQCPYRSRQKATLNRH   49 (118)
Q Consensus        30 ~~~C~~c~~~f~~~~~l~~h   49 (118)
                      .|.||-|+..+-+..-++.|
T Consensus        19 ~YtCPRCn~~YCsl~CYr~h   38 (383)
T KOG4317|consen   19 EYTCPRCNLLYCSLKCYRNH   38 (383)
T ss_pred             cccCCCCCccceeeeeecCC
Confidence            38888888777665555555


No 285
>KOG1701|consensus
Probab=29.10  E-value=10  Score=25.56  Aligned_cols=14  Identities=21%  Similarity=0.520  Sum_probs=7.3

Q ss_pred             CccCCCCCcccccc
Q psy12028         30 KFGCPQCPYRSRQK   43 (118)
Q Consensus        30 ~~~C~~c~~~f~~~   43 (118)
                      -|.|..|++...-.
T Consensus       302 CFtC~~C~r~L~Gq  315 (468)
T KOG1701|consen  302 CFTCRTCRRQLAGQ  315 (468)
T ss_pred             ceehHhhhhhhccc
Confidence            36666665544433


No 286
>PF05741 zf-nanos:  Nanos RNA binding domain;  InterPro: IPR024161 Nanos is a highly conserved RNA-binding protein in higher eukaryotes and functions as a key regulatory protein in translational control using a 3' untranslated region during the development and maintenance of germ cells. Nanos comprises a non-conserved amino-terminus and highly conserved carboxy- terminal regions. The C-terminal region has two conserved Cys-Cys-His-Cys (CCHC)-type zinc-finger motifs that are indispensable for nanos function [, , ]. The structure of the nanos-type zinc finger is composed of two independent zinc-finger (ZF) lobes, the N-terminal ZF1 and the C-terminal ZF2, which are connected by a linker helix []. These lobes create a large cleft. Zinc ions in ZF1 and ZF2 are bound to the CCHC motif by tetrahedral coordination.; PDB: 3ALR_B.
Probab=28.81  E-value=21  Score=16.60  Aligned_cols=11  Identities=36%  Similarity=0.905  Sum_probs=3.6

Q ss_pred             CCccCCCCCCC
Q psy12028         90 PKFECPHCPYR  100 (118)
Q Consensus        90 ~~~~C~~C~~~  100 (118)
                      +.|.|++||-+
T Consensus        32 r~y~Cp~CgAt   42 (55)
T PF05741_consen   32 RKYVCPICGAT   42 (55)
T ss_dssp             GG---TTT---
T ss_pred             hcCcCCCCcCc
Confidence            45788888854


No 287
>COG0675 Transposase and inactivated derivatives [DNA replication, recombination, and repair]
Probab=28.80  E-value=36  Score=21.65  Aligned_cols=13  Identities=31%  Similarity=0.866  Sum_probs=8.6

Q ss_pred             ccccCchhhhhhc
Q psy12028         62 MYACDVCGKVYQH   74 (118)
Q Consensus        62 ~~~c~~c~~~~~~   74 (118)
                      .|.|+.||..+..
T Consensus       322 ~~~C~~cg~~~~r  334 (364)
T COG0675         322 LFKCPRCGFVHDR  334 (364)
T ss_pred             eEECCCCCCeehh
Confidence            3788888865433


No 288
>PF10263 SprT-like:  SprT-like family;  InterPro: IPR006640 This is a family of uncharacterised bacterial proteins which includes Escherichia coli SprT (P39902 from SWISSPROT). SprT is described as a regulator of bolA gene in stationary phase []. The majority of members contain the metallopeptidase zinc binding signature which has a HExxH motif, however there is no evidence for them being metallopeptidases. 
Probab=28.67  E-value=12  Score=21.04  Aligned_cols=32  Identities=28%  Similarity=0.860  Sum_probs=19.0

Q ss_pred             cccccCchhhhhhchHHHHHHHhhhcCCCCCccCCCCCCCC
Q psy12028         61 VMYACDVCGKVYQHKQTLDRHKKDECGQEPKFECPHCPYRS  101 (118)
Q Consensus        61 ~~~~c~~c~~~~~~~~~l~~h~~~h~~~~~~~~C~~C~~~f  101 (118)
                      -.|.|..|+..+.      ++.+.  . ...|.|..|+-.+
T Consensus       122 ~~~~C~~C~~~~~------r~~~~--~-~~~~~C~~C~~~l  153 (157)
T PF10263_consen  122 YVYRCPSCGREYK------RHRRS--K-RKRYRCGRCGGPL  153 (157)
T ss_pred             eEEEcCCCCCEee------eeccc--c-hhhEECCCCCCEE
Confidence            3467888886652      23333  1 3348888888654


No 289
>TIGR00595 priA primosomal protein N'. All proteins in this family for which functions are known are components of the primosome which is involved in replication, repair, and recombination.This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=27.95  E-value=27  Score=24.19  Aligned_cols=10  Identities=40%  Similarity=0.740  Sum_probs=6.4

Q ss_pred             CCccCCCCCc
Q psy12028         29 PKFGCPQCPY   38 (118)
Q Consensus        29 ~~~~C~~c~~   38 (118)
                      .+..||.|+.
T Consensus       252 ~~~~Cp~C~s  261 (505)
T TIGR00595       252 IPKTCPQCGS  261 (505)
T ss_pred             CCCCCCCCCC
Confidence            4566777765


No 290
>PRK07591 threonine synthase; Validated
Probab=27.60  E-value=44  Score=22.60  Aligned_cols=28  Identities=25%  Similarity=0.481  Sum_probs=16.7

Q ss_pred             ccCCCCCccccchHHHHhhhhhhcCCCCCccCCCCCcccccc
Q psy12028          2 YACDVCGKEYQHKRTLYRHKKDECGQEPKFGCPQCPYRSRQK   43 (118)
Q Consensus         2 ~~C~~C~~~~~~~~~l~~h~~~~~~~~~~~~C~~c~~~f~~~   43 (118)
                      ++|..||..|..             ... +.|+.|+..+...
T Consensus        19 l~C~~Cg~~~~~-------------~~~-~~C~~cg~~l~~~   46 (421)
T PRK07591         19 LKCRECGAEYPL-------------GPI-HVCEECFGPLEVA   46 (421)
T ss_pred             EEeCCCCCcCCC-------------CCC-ccCCCCCCeEEEE
Confidence            457777776632             122 7788887554443


No 291
>smart00064 FYVE Protein present in Fab1, YOTB, Vac1, and EEA1. The FYVE zinc finger is named after four proteins where it was first found: Fab1, YOTB/ZK632.12, Vac1, and EEA1. The FYVE finger has been shown to bind two Zn2+ ions. The FYVE finger has eight potential zinc coordinating cysteine positions. The FYVE finger is structurally related to the PF10367 Vps39_2:  Vacuolar sorting protein 39 domain 2;  InterPro: IPR019453  This entry represents a domain found in the vacuolar sorting protein Vps39 and transforming growth factor beta receptor-associated protein Trap1. Vps39, a component of the C-Vps complex, is thought to be required for the fusion of endosomes and other types of transport intermediates with the vacuole [, ]. In Saccharomyces cerevisiae (Baker's yeast), Vps39 has been shown to stimulate nucleotide exchange []. Trap1 plays a role in the TGF-beta/activin signaling pathway. It associates with inactive heteromeric TGF-beta and activin receptor complexes, mainly through the type II receptor, and is released upon activation of signaling [, ]. The precise function of this domain has not been characterised In Vps39 this domain is involved in localisation and in mediating the interactions with Vps11 []. 
Probab=26.45  E-value=41  Score=17.36  Aligned_cols=12  Identities=17%  Similarity=0.360  Sum_probs=9.6

Q ss_pred             ccCCCCCCCCCC
Q psy12028         92 FECPHCPYRSKR  103 (118)
Q Consensus        92 ~~C~~C~~~f~~  103 (118)
                      -.|.+|++.+.+
T Consensus        79 ~~C~vC~k~l~~   90 (109)
T PF10367_consen   79 TKCSVCGKPLGN   90 (109)
T ss_pred             CCccCcCCcCCC
Confidence            459999998765


No 293
>COG3024 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=26.42  E-value=37  Score=16.34  Aligned_cols=9  Identities=44%  Similarity=1.139  Sum_probs=5.3

Q ss_pred             cCCCCCccc
Q psy12028          3 ACDVCGKEY   11 (118)
Q Consensus         3 ~C~~C~~~~   11 (118)
                      +|+.||+..
T Consensus         9 ~CP~Cgkpv   17 (65)
T COG3024           9 PCPTCGKPV   17 (65)
T ss_pred             cCCCCCCcc
Confidence            466666654


No 294
>PF14599 zinc_ribbon_6:  Zinc-ribbon; PDB: 2K2D_A.
Probab=26.40  E-value=14  Score=17.61  Aligned_cols=15  Identities=20%  Similarity=0.381  Sum_probs=6.7

Q ss_pred             ccCCCCCcccccchH
Q psy12028         31 FGCPQCPYRSRQKAT   45 (118)
Q Consensus        31 ~~C~~c~~~f~~~~~   45 (118)
                      ..|..|+........
T Consensus        31 IlCNDC~~~s~v~fH   45 (61)
T PF14599_consen   31 ILCNDCNAKSEVPFH   45 (61)
T ss_dssp             EEESSS--EEEEE--
T ss_pred             EECCCCCCccceeee
Confidence            447777776655443


No 295
>PF14122 YokU:  YokU-like protein
Probab=25.17  E-value=43  Score=17.20  Aligned_cols=15  Identities=33%  Similarity=0.853  Sum_probs=9.4

Q ss_pred             cCCCCCccccchHHH
Q psy12028          3 ACDVCGKEYQHKRTL   17 (118)
Q Consensus         3 ~C~~C~~~~~~~~~l   17 (118)
                      .|..||.+|.....+
T Consensus        37 ~C~~CgmvYq~d~vi   51 (87)
T PF14122_consen   37 ICSNCGMVYQDDEVI   51 (87)
T ss_pred             eecCCCcEEehhHHH
Confidence            477777777655443


No 296
>PRK14559 putative protein serine/threonine phosphatase; Provisional
Probab=24.90  E-value=71  Score=23.19  Aligned_cols=9  Identities=33%  Similarity=0.715  Sum_probs=5.8

Q ss_pred             ccCCCCCcc
Q psy12028          2 YACDVCGKE   10 (118)
Q Consensus         2 ~~C~~C~~~   10 (118)
                      ..|+.||..
T Consensus         2 ~~Cp~Cg~~   10 (645)
T PRK14559          2 LICPQCQFE   10 (645)
T ss_pred             CcCCCCCCc
Confidence            357777764


No 297
>KOG4118|consensus
Probab=24.85  E-value=55  Score=15.83  Aligned_cols=25  Identities=20%  Similarity=0.386  Sum_probs=15.5

Q ss_pred             cccCchhhhhhchHHHHHHHhhhcC
Q psy12028         63 YACDVCGKVYQHKQTLDRHKKDECG   87 (118)
Q Consensus        63 ~~c~~c~~~~~~~~~l~~h~~~h~~   87 (118)
                      +.|.+|......+..+..|...-+.
T Consensus        39 ~kCtVC~~~mpdpktfkqhfe~kHp   63 (74)
T KOG4118|consen   39 HKCTVCMVQMPDPKTFKQHFENKHP   63 (74)
T ss_pred             hhhHhhHhhCCCCchHHHHHhhcCC
Confidence            5666776666666666666554443


No 298
>PF03833 PolC_DP2:  DNA polymerase II large subunit DP2;  InterPro: IPR016033 DP2 is the large subunit of a two-subunit novel archaebacterial replicative DNA polymerase first characterised for Pyrococcus furiosus. The structure of DP2 appears to be organised as a ~950 residue component separated from a ~300 residue component by a ~150 residue intein. The other subunit, DP1, has sequence similarity to the eukaryotic DNA polymerase delta small subunit. This entry represents the N-terminal ~950 residue component of DP2.; GO: 0003887 DNA-directed DNA polymerase activity; PDB: 3O59_X.
Probab=24.74  E-value=25  Score=26.18  Aligned_cols=9  Identities=33%  Similarity=0.910  Sum_probs=0.0

Q ss_pred             ccCCCCCcc
Q psy12028         31 FGCPQCPYR   39 (118)
Q Consensus        31 ~~C~~c~~~   39 (118)
                      ..|+.|+..
T Consensus       656 r~Cp~Cg~~  664 (900)
T PF03833_consen  656 RRCPKCGKE  664 (900)
T ss_dssp             ---------
T ss_pred             ccCcccCCc
Confidence            566666654


No 299
>KOG3002|consensus
Probab=24.66  E-value=1.1e+02  Score=19.83  Aligned_cols=16  Identities=19%  Similarity=0.416  Sum_probs=9.3

Q ss_pred             CCCccCCCCCcccccc
Q psy12028         28 EPKFGCPQCPYRSRQK   43 (118)
Q Consensus        28 ~~~~~C~~c~~~f~~~   43 (118)
                      +..-.||.|...+...
T Consensus        78 ~~~~~CP~Cr~~~g~~   93 (299)
T KOG3002|consen   78 KVSNKCPTCRLPIGNI   93 (299)
T ss_pred             hhcccCCccccccccH
Confidence            3445677776666543


No 300
>KOG3014|consensus
Probab=24.61  E-value=55  Score=20.56  Aligned_cols=23  Identities=26%  Similarity=0.469  Sum_probs=18.0

Q ss_pred             cCCCCCcccc--chHHHHhhhhhhc
Q psy12028          3 ACDVCGKEYQ--HKRTLYRHKKDEC   25 (118)
Q Consensus         3 ~C~~C~~~~~--~~~~l~~h~~~~~   25 (118)
                      +|.+|++.|.  +..+-..|.+-|+
T Consensus        39 ~C~~Cgm~Yt~~s~EDe~~H~~fH~   63 (257)
T KOG3014|consen   39 KCKECGMKYTVTSPEDEALHEKFHN   63 (257)
T ss_pred             ehhhcCceecCCCHHHHHHHHHHHH
Confidence            5999998875  5666778888886


No 301
>PF05129 Elf1:  Transcription elongation factor Elf1 like;  InterPro: IPR007808 This family of uncharacterised, mostly short, proteins contain a putative zinc binding domain with four conserved cysteines.; PDB: 1WII_A.
Probab=24.45  E-value=36  Score=17.18  Aligned_cols=40  Identities=25%  Similarity=0.640  Sum_probs=14.7

Q ss_pred             CCCccCCCCCcccccchHHHHHhhhhhccCCcccccccCchhhhhhch
Q psy12028         28 EPKFGCPQCPYRSRQKATLNRHLGWEQLQGNAHVMYACDVCGKVYQHK   75 (118)
Q Consensus        28 ~~~~~C~~c~~~f~~~~~l~~h~~~~~~~~~~~~~~~c~~c~~~~~~~   75 (118)
                      ...|.||.|+..-.-.-.+.        ...+.....|..|+..|...
T Consensus        20 ~~~F~CPfC~~~~sV~v~id--------kk~~~~~~~C~~Cg~~~~~~   59 (81)
T PF05129_consen   20 PKVFDCPFCNHEKSVSVKID--------KKEGIGILSCRVCGESFQTK   59 (81)
T ss_dssp             SS----TTT--SS-EEEEEE--------TTTTEEEEEESSS--EEEEE
T ss_pred             CceEcCCcCCCCCeEEEEEE--------ccCCEEEEEecCCCCeEEEc
Confidence            45699999983322211111        11122335788888777553


No 302
>KOG0402|consensus
Probab=24.25  E-value=26  Score=17.86  Aligned_cols=31  Identities=26%  Similarity=0.658  Sum_probs=19.2

Q ss_pred             CCccCCCCCcccccchHHHHHhhhhhccCCcccccccCchhhhhh
Q psy12028         29 PKFGCPQCPYRSRQKATLNRHLGWEQLQGNAHVMYACDVCGKVYQ   73 (118)
Q Consensus        29 ~~~~C~~c~~~f~~~~~l~~h~~~~~~~~~~~~~~~c~~c~~~~~   73 (118)
                      -.|.|++||+.--..     -         .-..|.|..|.+.+.
T Consensus        35 aky~CsfCGK~~vKR-----~---------AvGiW~C~~C~kv~a   65 (92)
T KOG0402|consen   35 AKYTCSFCGKKTVKR-----K---------AVGIWKCGSCKKVVA   65 (92)
T ss_pred             hhhhhhhcchhhhhh-----h---------ceeEEecCCccceec
Confidence            359999999754321     1         113477887777654


No 303
>PRK03922 hypothetical protein; Provisional
Probab=24.13  E-value=45  Score=17.99  Aligned_cols=14  Identities=21%  Similarity=0.354  Sum_probs=11.0

Q ss_pred             CccCCCCCcccccc
Q psy12028         30 KFGCPQCPYRSRQK   43 (118)
Q Consensus        30 ~~~C~~c~~~f~~~   43 (118)
                      ...||.||..|...
T Consensus        49 ~~~cP~cge~~~~a   62 (113)
T PRK03922         49 LTICPKCGEPFDSA   62 (113)
T ss_pred             cccCCCCCCcCCcE
Confidence            36899999988654


No 304
>PF02146 SIR2:  Sir2 family;  InterPro: IPR003000 These sequences represent the Sirtuin (Sir2-related) family of NAD+-dependent deacetylases. This family of enzymes is broadly conserved from bacteria to humans. In yeast, Sir2 proteins form complexes with other proteins to silence chromatin by accessing histones and deacetylating them. Sir2 proteins have been proposed to play a role in silencing, chromosome stability and ageing []. The bacterial enzyme CobB, an homologue of Sir2, is a phosphoribosyltransferase []. An in vitro ADP ribosyltransferase activity has also been associated with human members of this family []. Sir2-like enzymes employ NAD+ as a cosubstrate in deacetylation reactions [] and catalyse a reaction in which the cleavage of NAD(+)and histone and/or protein deacetylation are coupled to the formation of O-acetyl-ADP-ribose, a novel metabolite. The dependence of the reaction on both NAD(+) and the generation of this potential second messenger offers new clues to understanding the function and regulation of nuclear, cytoplasmic and mitochondrial Sir2-like enzymes []. Silent Information Regulator protein of Saccharomyces cerevisiae (Sir2) is one of several factors critical for silencing at least three loci. Among them, it is unique because it silences the rDNA as well as the mating type loci and telomeres []. Sir2 interacts in a complex with itself and with Sir3 and Sir4, two proteins that are able to interact with nucleosomes. In addition Sir2 also interacts with ubiquitination factors and/or complexes [].  Homologues of Sir2 share a core domain including the GAG and NID motifs and a putative C4 Zinc finger. The regions containing these three conserved motifs are individually essential for Sir2 silencing function, as are the four cysteins []. In addition, the conserved residues HG next to the putative Zn finger have been shown to be essential for the ADP ribosyltransferase activity []. ; GO: 0008270 zinc ion binding, 0070403 NAD+ binding, 0006476 protein deacetylation; PDB: 1S5P_A 3PKI_E 3PKJ_F 3K35_A 1ICI_A 1M2K_A 1M2G_A 1M2N_B 1M2H_A 1M2J_A ....
Probab=23.76  E-value=63  Score=18.74  Aligned_cols=11  Identities=18%  Similarity=0.618  Sum_probs=5.3

Q ss_pred             ccCCCCCcccc
Q psy12028         31 FGCPQCPYRSR   41 (118)
Q Consensus        31 ~~C~~c~~~f~   41 (118)
                      ..|..|+..+.
T Consensus       106 ~~C~~C~~~~~  116 (178)
T PF02146_consen  106 LRCSKCGKEYD  116 (178)
T ss_dssp             EEETTTSBEEE
T ss_pred             eeecCCCcccc
Confidence            44555555443


No 305
>COG3478 Predicted nucleic-acid-binding protein containing a Zn-ribbon domain [General function prediction only]
Probab=23.59  E-value=50  Score=15.96  Aligned_cols=8  Identities=50%  Similarity=1.555  Sum_probs=4.9

Q ss_pred             CccCCCCC
Q psy12028         91 KFECPHCP   98 (118)
Q Consensus        91 ~~~C~~C~   98 (118)
                      .++|+.||
T Consensus         4 ~~kCpKCg   11 (68)
T COG3478           4 AFKCPKCG   11 (68)
T ss_pred             cccCCCcC
Confidence            35566666


No 306
>PF01844 HNH:  HNH endonuclease;  InterPro: IPR002711 HNH endonuclease is found in bacteria and viruses [, , ]. This family includes pyocins, colicins and anaredoxins.; GO: 0003676 nucleic acid binding, 0004519 endonuclease activity; PDB: 2QGP_C.
Probab=23.54  E-value=18  Score=15.44  Aligned_cols=10  Identities=40%  Similarity=0.956  Sum_probs=2.3

Q ss_pred             CCCCCccccc
Q psy12028          4 CDVCGKEYQH   13 (118)
Q Consensus         4 C~~C~~~~~~   13 (118)
                      |..|+..+..
T Consensus         1 C~~C~~~~~~   10 (47)
T PF01844_consen    1 CQYCGKPGSD   10 (47)
T ss_dssp             -TTT--B--G
T ss_pred             CCCCCCcCcc
Confidence            3445544433


No 307
>PF03966 Trm112p:  Trm112p-like protein;  InterPro: IPR005651 This family of short proteins have no known function. The bacterial members are about 60-70 amino acids in length and the eukaryotic examples are about 120 amino acids in length. The C terminus contains the strongest conservation. The function of this family is uncertain. The bacterial members are about 60-70 amino acids in length and the eukaryotic examples are about 120 amino acids in length. The C terminus contains the strongest conservation. The entry contains 2 families:  Trm112, which is required for tRNA methylation in Saccharomyces cerevisiae (Baker's yeast) and is found in complexes with 2 tRNA methylases (TRM9 and TRM11) also with putative methyltransferase YDR140W []. The zinc-finger protein Ynr046w is plurifunctional and a component of the eRF1 methyltransferase in yeast []. The crystal structure of Ynr046w has been determined to 1.7 A resolution. It comprises a zinc-binding domain built from both the N- and C-terminal sequences and an inserted domain, absent from bacterial and archaeal orthologs of the protein, composed of three alpha-helices []. UPF0434, which are proteins that are functionally uncharacterised.  ; PDB: 3Q87_A 2KPI_A 2K5R_A 2HF1_A 2JS4_A 2J6A_A 2JR6_A 2PK7_A 2JNY_A.
Probab=23.37  E-value=29  Score=16.61  Aligned_cols=15  Identities=27%  Similarity=0.563  Sum_probs=12.3

Q ss_pred             CCCccCCCCCccccc
Q psy12028         28 EPKFGCPQCPYRSRQ   42 (118)
Q Consensus        28 ~~~~~C~~c~~~f~~   42 (118)
                      +....|+.|+..|..
T Consensus        51 eg~L~Cp~c~r~YPI   65 (68)
T PF03966_consen   51 EGELICPECGREYPI   65 (68)
T ss_dssp             TTEEEETTTTEEEEE
T ss_pred             CCEEEcCCCCCEEeC
Confidence            567899999998864


No 308
>PF03145 Sina:  Seven in absentia protein family;  InterPro: IPR018121 The seven in absentia (sina) gene was first identified in Drosophila. The Drosophila Sina protein is essential for the determination of the R7 pathway in photoreceptor cell development: the loss of functional Sina results in the transformation of the R7 precursor cell to a non-neuronal cell type. The Sina protein contains an N-terminal RING finger domain C3HC4-type. Through this domain, Sina binds E2 ubiquitin-conjugating enzymes (UbcD1) Sina also interacts with Tramtrack (TTK88) via PHYL. Tramtrack is a transcriptional repressor that blocks photoreceptor determination, while PHYL down-regulates the activity of TTK88. In turn, the activity of PHYL requires the activation of the Sevenless receptor tyrosine kinase, a process essential for R7 determination. It is thought that Sina targets TTK88 for degradation, therefore promoting the R7 pathway. Murine and human homologues of Sina have also been identified. The human homologue Siah-1 [] also binds E2 enzymes (UbcH5) and through a series of physical interactions, targets beta-catenin for ubiquitin degradation. Siah-1 expression is enhanced by p53, itself promoted by DNA damage. Thus this pathway links DNA damage to beta-catenin degradation [, ]. Sina proteins, therefore, physically interact with a variety of proteins. The N-terminal RING finger domain that binds ubiquitin conjugating enzymes is a C3HC4-type, and does not form part of the alignment for this family. The remainder C-terminal part is involved in interactions with other proteins, and is included in this alignment. In addition to the Drosophila protein and mammalian homologues, whose similarity was noted previously, this family also includes putative homologues from Caenorhabditis elegans, Arabidopsis thaliana.; GO: 0006511 ubiquitin-dependent protein catabolic process, 0007275 multicellular organismal development, 0005634 nucleus; PDB: 2A25_A 1K2F_B 2AN6_C.
Probab=23.08  E-value=54  Score=19.43  Aligned_cols=26  Identities=19%  Similarity=0.259  Sum_probs=11.3

Q ss_pred             cccccCc----hhhhhhchHHHHHHHhhhcC
Q psy12028         61 VMYACDV----CGKVYQHKQTLDRHKKDECG   87 (118)
Q Consensus        61 ~~~~c~~----c~~~~~~~~~l~~h~~~h~~   87 (118)
                      +|+.|+.    |+-.- ....|..|....|.
T Consensus        43 ~p~~CP~~~~~C~~~G-~~~~l~~Hl~~~H~   72 (198)
T PF03145_consen   43 RPCSCPFPGSGCDWQG-SYKELLDHLRDKHS   72 (198)
T ss_dssp             SEEE-SSSSTT---EE-ECCCHHHHHHHHTT
T ss_pred             cCCcCCCCCCCccccC-CHHHHHHHHHHHCC
Confidence            4566665    43222 22355666665554


No 309
>PF06676 DUF1178:  Protein of unknown function (DUF1178);  InterPro: IPR009562 This family consists of several hypothetical bacterial proteins of around 150 residues in length. The function of this family is unknown.
Probab=23.06  E-value=1.1e+02  Score=17.63  Aligned_cols=34  Identities=18%  Similarity=0.382  Sum_probs=20.7

Q ss_pred             ccchHHHHhhhhhhcCCCCCccCCCCCcccccchHHHHH
Q psy12028         11 YQHKRTLYRHKKDECGQEPKFGCPQCPYRSRQKATLNRH   49 (118)
Q Consensus        11 ~~~~~~l~~h~~~~~~~~~~~~C~~c~~~f~~~~~l~~h   49 (118)
                      |.+...+.....     .....||+||-.-..+..+..+
T Consensus        18 F~ss~~fd~Q~~-----~glv~CP~Cgs~~V~K~lmAP~   51 (148)
T PF06676_consen   18 FRSSAAFDRQQA-----RGLVSCPVCGSTEVSKALMAPA   51 (148)
T ss_pred             cCCHHHHHHHHH-----cCCccCCCCCCCeEeeecCCCe
Confidence            445555554432     4578999999776555444333


No 310
>KOG0801|consensus
Probab=23.06  E-value=28  Score=20.26  Aligned_cols=12  Identities=25%  Similarity=0.631  Sum_probs=9.1

Q ss_pred             ccCCCCCccccc
Q psy12028         31 FGCPQCPYRSRQ   42 (118)
Q Consensus        31 ~~C~~c~~~f~~   42 (118)
                      ++||+|.+....
T Consensus       139 ~KCPvC~K~V~s  150 (205)
T KOG0801|consen  139 MKCPVCHKVVPS  150 (205)
T ss_pred             ccCCccccccCC
Confidence            889999876554


No 311
>PF13248 zf-ribbon_3:  zinc-ribbon domain
Probab=22.89  E-value=33  Score=12.90  Aligned_cols=8  Identities=50%  Similarity=1.148  Sum_probs=5.0

Q ss_pred             cCCCCCcc
Q psy12028          3 ACDVCGKE   10 (118)
Q Consensus         3 ~C~~C~~~   10 (118)
                      .|+.||..
T Consensus         4 ~Cp~Cg~~   11 (26)
T PF13248_consen    4 FCPNCGAE   11 (26)
T ss_pred             CCcccCCc
Confidence            46777763


No 312
>KOG2906|consensus
Probab=22.83  E-value=11  Score=19.73  Aligned_cols=38  Identities=18%  Similarity=0.425  Sum_probs=18.6

Q ss_pred             ccCCCCCcccccchHHHHHhhhhhccCCcccccccCchhhhh
Q psy12028         31 FGCPQCPYRSRQKATLNRHLGWEQLQGNAHVMYACDVCGKVY   72 (118)
Q Consensus        31 ~~C~~c~~~f~~~~~l~~h~~~~~~~~~~~~~~~c~~c~~~~   72 (118)
                      -.||.||-.-.....|+.-    .-......-|.|-.|+..+
T Consensus        66 ~~Cp~Cgh~rayF~qlQtR----SADEPmT~FYkC~~C~~~W  103 (105)
T KOG2906|consen   66 ATCPTCGHERAYFMQLQTR----SADEPMTTFYKCCKCKHRW  103 (105)
T ss_pred             CcCCCCCCCceEEEEeeec----cCCCcHhHhhhhhcccccc
Confidence            5688887654443333322    1122223346776676543


No 313
>PF03380 DUF282:  Caenorhabditis protein of unknown function, DUF282;  InterPro: IPR005044  This family consists of proteins of unknown function found in Caenorhabditis species.
Probab=22.80  E-value=54  Score=14.07  Aligned_cols=9  Identities=56%  Similarity=1.350  Sum_probs=4.6

Q ss_pred             CCCCCcccc
Q psy12028          4 CDVCGKEYQ   12 (118)
Q Consensus         4 C~~C~~~~~   12 (118)
                      |..|.+++.
T Consensus         2 Cs~C~~iYd   10 (39)
T PF03380_consen    2 CSVCSKIYD   10 (39)
T ss_pred             CcccccccC
Confidence            555555543


No 314
>TIGR00627 tfb4 transcription factor tfb4. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=22.69  E-value=60  Score=20.77  Aligned_cols=8  Identities=25%  Similarity=0.679  Sum_probs=3.8

Q ss_pred             cCCCCCCC
Q psy12028         93 ECPHCPYR  100 (118)
Q Consensus        93 ~C~~C~~~  100 (118)
                      .|+.||-.
T Consensus       271 ~C~~Cgt~  278 (279)
T TIGR00627       271 ICKTCKTA  278 (279)
T ss_pred             CCCCCCCC
Confidence            45555433


No 315
>PF03884 DUF329:  Domain of unknown function (DUF329);  InterPro: IPR005584 The biological function of these short proteins is unknown, but they contain four conserved cysteines, suggesting that they all bind zinc. YacG (Q5X8H6 from SWISSPROT) from Escherichia coli has been shown to bind zinc and contains the structural motifs typical of zinc-binding proteins []. The conserved four cysteine motif in these proteins (-C-X(2)-C-X(15)-C-X(3)-C-) is not found in other zinc-binding proteins with known structures.; GO: 0008270 zinc ion binding; PDB: 1LV3_A.
Probab=22.58  E-value=33  Score=16.10  Aligned_cols=12  Identities=25%  Similarity=0.551  Sum_probs=5.8

Q ss_pred             ccCCCCCccccc
Q psy12028         31 FGCPQCPYRSRQ   42 (118)
Q Consensus        31 ~~C~~c~~~f~~   42 (118)
                      ..||.|++.+..
T Consensus         3 v~CP~C~k~~~~   14 (57)
T PF03884_consen    3 VKCPICGKPVEW   14 (57)
T ss_dssp             EE-TTT--EEE-
T ss_pred             ccCCCCCCeecc
Confidence            468889887755


No 316
>PLN03239 histone acetyltransferase; Provisional
Probab=22.33  E-value=58  Score=21.58  Aligned_cols=24  Identities=21%  Similarity=0.145  Sum_probs=21.0

Q ss_pred             CCCccCCCCCCCCCChhHHHHHHh
Q psy12028         89 EPKFECPHCPYRSKRKDTLDRHMK  112 (118)
Q Consensus        89 ~~~~~C~~C~~~f~~~~~l~~H~~  112 (118)
                      ...|.|..|-+-|.....|.+|+.
T Consensus       104 ~~lYiCE~Clky~~~~~~l~~H~~  127 (351)
T PLN03239        104 DVLYVCEFSFGFFARKSELLRFQA  127 (351)
T ss_pred             ceEEEeccchhhhcCHHHHHHHHH
Confidence            467999999999999999999875


No 317
>PF06220 zf-U1:  U1 zinc finger;  InterPro: IPR013085 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  C2H2-type (classical) zinc fingers (Znf) were the first class to be characterised. They contain a short beta hairpin and an alpha helix (beta/beta/alpha structure), where a single zinc atom is held in place by Cys(2)His(2) (C2H2) residues in a tetrahedral array. C2H2 Znf's can be divided into three groups based on the number and pattern of fingers: triple-C2H2 (binds single ligand), multiple-adjacent-C2H2 (binds multiple ligands), and separated paired-C2H2 []. C2H2 Znf's are the most common DNA-binding motifs found in eukaryotic transcription factors, and have also been identified in prokaryotes []. Transcription factors usually contain several Znf's (each with a conserved beta/beta/alpha structure) capable of making multiple contacts along the DNA, where the C2H2 Znf motifs recognise DNA sequences by binding to the major groove of DNA via a short alpha-helix in the Znf, the Znf spanning 3-4 bases of the DNA []. C2H2 Znf's can also bind to RNA and protein targets []. This entry represents a C2H2-type zinc finger motif found in several U1 small nuclear ribonucleoprotein C (U1-C) proteins. Some proteins contain multiple copies of this motif. The U1 small nuclear ribonucleoprotein (U1 snRNP) binds to the pre-mRNA 5' splice site at early stages of spliceosome assembly. Recruitment of U1 to a class of weak 5' splice site is promoted by binding of the protein TIA-1 to uridine-rich sequences immediately downstream from the 5' splice site. Binding of TIA-1 in the vicinity of a 5' splice site helps to stabilise U1 snRNP recruitment, at least in part, via a direct interaction with U1-C, thus providing one molecular mechanism for the function of this splicing regulator []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 2VRD_A.
Probab=22.11  E-value=84  Score=13.20  Aligned_cols=10  Identities=20%  Similarity=0.530  Sum_probs=2.9

Q ss_pred             ccCCCCCCCC
Q psy12028         92 FECPHCPYRS  101 (118)
Q Consensus        92 ~~C~~C~~~f  101 (118)
                      |=|..|+.-+
T Consensus         4 yyCdyC~~~~   13 (38)
T PF06220_consen    4 YYCDYCKKYL   13 (38)
T ss_dssp             -B-TTT--B-
T ss_pred             eeccccccee
Confidence            4456666555


No 318
>PF11494 Ta0938:  Ta0938;  InterPro: IPR021585  Ta0938 is a protein of unknown function however the structure has been determined. The protein has a novel fold and a putative Zn-binding motif. The structure has two different parts, one region contains a beta sheet flanked by two alpha helices and the other contains a bundle of loops which contain all cysteines in the protein. ; PDB: 2FQH_A.
Probab=22.01  E-value=51  Score=17.36  Aligned_cols=12  Identities=25%  Similarity=0.634  Sum_probs=3.1

Q ss_pred             CccCCCCCcccc
Q psy12028         30 KFGCPQCPYRSR   41 (118)
Q Consensus        30 ~~~C~~c~~~f~   41 (118)
                      .-.|..|+.++.
T Consensus        14 e~~CalCG~tWg   25 (105)
T PF11494_consen   14 EMGCALCGATWG   25 (105)
T ss_dssp             GGS-SS---S--
T ss_pred             cccccccCCcHH
Confidence            345555655554


No 319
>PF02748 PyrI_C:  Aspartate carbamoyltransferase regulatory chain, metal binding domain;  InterPro: IPR020542 Aspartate carbamoyltransferase (aspartate transcarbamylase, ATCase) 2.1.3.2 from EC is an allosteric enzyme that plays a central role in the regulation of the pyrimidine pathway in bacteria. The holoenzyme is a dodecamer composed of six catalytic chains, each with an active site, and six regulatory chains lacking catalytic activity []. The catalytic subunits exist as a dimer of catalytic trimers, (c3)2, while the regulatory subunits exist as a trimer of regulatory dimers, (r2)3, therefore the complete holoenzyme can be represented as (c3)2(r2)3. The association of the catalytic subunits c3 with the regulatory subunits r2 is responsible for the establishment of positive co-operativity between catalytic sites for the binding of aspartate and it dictates the pattern of allosteric response toward nucleotide effectors. ATCase from Escherichia coli is the most extensively studied allosteric enzyme []. The crystal structure of the T-state, the T-state with CTP bound, the R-state with N-phosphonacetyl-L-aspartate (PALA) bound, and the R-state with phosphonoacetamide plus malonate bound have been used in interpreting kinetic and mutational studies. A high-resolution structure of E. coli ATCase in the presence of PALA (a bisubstrate analog) allows a detailed description of the binding at the active site of the enzyme and allows a detailed model of the tetrahedral intermediate to be constructed. The entire regulatory chain has been traced showing that the N-terminal regions of the regulatory chains R1 and R6 are located in close proximity to each other and to the regulatory site. This portion of the molecule may be involved in the observed asymmetry between the regulatory binding sites as well as in the heterotropic response of the enzyme []. The C-terminal domain of the regulatory chains have a rubredoxin-like zinc-bound fold.  ATCase from Enterobacter agglomerans (Erwinia herbicola) (Pantoea agglomerans) differs from the other investigated enterobacterial ATCases by its absence of homotropic co-operativity toward the substrate aspartate and its lack of response to ATP which is an allosteric effector (activator) of this family of enzymes. Nevertheless, the E. herbicola ATCase has the same quaternary structure, two trimers of catalytic chains with three dimers of regulatory chains, (c3)2(r2)3, as other enterobacterial ATCases and shows extensive primary structure conservation [].  This entry represents the C-terminal domain.; PDB: 2YWW_B 1SKU_D 1Q95_L 8ATC_B 3AT1_D 1RAI_D 4E2F_D 1NBE_B 6AT1_B 2FZC_D ....
Probab=21.85  E-value=30  Score=15.82  Aligned_cols=14  Identities=21%  Similarity=0.377  Sum_probs=8.5

Q ss_pred             CCCccCCCCCCCCC
Q psy12028         89 EPKFECPHCPYRSK  102 (118)
Q Consensus        89 ~~~~~C~~C~~~f~  102 (118)
                      ...|+|.+|++.+.
T Consensus        33 ~~~~rC~YCe~~~~   46 (52)
T PF02748_consen   33 PIKLRCHYCERIIT   46 (52)
T ss_dssp             TCEEEETTT--EEE
T ss_pred             CCEEEeeCCCCEec
Confidence            55688888887664


No 320
>PF12230 PRP21_like_P:  Pre-mRNA splicing factor PRP21 like protein;  InterPro: IPR022030  This domain family is found in eukaryotes, and is typically between 212 and 238 amino acids in length. The family is found in association with PF01805 from PFAM. There are two completely conserved residues (W and H) that may be functionally important. PRP21 is required for assembly of the prespliceosome and it interacts with U2 snRNP and/or pre-mRNA in the prespliceosome. This family also contains proteins similar to PRP21, such as the mammalian SF3a. SF3a also interacts with U2 snRNP from the prespliceosome, converting it to its active form. ; PDB: 4DGW_B.
Probab=21.60  E-value=31  Score=21.06  Aligned_cols=26  Identities=31%  Similarity=0.413  Sum_probs=0.0

Q ss_pred             CCCccCCCCCCCCCChhHHHHHHhhhc
Q psy12028         89 EPKFECPHCPYRSKRKDTLDRHMKIIH  115 (118)
Q Consensus        89 ~~~~~C~~C~~~f~~~~~l~~H~~~~~  115 (118)
                      ..-..|++||... -.+.|..||++..
T Consensus       166 ~~~~~cPitGe~I-P~~e~~eHmRi~L  191 (229)
T PF12230_consen  166 EKMIICPITGEMI-PADEMDEHMRIEL  191 (229)
T ss_dssp             ---------------------------
T ss_pred             ccccccccccccc-ccccccccccccc
Confidence            4557899999764 5677889988753


No 321
>PTZ00303 phosphatidylinositol kinase; Provisional
Probab=21.56  E-value=12  Score=27.64  Aligned_cols=13  Identities=23%  Similarity=0.401  Sum_probs=9.3

Q ss_pred             ccCCCCCcccccc
Q psy12028         31 FGCPQCPYRSRQK   43 (118)
Q Consensus        31 ~~C~~c~~~f~~~   43 (118)
                      -.|..|++.|...
T Consensus       461 dtC~~C~kkFfSl  473 (1374)
T PTZ00303        461 DSCPSCGRAFISL  473 (1374)
T ss_pred             CcccCcCCccccc
Confidence            4588888888653


No 322
>PF10058 DUF2296:  Predicted integral membrane metal-binding protein (DUF2296);  InterPro: IPR019273  This domain, found mainly in the eukaryotic lunapark proteins, has no known function []. 
Probab=21.38  E-value=46  Score=15.35  Aligned_cols=11  Identities=36%  Similarity=0.987  Sum_probs=6.8

Q ss_pred             CCCccCCCCCC
Q psy12028         89 EPKFECPHCPY   99 (118)
Q Consensus        89 ~~~~~C~~C~~   99 (118)
                      ...|.|+.||.
T Consensus        42 ~i~y~C~~Cg~   52 (54)
T PF10058_consen   42 EIQYRCPYCGA   52 (54)
T ss_pred             ceEEEcCCCCC
Confidence            34577777763


No 323
>PF06170 DUF983:  Protein of unknown function (DUF983);  InterPro: IPR009325 This family consists of several bacterial proteins of unknown function.
Probab=21.30  E-value=54  Score=16.79  Aligned_cols=11  Identities=36%  Similarity=1.026  Sum_probs=7.5

Q ss_pred             cCCCCCCCCCC
Q psy12028         93 ECPHCPYRSKR  103 (118)
Q Consensus        93 ~C~~C~~~f~~  103 (118)
                      .|+.||-.|..
T Consensus        10 ~C~~CG~d~~~   20 (86)
T PF06170_consen   10 RCPHCGLDYSH   20 (86)
T ss_pred             cccccCCcccc
Confidence            58888866543


No 324
>COG5152 Uncharacterized conserved protein, contains RING and CCCH-type Zn-fingers [General function prediction only]
Probab=21.09  E-value=37  Score=20.48  Aligned_cols=13  Identities=31%  Similarity=1.071  Sum_probs=7.0

Q ss_pred             CccCCCCCccccc
Q psy12028          1 MYACDVCGKEYQH   13 (118)
Q Consensus         1 ~~~C~~C~~~~~~   13 (118)
                      ||.|.+|.+.|.+
T Consensus       196 PF~C~iCKkdy~s  208 (259)
T COG5152         196 PFLCGICKKDYES  208 (259)
T ss_pred             ceeehhchhhccc
Confidence            4556555555533


No 325
>TIGR03830 CxxCG_CxxCG_HTH putative zinc finger/helix-turn-helix protein, YgiT family. This model describes a family of predicted regulatory proteins with a conserved zinc finger/HTH architecture. The amino-terminal region contains a novel domain, featuring two CXXC motifs and occuring in a number of small bacterial proteins as well as in the present family. The carboxyl-terminal region consists of a helix-turn-helix domain, modeled by pfam01381. The predicted function is DNA binding and transcriptional regulation.
Probab=21.08  E-value=81  Score=16.89  Aligned_cols=17  Identities=24%  Similarity=0.589  Sum_probs=10.1

Q ss_pred             ccCCCCCccccchHHHH
Q psy12028          2 YACDVCGKEYQHKRTLY   18 (118)
Q Consensus         2 ~~C~~C~~~~~~~~~l~   18 (118)
                      +.|+.||..+.+.....
T Consensus        32 ~~C~~CGe~~~~~e~~~   48 (127)
T TIGR03830        32 WYCPACGEELLDPEESK   48 (127)
T ss_pred             eECCCCCCEEEcHHHHH
Confidence            35677776666555444


No 326
>PF04988 AKAP95:  A-kinase anchoring protein 95 (AKAP95);  InterPro: IPR007071 A-kinase (or PKA)-anchoring protein AKAP95 is implicated in mitotic chromosome condensation by acting as a targeting molecule for the condensin complex. The protein contains two zinc fingers which are thought to mediate the binding of AKAP95 to DNA [].; GO: 0003677 DNA binding, 0005634 nucleus
Probab=20.80  E-value=73  Score=18.61  Aligned_cols=21  Identities=29%  Similarity=0.828  Sum_probs=17.0

Q ss_pred             ccCCCCCcccccchHHHHHhh
Q psy12028         31 FGCPQCPYRSRQKATLNRHLG   51 (118)
Q Consensus        31 ~~C~~c~~~f~~~~~l~~h~~   51 (118)
                      |.|.+|.........+..|+.
T Consensus         1 F~Cs~CKfrtf~~~ei~~Hle   21 (165)
T PF04988_consen    1 FTCSFCKFRTFEEKEIEKHLE   21 (165)
T ss_pred             CccceeeeecccHHHHHHHHc
Confidence            578889887777788888876


No 327
>PF13696 zf-CCHC_2:  Zinc knuckle
Probab=20.73  E-value=45  Score=13.59  Aligned_cols=10  Identities=20%  Similarity=0.800  Sum_probs=7.4

Q ss_pred             CccCCCCCCC
Q psy12028         91 KFECPHCPYR  100 (118)
Q Consensus        91 ~~~C~~C~~~  100 (118)
                      .|.|..|+..
T Consensus         8 ~Y~C~~C~~~   17 (32)
T PF13696_consen    8 GYVCHRCGQK   17 (32)
T ss_pred             CCEeecCCCC
Confidence            4788888764


No 328
>PLN00104 MYST -like histone acetyltransferase; Provisional
Probab=20.66  E-value=63  Score=22.28  Aligned_cols=24  Identities=42%  Similarity=0.681  Sum_probs=21.3

Q ss_pred             CCCccCCCCCCCCCChhHHHHHHh
Q psy12028         89 EPKFECPHCPYRSKRKDTLDRHMK  112 (118)
Q Consensus        89 ~~~~~C~~C~~~f~~~~~l~~H~~  112 (118)
                      ...|.|..|-+-|.....|.+|+.
T Consensus       196 ~~lyiCe~Cl~y~~~~~~~~~H~~  219 (450)
T PLN00104        196 SKLYFCEFCLKFMKRKEQLQRHMK  219 (450)
T ss_pred             CeEEEchhhhhhhcCHHHHHHHHh
Confidence            557999999999999999999985


No 329
>COG1066 Sms Predicted ATP-dependent serine protease [Posttranslational modification, protein turnover, chaperones]
Probab=20.66  E-value=46  Score=22.76  Aligned_cols=10  Identities=50%  Similarity=1.152  Sum_probs=5.3

Q ss_pred             ccCCCCCccc
Q psy12028         31 FGCPQCPYRS   40 (118)
Q Consensus        31 ~~C~~c~~~f   40 (118)
                      |.|..||..+
T Consensus         8 f~C~~CG~~s   17 (456)
T COG1066           8 FVCQECGYVS   17 (456)
T ss_pred             EEcccCCCCC
Confidence            5555555444


No 330
>smart00647 IBR In Between Ring fingers. the domains occurs between pairs og RING fingers
Probab=20.61  E-value=74  Score=14.45  Aligned_cols=11  Identities=27%  Similarity=0.760  Sum_probs=5.8

Q ss_pred             cccCchhhhhh
Q psy12028         63 YACDVCGKVYQ   73 (118)
Q Consensus        63 ~~c~~c~~~~~   73 (118)
                      ..|+.|+..|-
T Consensus        41 v~C~~C~~~fC   51 (64)
T smart00647       41 VTCPKCGFSFC   51 (64)
T ss_pred             eECCCCCCeEC
Confidence            45655555543


No 331
>TIGR03655 anti_R_Lar restriction alleviation protein, Lar family. Restriction alleviation proteins provide a countermeasure to host cell restriction enzyme defense against foreign DNA such as phage or plasmids. This family consists of homologs to the phage antirestriction protein Lar, and most members belong to phage genomes or prophage regions of bacterial genomes.
Probab=20.51  E-value=52  Score=14.85  Aligned_cols=8  Identities=38%  Similarity=0.841  Sum_probs=4.9

Q ss_pred             cCCCCCcc
Q psy12028         32 GCPQCPYR   39 (118)
Q Consensus        32 ~C~~c~~~   39 (118)
                      .||+||..
T Consensus         3 PCPfCGg~   10 (53)
T TIGR03655         3 PCPFCGGA   10 (53)
T ss_pred             CCCCCCCc
Confidence            46777653


No 332
>PTZ00064 histone acetyltransferase; Provisional
Probab=20.03  E-value=76  Score=22.33  Aligned_cols=24  Identities=25%  Similarity=0.272  Sum_probs=21.5

Q ss_pred             CCCccCCCCCCCCCChhHHHHHHh
Q psy12028         89 EPKFECPHCPYRSKRKDTLDRHMK  112 (118)
Q Consensus        89 ~~~~~C~~C~~~f~~~~~l~~H~~  112 (118)
                      ...|.|..|-+-|.....|.+|+.
T Consensus       278 d~LYICEfCLkY~~s~~~l~rH~~  301 (552)
T PTZ00064        278 DTLHFCEYCLDFFCFEDELIRHLS  301 (552)
T ss_pred             CeEEEccchhhhhCCHHHHHHHHh
Confidence            557999999999999999999975


Done!