Query         psy12029
Match_columns 81
No_of_seqs    113 out of 1321
Neff          11.5
Searched_HMMs 46136
Date          Fri Aug 16 16:49:10 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy12029.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/12029hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG2462|consensus               99.9 3.7E-23   8E-28  110.0   2.8   71    2-73    194-264 (279)
  2 KOG2462|consensus               99.9 1.1E-22 2.5E-27  108.1   3.1   76    2-80    168-243 (279)
  3 KOG3623|consensus               99.6 7.4E-17 1.6E-21   95.4   1.2   71    2-73    901-971 (1007)
  4 KOG3576|consensus               99.6 1.6E-16 3.5E-21   82.2  -0.8   74    3-77    125-198 (267)
  5 KOG3623|consensus               99.5 2.5E-14 5.4E-19   85.1   2.2   61   19-80    890-950 (1007)
  6 KOG1074|consensus               99.4 3.2E-14   7E-19   85.3  -0.5   76    3-78    613-694 (958)
  7 PHA02768 hypothetical protein;  99.4 1.9E-13 4.2E-18   57.4   1.7   44   23-69      5-48  (55)
  8 KOG3576|consensus               99.4 7.9E-13 1.7E-17   68.8   3.2   76    3-79    153-239 (267)
  9 PHA00733 hypothetical protein   99.3 3.1E-12 6.7E-17   63.0   4.5   63   11-77     62-124 (128)
 10 KOG1074|consensus               99.3 1.2E-12 2.5E-17   78.9   0.6   57   23-80    353-409 (958)
 11 PF13465 zf-H2C2_2:  Zinc-finge  99.1 1.5E-10 3.3E-15   42.1   2.7   24   39-63      2-25  (26)
 12 PF13465 zf-H2C2_2:  Zinc-finge  99.1 2.4E-11 5.1E-16   44.3   0.2   25   10-34      1-25  (26)
 13 KOG3993|consensus               99.0 1.3E-10 2.9E-15   66.0   1.1   72    5-77    277-381 (500)
 14 PHA00616 hypothetical protein   98.9 7.9E-10 1.7E-14   44.6   1.8   34   23-57      1-34  (44)
 15 KOG3608|consensus               98.9 3.1E-10 6.8E-15   63.5   0.7   69    4-73    188-258 (467)
 16 KOG3608|consensus               98.9 9.4E-10   2E-14   61.6   2.3   70    4-76    246-316 (467)
 17 PHA00616 hypothetical protein   98.7 5.2E-09 1.1E-13   42.2   1.5   28   53-80      2-29  (44)
 18 PHA00732 hypothetical protein   98.7   9E-09   2E-13   46.8   2.3   45   23-74      1-46  (79)
 19 PHA02768 hypothetical protein;  98.5 1.2E-07 2.6E-12   40.0   2.0   24   53-76      6-29  (55)
 20 PLN03086 PRLI-interacting fact  98.5 2.2E-07 4.8E-12   55.4   3.7   63    8-75    465-537 (567)
 21 PF00096 zf-C2H2:  Zinc finger,  98.4 2.3E-07 4.9E-12   32.5   2.2   22   53-74      1-22  (23)
 22 PF05605 zf-Di19:  Drought indu  98.4 9.6E-07 2.1E-11   37.4   3.9   51   23-77      2-54  (54)
 23 PF00096 zf-C2H2:  Zinc finger,  98.4 3.6E-07 7.8E-12   32.0   1.9   23   24-46      1-23  (23)
 24 PF13894 zf-C2H2_4:  C2H2-type   98.3 9.9E-07 2.2E-11   30.9   2.4   24   53-76      1-24  (24)
 25 PF13912 zf-C2H2_6:  C2H2-type   98.3   9E-07   2E-11   32.1   1.9   24   53-76      2-25  (27)
 26 PF09237 GAGA:  GAGA factor;  I  98.2 2.5E-06 5.4E-11   35.3   2.8   29   53-81     25-53  (54)
 27 PLN03086 PRLI-interacting fact  98.2 3.7E-06   8E-11   50.4   4.0   67    7-76    488-564 (567)
 28 PF09237 GAGA:  GAGA factor;  I  98.1 5.4E-06 1.2E-10   34.3   3.1   34   18-51     19-52  (54)
 29 PHA00733 hypothetical protein   98.1 1.5E-06 3.3E-11   43.0   1.5   55   20-75     37-96  (128)
 30 PF13912 zf-C2H2_6:  C2H2-type   98.1 1.7E-06 3.7E-11   31.4   1.3   25   23-47      1-25  (27)
 31 PF13894 zf-C2H2_4:  C2H2-type   98.0 6.2E-06 1.3E-10   28.7   2.1   23   24-46      1-23  (24)
 32 COG5189 SFP1 Putative transcri  97.9 3.7E-06 7.9E-11   47.1   1.0   52   21-73    347-419 (423)
 33 smart00355 ZnF_C2H2 zinc finge  97.8 2.3E-05 5.1E-10   27.6   2.3   22   54-75      2-23  (26)
 34 PRK04860 hypothetical protein;  97.8 2.7E-05   6E-10   40.0   2.9   39   22-65    118-156 (160)
 35 PF12756 zf-C2H2_2:  C2H2 type   97.6 5.7E-05 1.2E-09   35.4   2.4   23   53-75     51-73  (100)
 36 smart00355 ZnF_C2H2 zinc finge  97.6 7.2E-05 1.6E-09   26.2   2.1   24   24-47      1-24  (26)
 37 PF13909 zf-H2C2_5:  C2H2-type   97.4 0.00023   5E-09   24.9   2.2   23   53-76      1-23  (24)
 38 PF12874 zf-met:  Zinc-finger o  97.4 0.00018   4E-09   25.4   1.8   21   53-73      1-21  (25)
 39 PF12874 zf-met:  Zinc-finger o  97.4 0.00014   3E-09   25.7   1.5   23   24-46      1-23  (25)
 40 KOG3993|consensus               97.4 2.7E-05 5.9E-10   45.2  -0.7   54   22-76    266-319 (500)
 41 PHA00732 hypothetical protein   97.2 0.00032   7E-09   32.0   2.1   25   53-77      2-27  (79)
 42 PF12171 zf-C2H2_jaz:  Zinc-fin  96.9 0.00035 7.6E-09   25.2   0.4   21   53-73      2-22  (27)
 43 PF13913 zf-C2HC_2:  zinc-finge  96.6  0.0025 5.3E-08   22.7   1.9   20   53-73      3-22  (25)
 44 smart00451 ZnF_U1 U1-like zinc  95.9  0.0087 1.9E-07   22.6   1.9   21   53-73      4-24  (35)
 45 COG4049 Uncharacterized protei  95.6    0.01 2.2E-07   25.2   1.5   30   17-46     11-40  (65)
 46 KOG2893|consensus               95.5   0.003 6.5E-08   34.6  -0.3   40   25-69     12-51  (341)
 47 KOG1146|consensus               95.5   0.011 2.4E-07   39.3   2.1   56   18-74    460-540 (1406)
 48 PRK04860 hypothetical protein;  95.5  0.0047   1E-07   31.9   0.4   29    8-36    128-156 (160)
 49 cd00350 rubredoxin_like Rubred  95.4   0.011 2.5E-07   22.3   1.3   24   24-60      2-25  (33)
 50 KOG2186|consensus               95.0   0.027 5.9E-07   31.2   2.3   47   24-74      4-50  (276)
 51 COG5048 FOG: Zn-finger [Genera  94.6  0.0063 1.4E-07   35.1  -0.8   55   23-78    289-349 (467)
 52 PF12756 zf-C2H2_2:  C2H2 type   94.4   0.044 9.5E-07   25.5   2.1   24   23-46     50-73  (100)
 53 PF13719 zinc_ribbon_5:  zinc-r  93.5     0.1 2.2E-06   20.2   1.9   34   24-63      3-36  (37)
 54 COG2888 Predicted Zn-ribbon RN  93.3   0.068 1.5E-06   23.0   1.4   32   22-59     26-57  (61)
 55 PF09538 FYDLN_acid:  Protein o  93.1   0.075 1.6E-06   25.8   1.5   30   24-65     10-39  (108)
 56 TIGR02098 MJ0042_CXXC MJ0042 f  92.6    0.11 2.5E-06   20.0   1.5   34   24-63      3-36  (38)
 57 PF09986 DUF2225:  Uncharacteri  92.5   0.022 4.7E-07   30.8  -0.8   45   21-65      3-61  (214)
 58 COG1997 RPL43A Ribosomal prote  92.1   0.046 9.9E-07   25.4   0.1   32   22-64     34-65  (89)
 59 PF13717 zinc_ribbon_4:  zinc-r  92.1    0.18 3.9E-06   19.4   1.7   33   24-62      3-35  (36)
 60 COG5048 FOG: Zn-finger [Genera  90.9   0.074 1.6E-06   30.8   0.1   52    3-55    297-354 (467)
 61 COG5189 SFP1 Putative transcri  90.9   0.057 1.2E-06   31.1  -0.3   23   20-42    395-417 (423)
 62 PF05443 ROS_MUCR:  ROS/MUCR tr  90.7     0.2 4.3E-06   25.3   1.5   23   53-78     73-95  (132)
 63 PF04959 ARS2:  Arsenite-resist  90.7    0.24 5.1E-06   27.0   1.9   30   19-48     73-102 (214)
 64 COG1592 Rubrerythrin [Energy p  90.7    0.17 3.6E-06   26.5   1.3   24   22-59    133-156 (166)
 65 KOG4167|consensus               90.7   0.076 1.7E-06   33.8   0.1   26   22-47    791-816 (907)
 66 cd00729 rubredoxin_SM Rubredox  90.6    0.22 4.8E-06   18.9   1.3   25   23-60      2-26  (34)
 67 PF04959 ARS2:  Arsenite-resist  90.4    0.14 3.1E-06   27.9   0.9   26   53-78     78-103 (214)
 68 PF12013 DUF3505:  Protein of u  89.9     0.4 8.7E-06   23.1   2.2   25   53-77     81-109 (109)
 69 smart00834 CxxC_CXXC_SSSS Puta  88.7    0.12 2.6E-06   20.1  -0.1   30   23-60      5-34  (41)
 70 TIGR02605 CxxC_CxxC_SSSS putat  88.6    0.12 2.7E-06   21.4  -0.1   30   23-60      5-34  (52)
 71 smart00659 RPOLCX RNA polymera  88.5     0.5 1.1E-05   19.1   1.6   27   23-61      2-28  (44)
 72 smart00614 ZnF_BED BED zinc fi  88.3    0.64 1.4E-05   19.1   2.0    8   66-73     37-44  (50)
 73 TIGR02300 FYDLN_acid conserved  87.8    0.44 9.5E-06   23.9   1.5   30   24-65     10-39  (129)
 74 TIGR00373 conserved hypothetic  87.5    0.44 9.6E-06   24.7   1.5   38   17-64    103-140 (158)
 75 smart00734 ZnF_Rad18 Rad18-lik  87.3    0.85 1.8E-05   16.2   1.8   19   54-73      3-21  (26)
 76 PRK00398 rpoP DNA-directed RNA  86.7    0.28 6.1E-06   19.8   0.4   30   22-62      2-31  (46)
 77 smart00531 TFIIE Transcription  86.5    0.84 1.8E-05   23.3   2.2   40   19-63     95-134 (147)
 78 PRK06266 transcription initiat  85.9    0.55 1.2E-05   24.9   1.4   37   18-64    112-148 (178)
 79 PF15269 zf-C2H2_7:  Zinc-finge  85.3     0.8 1.7E-05   18.6   1.4   22   53-74     21-42  (54)
 80 KOG3408|consensus               85.2     0.9   2E-05   22.6   1.8   27   19-45     53-79  (129)
 81 PRK09678 DNA-binding transcrip  84.9    0.28   6E-06   22.1  -0.0   37   25-64      3-41  (72)
 82 cd00924 Cyt_c_Oxidase_Vb Cytoc  84.4    0.45 9.8E-06   22.7   0.6   10   53-62     80-89  (97)
 83 PRK14890 putative Zn-ribbon RN  84.0     1.3 2.8E-05   19.2   1.8   33   22-60     24-56  (59)
 84 PF02892 zf-BED:  BED zinc fing  83.3     2.1 4.6E-05   16.9   2.3   11   24-34     17-27  (45)
 85 COG3091 SprT Zn-dependent meta  81.8    0.48   1E-05   24.5   0.1   36   21-62    115-150 (156)
 86 PRK00464 nrdR transcriptional   81.7    0.23 5.1E-06   25.7  -1.0   11   53-63     29-39  (154)
 87 COG1996 RPC10 DNA-directed RNA  81.4       1 2.2E-05   18.7   1.0   29   22-61      5-33  (49)
 88 PF10013 DUF2256:  Uncharacteri  80.7     1.5 3.2E-05   17.6   1.3   14   26-39     11-24  (42)
 89 PTZ00255 60S ribosomal protein  80.5    0.49 1.1E-05   22.3  -0.1   31   22-63     35-65  (90)
 90 KOG4167|consensus               80.5    0.31 6.6E-06   31.3  -1.0   24   53-76    793-816 (907)
 91 KOG2593|consensus               80.5     1.3 2.9E-05   26.7   1.6   43   15-61    120-162 (436)
 92 TIGR00280 L37a ribosomal prote  79.6    0.49 1.1E-05   22.3  -0.2   31   22-63     34-64  (91)
 93 KOG2785|consensus               79.6     3.4 7.3E-05   24.7   2.9   52   22-73    165-241 (390)
 94 PF07754 DUF1610:  Domain of un  79.6    0.94   2E-05   15.9   0.5   10   22-31     15-24  (24)
 95 COG3364 Zn-ribbon containing p  79.5     1.1 2.4E-05   21.6   0.9   17   22-38      1-17  (112)
 96 PLN02294 cytochrome c oxidase   79.3    0.96 2.1E-05   23.9   0.7   22   14-36    133-154 (174)
 97 PF14353 CpXC:  CpXC protein     78.6     2.7 5.9E-05   20.8   2.2   12   53-64     39-50  (128)
 98 PF13878 zf-C2H2_3:  zinc-finge  76.8     3.3 7.2E-05   16.4   1.8   24   24-47     14-39  (41)
 99 PRK03824 hypA hydrogenase nick  76.5    0.93   2E-05   22.9   0.2   15   22-36     69-83  (135)
100 PHA00626 hypothetical protein   76.1     1.6 3.4E-05   18.7   0.8   16   21-36     21-36  (59)
101 COG4957 Predicted transcriptio  75.0     2.5 5.3E-05   21.6   1.4   22   53-77     77-98  (148)
102 PRK03976 rpl37ae 50S ribosomal  74.9     0.7 1.5E-05   21.8  -0.4   31   22-63     35-65  (90)
103 PF10571 UPF0547:  Uncharacteri  74.2       2 4.4E-05   15.3   0.8   11   53-63     15-25  (26)
104 KOG1842|consensus               74.1     1.9   4E-05   26.4   1.0   25   53-77     16-40  (505)
105 PF09723 Zn-ribbon_8:  Zinc rib  74.1     1.8 3.9E-05   17.1   0.7   13   53-65      6-18  (42)
106 KOG1146|consensus               73.1     3.1 6.7E-05   28.9   1.9   58   19-78   1280-1354(1406)
107 PF09845 DUF2072:  Zn-ribbon co  72.5     1.6 3.5E-05   22.0   0.5   15   23-37      1-15  (131)
108 PF09963 DUF2197:  Uncharacteri  71.1     2.2 4.7E-05   18.3   0.7   37   24-61      3-40  (56)
109 PF01215 COX5B:  Cytochrome c o  70.5     1.7 3.7E-05   22.1   0.3   22   14-36    104-125 (136)
110 COG1773 Rubredoxin [Energy pro  70.5     1.8 3.9E-05   18.5   0.3   15   23-37      3-17  (55)
111 COG5236 Uncharacterized conser  69.6     9.9 0.00021   22.8   3.2   65    7-73    200-272 (493)
112 COG2331 Uncharacterized protei  69.3       3 6.5E-05   19.1   0.9   30   23-60     12-41  (82)
113 PF08274 PhnA_Zn_Ribbon:  PhnA   67.6     3.5 7.6E-05   15.2   0.8    8   53-60     20-27  (30)
114 TIGR00100 hypA hydrogenase nic  67.4       3 6.4E-05   20.5   0.8   26   22-60     69-94  (115)
115 COG4530 Uncharacterized protei  67.2     3.6 7.8E-05   20.2   1.0   14   50-64     25-38  (129)
116 PTZ00043 cytochrome c oxidase   65.8     2.8 6.1E-05   23.3   0.5   18   20-37    178-195 (268)
117 PF13451 zf-trcl:  Probable zin  64.8     3.1 6.6E-05   17.3   0.5   17   21-37      2-18  (49)
118 PRK12380 hydrogenase nickel in  64.4     4.1 8.9E-05   20.0   0.9   26   22-60     69-94  (113)
119 COG1571 Predicted DNA-binding   63.9     5.9 0.00013   24.2   1.6   29   25-65    352-380 (421)
120 PF02176 zf-TRAF:  TRAF-type zi  63.8     4.6 9.9E-05   16.9   0.9   40   22-63      8-53  (60)
121 PF04423 Rad50_zn_hook:  Rad50   63.6     2.8 6.1E-05   17.5   0.3   13   25-37     22-34  (54)
122 smart00154 ZnF_AN1 AN1-like Zi  61.8     4.2   9E-05   15.9   0.6   14   23-36     12-25  (39)
123 PF01927 Mut7-C:  Mut7-C RNAse   61.6     8.6 0.00019   19.7   1.8   47   24-71     92-143 (147)
124 KOG4727|consensus               61.6     4.8  0.0001   21.4   0.9   22   23-44     75-96  (193)
125 COG3357 Predicted transcriptio  61.2     3.2   7E-05   19.6   0.2   32   21-63     56-87  (97)
126 COG5112 UFD2 U1-like Zn-finger  60.9     6.5 0.00014   19.2   1.2   25   20-44     52-76  (126)
127 PF08790 zf-LYAR:  LYAR-type C2  60.8     1.6 3.4E-05   15.9  -0.6    9   25-33      2-10  (28)
128 COG4391 Uncharacterized protei  60.4       3 6.4E-05   18.2   0.0   45   14-63     15-59  (62)
129 PF07975 C1_4:  TFIIH C1-like d  59.0     1.2 2.5E-05   18.7  -1.3   25   21-45     19-43  (51)
130 KOG0717|consensus               59.0     7.1 0.00015   24.2   1.4   21   53-73    293-313 (508)
131 PF01428 zf-AN1:  AN1-like Zinc  58.6       4 8.6E-05   16.2   0.3   15   22-36     12-26  (43)
132 PRK00564 hypA hydrogenase nick  56.5     5.7 0.00012   19.6   0.7   14   22-35     70-83  (117)
133 KOG2231|consensus               56.5      15 0.00032   24.0   2.5   47   25-76    184-236 (669)
134 PF06397 Desulfoferrod_N:  Desu  55.5     6.1 0.00013   15.3   0.5   12   22-33      5-16  (36)
135 PRK05452 anaerobic nitric oxid  55.0     3.2   7E-05   25.5  -0.4   38   20-60    422-466 (479)
136 PF15135 UPF0515:  Uncharacteri  55.0     9.3  0.0002   21.7   1.4   12   53-64    156-167 (278)
137 PF07282 OrfB_Zn_ribbon:  Putat  54.4      12 0.00026   16.2   1.5   30   24-64     29-58  (69)
138 KOG2807|consensus               54.4      30 0.00065   20.7   3.3   55   21-76    288-369 (378)
139 KOG0978|consensus               54.3     2.9 6.2E-05   27.1  -0.7   18   53-70    679-696 (698)
140 PF13824 zf-Mss51:  Zinc-finger  54.2      11 0.00025   16.1   1.3   13   20-32     11-23  (55)
141 PRK04351 hypothetical protein;  53.4     7.7 0.00017   20.1   0.9   33   23-64    112-144 (149)
142 PF01286 XPA_N:  XPA protein N-  53.2     7.1 0.00015   14.9   0.6   12   54-65      5-16  (34)
143 cd00730 rubredoxin Rubredoxin;  53.1     5.1 0.00011   16.7   0.2   13   24-36      2-14  (50)
144 KOG4173|consensus               53.0      12 0.00025   20.8   1.5   50   25-75    108-169 (253)
145 PF10537 WAC_Acf1_DNA_bd:  ATP-  52.9      27 0.00058   16.9   3.1   36   23-60      3-38  (102)
146 PF00301 Rubredoxin:  Rubredoxi  52.6     5.7 0.00012   16.3   0.3   14   24-37      2-15  (47)
147 PF12760 Zn_Tnp_IS1595:  Transp  51.7     3.8 8.1E-05   16.5  -0.3   27   24-60     19-45  (46)
148 KOG2482|consensus               50.9      12 0.00025   22.5   1.4   22   53-74    196-217 (423)
149 TIGR00622 ssl1 transcription f  50.4      13 0.00029   18.4   1.3   49   25-76     57-105 (112)
150 PF04780 DUF629:  Protein of un  49.6      19  0.0004   22.5   2.1   23   53-75     58-80  (466)
151 PF13453 zf-TFIIB:  Transcripti  49.0      19 0.00041   14.0   1.6   21   21-41     17-37  (41)
152 PF04606 Ogr_Delta:  Ogr/Delta-  48.8     3.3 7.2E-05   16.8  -0.7   37   25-64      1-39  (47)
153 PRK00432 30S ribosomal protein  48.5      12 0.00027   15.5   1.0   10   53-62     38-47  (50)
154 COG1326 Uncharacterized archae  48.2      27 0.00059   19.1   2.4   35   23-62      6-40  (201)
155 PF06651 DUF1163:  Protein of u  47.9     8.6 0.00019   17.1   0.5   36    2-37     18-53  (70)
156 KOG2636|consensus               47.8      15 0.00032   22.8   1.5   29   16-44    394-423 (497)
157 COG3677 Transposase and inacti  47.7     8.6 0.00019   19.4   0.5   16   21-36     51-66  (129)
158 PF10263 SprT-like:  SprT-like   47.7      11 0.00023   19.2   0.9   32   23-63    123-154 (157)
159 PLN03238 probable histone acet  47.3      32  0.0007   20.1   2.7   21   53-73     49-69  (290)
160 TIGR00416 sms DNA repair prote  47.1      14  0.0003   22.8   1.4   10   23-32      7-16  (454)
161 TIGR00686 phnA alkylphosphonat  46.7      13 0.00028   18.3   1.0   11   53-63     20-30  (109)
162 KOG2071|consensus               46.4      16 0.00035   23.3   1.6   27   21-47    416-442 (579)
163 COG4338 Uncharacterized protei  46.2     6.6 0.00014   16.3  -0.0   14   26-39     15-28  (54)
164 PRK11823 DNA repair protein Ra  46.0      15 0.00032   22.6   1.4   10   23-32      7-16  (446)
165 KOG3352|consensus               45.8     8.6 0.00019   20.0   0.3   15   22-36    132-146 (153)
166 COG0846 SIR2 NAD-dependent pro  44.9      21 0.00046   20.3   1.8   38   18-60    117-154 (250)
167 PRK05978 hypothetical protein;  44.7     7.5 0.00016   20.2   0.0   31   24-64     34-64  (148)
168 PF07295 DUF1451:  Protein of u  44.5      10 0.00022   19.7   0.5   28   22-60    111-138 (146)
169 PRK03681 hypA hydrogenase nick  43.7     8.5 0.00018   18.9   0.2   13   22-34     69-81  (114)
170 COG1198 PriA Primosomal protei  43.6     6.1 0.00013   25.9  -0.4   11   50-61    474-484 (730)
171 COG1656 Uncharacterized conser  42.9      24 0.00052   18.8   1.7   47   24-71     98-149 (165)
172 PF02591 DUF164:  Putative zinc  42.8      29 0.00063   14.5   1.7   32   25-61     24-55  (56)
173 PRK14138 NAD-dependent deacety  42.6      39 0.00085   19.0   2.6   38   18-60    114-151 (244)
174 COG1655 Uncharacterized protei  42.6     3.4 7.3E-05   23.1  -1.4   31   18-48     14-44  (267)
175 COG4306 Uncharacterized protei  42.3     7.2 0.00016   19.7  -0.2   13   53-65     69-81  (160)
176 PF14369 zf-RING_3:  zinc-finge  41.1      11 0.00024   14.3   0.3   10   25-34     23-32  (35)
177 COG5152 Uncharacterized conser  40.7      16 0.00035   20.1   0.9   17   49-65    193-209 (259)
178 PRK08222 hydrogenase 4 subunit  40.7      22 0.00049   18.9   1.4   19   22-40    113-131 (181)
179 PHA02998 RNA polymerase subuni  39.7     3.7 8.1E-05   22.0  -1.5   39   23-65    143-184 (195)
180 TIGR00627 tfb4 transcription f  39.6      28  0.0006   20.2   1.8    7   54-60    271-277 (279)
181 smart00731 SprT SprT homologue  39.6      16 0.00035   18.6   0.8   32   23-62    112-143 (146)
182 PF03604 DNA_RNApol_7kD:  DNA d  39.4      20 0.00043   13.4   0.8   11   53-63      1-11  (32)
183 PRK00762 hypA hydrogenase nick  39.3      12 0.00026   18.7   0.3   33   21-60     68-100 (124)
184 PF11931 DUF3449:  Domain of un  39.2      10 0.00022   20.7   0.0   26   17-42     95-121 (196)
185 PF06524 NOA36:  NOA36 protein;  38.6      31 0.00066   20.0   1.8   16   18-33    137-152 (314)
186 KOG2907|consensus               38.6      12 0.00025   18.6   0.2   41   22-64     73-114 (116)
187 cd00065 FYVE FYVE domain; Zinc  38.2      30 0.00065   14.2   1.4   10   24-33     19-28  (57)
188 COG0068 HypF Hydrogenase matur  37.9      16 0.00034   24.1   0.7   35   20-61    147-182 (750)
189 PF03811 Zn_Tnp_IS1:  InsA N-te  37.6      28 0.00061   13.4   1.2   11   47-58     25-35  (36)
190 PF14787 zf-CCHC_5:  GAG-polypr  37.6      14  0.0003   14.3   0.3   14   25-38      4-17  (36)
191 PRK12722 transcriptional activ  37.5      24 0.00051   19.2   1.2   28   24-60    135-162 (187)
192 PF14690 zf-ISL3:  zinc-finger   37.5      15 0.00033   14.5   0.4    9   23-31      2-10  (47)
193 PRK12860 transcriptional activ  37.4      22 0.00048   19.4   1.1   28   23-59    134-161 (189)
194 COG0675 Transposase and inacti  37.1      21 0.00045   20.4   1.1   12   53-64    323-334 (364)
195 KOG0317|consensus               37.0      21 0.00046   20.8   1.0   32   25-63    253-284 (293)
196 cd01121 Sms Sms (bacterial rad  36.8      23 0.00049   21.3   1.2    9   23-31     14-22  (372)
197 KOG1280|consensus               36.4      49  0.0011   20.0   2.4   43   18-60     74-117 (381)
198 PF12230 PRP21_like_P:  Pre-mRN  36.1      12 0.00026   20.6   0.0   24   53-77    169-192 (229)
199 PF10071 DUF2310:  Zn-ribbon-co  35.9      16 0.00034   20.9   0.4   32   20-59    217-248 (258)
200 PF10276 zf-CHCC:  Zinc-finger   35.2      19 0.00041   14.3   0.5   12   22-33     28-39  (40)
201 cd00974 DSRD Desulforedoxin (D  35.1      20 0.00043   13.3   0.6   11   23-33      4-14  (34)
202 PF05191 ADK_lid:  Adenylate ki  34.8      20 0.00043   13.7   0.5   11   53-63      2-12  (36)
203 COG1779 C4-type Zn-finger prot  34.7     6.7 0.00014   21.4  -1.0   39   23-64     14-55  (201)
204 PF02891 zf-MIZ:  MIZ/SP-RING z  34.4      25 0.00055   14.5   0.8   23   33-60     27-49  (50)
205 smart00064 FYVE Protein presen  34.2      32 0.00069   14.8   1.2   12   24-35     11-22  (68)
206 TIGR00319 desulf_FeS4 desulfof  34.1      21 0.00046   13.2   0.6   12   22-33      6-17  (34)
207 smart00440 ZnF_C2C2 C2C2 Zinc   33.7      29 0.00064   13.5   0.9   10   53-62     29-38  (40)
208 PF12907 zf-met2:  Zinc-binding  33.6     8.9 0.00019   15.2  -0.6    8   54-61      3-10  (40)
209 PTZ00448 hypothetical protein;  33.3      37  0.0008   20.6   1.6   22   53-74    315-336 (373)
210 PTZ00064 histone acetyltransfe  33.3      50  0.0011   21.1   2.2   22   53-74    281-302 (552)
211 PF05876 Terminase_GpA:  Phage   33.3      11 0.00025   23.8  -0.4   37   24-64    201-241 (557)
212 TIGR01384 TFS_arch transcripti  33.1      28  0.0006   16.5   1.0   12   23-34     16-27  (104)
213 COG4896 Uncharacterized protei  32.9      29 0.00062   15.3   0.9    7   53-59     32-38  (68)
214 TIGR01206 lysW lysine biosynth  32.7      17 0.00037   15.4   0.2   31   23-62      2-32  (54)
215 PLN00104 MYST -like histone ac  32.3      45 0.00098   20.9   1.9   22   53-74    199-220 (450)
216 KOG3214|consensus               32.0      24 0.00051   17.2   0.6   41   20-65     20-60  (109)
217 PF01096 TFIIS_C:  Transcriptio  31.8      25 0.00054   13.6   0.6   10   53-62     29-38  (39)
218 cd01413 SIR2_Af2 SIR2_Af2: Arc  31.8      62  0.0013   17.9   2.3   37   18-60    108-144 (222)
219 PF01780 Ribosomal_L37ae:  Ribo  30.6      24 0.00053   16.8   0.5   31   22-63     34-64  (90)
220 PLN02925 4-hydroxy-3-methylbut  29.7      70  0.0015   21.4   2.4   29   53-81    635-663 (733)
221 COG2879 Uncharacterized small   29.7      62  0.0014   14.3   2.0   17   64-80     24-40  (65)
222 PF11789 zf-Nse:  Zinc-finger o  29.6      44 0.00096   14.2   1.2   17   21-37     22-38  (57)
223 PLN02748 tRNA dimethylallyltra  29.6      51  0.0011   20.7   1.9   21   53-73    419-440 (468)
224 PF03884 DUF329:  Domain of unk  29.5      25 0.00054   15.2   0.4   12   24-35      3-14  (57)
225 PF08273 Prim_Zn_Ribbon:  Zinc-  28.3      24 0.00053   13.9   0.3   10   22-31      2-11  (40)
226 TIGR03829 YokU_near_AblA uncha  27.4      61  0.0013   15.4   1.5   18   50-67     33-50  (89)
227 PRK06260 threonine synthase; V  27.2      36 0.00078   20.5   1.0   14   23-36     19-32  (397)
228 PF11672 DUF3268:  Protein of u  26.4      24 0.00051   17.2   0.1    9   23-31      2-10  (102)
229 KOG0227|consensus               26.4      51  0.0011   18.2   1.3   27   15-43     47-73  (222)
230 KOG0782|consensus               26.3      11 0.00024   24.3  -1.2   27   11-37    241-267 (1004)
231 PRK01343 zinc-binding protein;  26.2      52  0.0011   14.2   1.1   12   23-34      9-20  (57)
232 KOG0562|consensus               26.1      80  0.0017   17.1   1.9   21   24-44    154-174 (184)
233 KOG3014|consensus               26.1      55  0.0012   18.8   1.4   31   17-47     28-63  (257)
234 COG1379 PHP family phosphoeste  26.0      27 0.00058   21.0   0.3   10   53-62    266-275 (403)
235 PRK05580 primosome assembly pr  26.0      15 0.00032   23.9  -0.8    9   53-61    422-430 (679)
236 PF02146 SIR2:  Sir2 family;  I  25.9      52  0.0011   17.3   1.3   39   18-61    100-138 (178)
237 PF12773 DZR:  Double zinc ribb  25.9      43 0.00094   13.4   0.9    9   53-61     30-38  (50)
238 PF05766 NinG:  Bacteriophage L  25.8      20 0.00042   19.5  -0.2   13   23-35      6-18  (189)
239 PF14446 Prok-RING_1:  Prokaryo  25.2      29 0.00063   14.8   0.3   13   24-36      6-18  (54)
240 COG4888 Uncharacterized Zn rib  25.0      38 0.00083   16.5   0.7   39   20-63     19-57  (104)
241 COG5188 PRP9 Splicing factor 3  25.0      50  0.0011   20.1   1.2   24   22-45    237-260 (470)
242 PLN03239 histone acetyltransfe  24.9      60  0.0013   19.6   1.5   24   50-74    105-128 (351)
243 TIGR01385 TFSII transcription   24.9     9.9 0.00021   22.1  -1.5   39   22-63    257-297 (299)
244 KOG0801|consensus               24.9      32 0.00069   18.4   0.4   19   11-32    129-147 (205)
245 PF04438 zf-HIT:  HIT zinc fing  24.7      45 0.00097   12.2   0.7   12   23-34     13-24  (30)
246 PF05180 zf-DNL:  DNL zinc fing  24.5     5.2 0.00011   17.8  -2.1   34   23-60      4-37  (66)
247 KOG2747|consensus               24.5      54  0.0012   20.2   1.3   23   53-75    159-181 (396)
248 PF08271 TF_Zn_Ribbon:  TFIIB z  24.4      49  0.0011   12.9   0.9    7   54-60      2-8   (43)
249 PF14311 DUF4379:  Domain of un  24.1      46   0.001   13.8   0.8   13   53-65     29-41  (55)
250 smart00132 LIM Zinc-binding do  23.6      33 0.00072   12.3   0.3   11   23-33     27-37  (39)
251 PF06170 DUF983:  Protein of un  23.4      35 0.00075   16.0   0.4   11   25-35     10-20  (86)
252 PRK12387 formate hydrogenlyase  23.4      45 0.00098   17.7   0.8   18   22-39    113-130 (180)
253 PRK00481 NAD-dependent deacety  23.3      92   0.002   17.4   2.0   35   17-60    116-150 (242)
254 PF05741 zf-nanos:  Nanos RNA b  23.0      36 0.00077   14.6   0.3   11   22-32     32-42  (55)
255 KOG2857|consensus               23.0      38 0.00083   17.6   0.5   23   22-44     16-38  (157)
256 PRK14892 putative transcriptio  23.0      36 0.00078   16.5   0.4   36   21-64     19-54  (99)
257 TIGR03831 YgiT_finger YgiT-typ  22.7      45 0.00097   12.8   0.6    9   53-61     33-41  (46)
258 PF04810 zf-Sec23_Sec24:  Sec23  22.7      67  0.0014   12.4   1.1   31   23-60      2-32  (40)
259 PF09943 DUF2175:  Uncharacteri  22.7      33 0.00071   16.7   0.2    9   53-61      3-11  (101)
260 COG4847 Uncharacterized protei  22.6      31 0.00067   16.6   0.1   11   22-32      5-15  (103)
261 PF11023 DUF2614:  Protein of u  22.6      83  0.0018   15.7   1.6   11   22-32     68-78  (114)
262 COG3024 Uncharacterized protei  22.6      36 0.00078   15.1   0.3   13   23-35      7-19  (65)
263 cd01407 SIR2-fam SIR2 family o  22.5 1.2E+02  0.0026   16.6   2.3   39   17-60    103-141 (218)
264 smart00661 RPOL9 RNA polymeras  22.4      42 0.00091   13.4   0.5   14   23-36     20-33  (52)
265 PF03107 C1_2:  C1 domain;  Int  22.4      55  0.0012   11.7   0.8    7   54-60      2-8   (30)
266 PF02148 zf-UBP:  Zn-finger in   22.4      37 0.00079   14.6   0.3   16   21-36      9-24  (63)
267 COG1998 RPS31 Ribosomal protei  22.2      66  0.0014   13.5   1.0    9   53-61     38-46  (51)
268 COG1675 TFA1 Transcription ini  22.1      22 0.00048   19.1  -0.5   34   19-62    109-142 (176)
269 TIGR00244 transcriptional regu  22.1      44 0.00096   17.5   0.6   12   53-64     29-40  (147)
270 PF10164 DUF2367:  Uncharacteri  22.0      41  0.0009   16.3   0.5   10   23-32     88-97  (98)
271 PRK11032 hypothetical protein;  21.9      68  0.0015   17.0   1.3   28   22-60    123-150 (160)
272 PF09855 DUF2082:  Nucleic-acid  21.6      45 0.00098   14.7   0.5    7   53-59      1-7   (64)
273 PF08792 A2L_zn_ribbon:  A2L zi  21.5      53  0.0011   12.3   0.6   10   53-62     22-31  (33)
274 cd04476 RPA1_DBD_C RPA1_DBD_C:  21.3      61  0.0013   16.8   1.1   10   53-62     52-61  (166)
275 KOG0954|consensus               20.7      47   0.001   22.4   0.6   31    2-32    287-321 (893)
276 PF03966 Trm112p:  Trm112p-like  20.6      53  0.0012   14.3   0.7   17   18-34     48-64  (68)
277 PF10083 DUF2321:  Uncharacteri  20.5      47   0.001   17.6   0.5   19   21-39     66-84  (158)
278 KOG4118|consensus               20.3      61  0.0013   14.5   0.8   22   53-74     39-60  (74)
279 PF05207 zf-CSL:  CSL zinc fing  20.0      39 0.00084   14.3   0.1   30   23-59     18-47  (55)

No 1  
>KOG2462|consensus
Probab=99.87  E-value=3.7e-23  Score=109.96  Aligned_cols=71  Identities=20%  Similarity=0.376  Sum_probs=56.1

Q ss_pred             ccccccccchhcccccccCCCceecCcchhhccCchHHHHHHHhhcCCCCCeecCCCCcccCCchHHHHHHH
Q psy12029          2 ELQLLVPFYFQITESSYFADRLFSCSGCARVYKNKKSLARHQTYECGQEPQYFCPLCPYRAKQKTNLMTHMS   73 (81)
Q Consensus         2 ~~~f~~~~~l~~~~~~~~~~~~~~C~~c~~~~~~~~~l~~h~~~~~~~~~~~~c~~c~~~f~~~~~l~~h~~   73 (81)
                      .+.|+++.-|+.|.++|+|||||.|..|++.|.++++|..||.+|.+.++ |.|..|+|+|...+.|+.|..
T Consensus       194 GKaFSRPWLLQGHiRTHTGEKPF~C~hC~kAFADRSNLRAHmQTHS~~K~-~qC~~C~KsFsl~SyLnKH~E  264 (279)
T KOG2462|consen  194 GKAFSRPWLLQGHIRTHTGEKPFSCPHCGKAFADRSNLRAHMQTHSDVKK-HQCPRCGKSFALKSYLNKHSE  264 (279)
T ss_pred             cccccchHHhhcccccccCCCCccCCcccchhcchHHHHHHHHhhcCCcc-ccCcchhhHHHHHHHHHHhhh
Confidence            35677777788888888888888888888888888888888888888777 888888888888888877754


No 2  
>KOG2462|consensus
Probab=99.86  E-value=1.1e-22  Score=108.13  Aligned_cols=76  Identities=17%  Similarity=0.309  Sum_probs=68.9

Q ss_pred             ccccccccchhcccccccCCCceecCcchhhccCchHHHHHHHhhcCCCCCeecCCCCcccCCchHHHHHHHhhcCCCC
Q psy12029          2 ELQLLVPFYFQITESSYFADRLFSCSGCARVYKNKKSLARHQTYECGQEPQYFCPLCPYRAKQKTNLMTHMSIKHSHYQ   80 (81)
Q Consensus         2 ~~~f~~~~~l~~~~~~~~~~~~~~C~~c~~~~~~~~~l~~h~~~~~~~~~~~~c~~c~~~f~~~~~l~~h~~~~~~~~~   80 (81)
                      +++|..-..|..|.++|+  -++.|.+||+.|...+-|+.|+|+|+|++| |.|..|+|.|...+||..|+++|.+.|+
T Consensus       168 ~K~YvSmpALkMHirTH~--l~c~C~iCGKaFSRPWLLQGHiRTHTGEKP-F~C~hC~kAFADRSNLRAHmQTHS~~K~  243 (279)
T KOG2462|consen  168 GKVYVSMPALKMHIRTHT--LPCECGICGKAFSRPWLLQGHIRTHTGEKP-FSCPHCGKAFADRSNLRAHMQTHSDVKK  243 (279)
T ss_pred             CceeeehHHHhhHhhccC--CCcccccccccccchHHhhcccccccCCCC-ccCCcccchhcchHHHHHHHHhhcCCcc
Confidence            355666667888999887  489999999999999999999999999999 9999999999999999999999998764


No 3  
>KOG3623|consensus
Probab=99.63  E-value=7.4e-17  Score=95.44  Aligned_cols=71  Identities=20%  Similarity=0.427  Sum_probs=62.4

Q ss_pred             ccccccccchhcccccccCCCceecCcchhhccCchHHHHHHHhhcCCCCCeecCCCCcccCCchHHHHHHH
Q psy12029          2 ELQLLVPFYFQITESSYFADRLFSCSGCARVYKNKKSLARHQTYECGQEPQYFCPLCPYRAKQKTNLMTHMS   73 (81)
Q Consensus         2 ~~~f~~~~~l~~~~~~~~~~~~~~C~~c~~~~~~~~~l~~h~~~~~~~~~~~~c~~c~~~f~~~~~l~~h~~   73 (81)
                      ++.|...++|.+|.--|+|.+||.|.+|.+.|..+-.|+-|.|.|.|++| |.|..|+|.|..+..+..|+.
T Consensus       901 DK~FqKqSSLaRHKYEHsGqRPyqC~iCkKAFKHKHHLtEHkRLHSGEKP-fQCdKClKRFSHSGSYSQHMN  971 (1007)
T KOG3623|consen  901 DKAFQKQSSLARHKYEHSGQRPYQCIICKKAFKHKHHLTEHKRLHSGEKP-FQCDKCLKRFSHSGSYSQHMN  971 (1007)
T ss_pred             HHHHHhhHHHHHhhhhhcCCCCcccchhhHhhhhhhhhhhhhhhccCCCc-chhhhhhhhcccccchHhhhc
Confidence            36777788889998889999999999999999999999999999999999 999999999998888887764


No 4  
>KOG3576|consensus
Probab=99.57  E-value=1.6e-16  Score=82.21  Aligned_cols=74  Identities=20%  Similarity=0.361  Sum_probs=60.8

Q ss_pred             cccccccchhcccccccCCCceecCcchhhccCchHHHHHHHhhcCCCCCeecCCCCcccCCchHHHHHHHhhcC
Q psy12029          3 LQLLVPFYFQITESSYFADRLFSCSGCARVYKNKKSLARHQTYECGQEPQYFCPLCPYRAKQKTNLMTHMSIKHS   77 (81)
Q Consensus         3 ~~f~~~~~l~~~~~~~~~~~~~~C~~c~~~~~~~~~l~~h~~~~~~~~~~~~c~~c~~~f~~~~~l~~h~~~~~~   77 (81)
                      +.|....-|.+|++.|...+.+.|.-||+.|...-+|.+|.++|+|.+| |+|..|++.|.+...|..|.+.-+|
T Consensus       125 K~F~lQRmlnrh~kch~~vkr~lct~cgkgfndtfdlkrh~rthtgvrp-ykc~~c~kaftqrcsleshl~kvhg  198 (267)
T KOG3576|consen  125 KKFGLQRMLNRHLKCHSDVKRHLCTFCGKGFNDTFDLKRHTRTHTGVRP-YKCSLCEKAFTQRCSLESHLKKVHG  198 (267)
T ss_pred             hhhhHHHHHHHHhhhccHHHHHHHhhccCcccchhhhhhhhccccCccc-cchhhhhHHHHhhccHHHHHHHHcC
Confidence            3455556677888888888888898899988888888889889988888 8998899888888888888775544


No 5  
>KOG3623|consensus
Probab=99.46  E-value=2.5e-14  Score=85.07  Aligned_cols=61  Identities=30%  Similarity=0.652  Sum_probs=57.8

Q ss_pred             cCCCceecCcchhhccCchHHHHHHHhhcCCCCCeecCCCCcccCCchHHHHHHHhhcCCCC
Q psy12029         19 FADRLFSCSGCARVYKNKKSLARHQTYECGQEPQYFCPLCPYRAKQKTNLMTHMSIKHSHYQ   80 (81)
Q Consensus        19 ~~~~~~~C~~c~~~~~~~~~l~~h~~~~~~~~~~~~c~~c~~~f~~~~~l~~h~~~~~~~~~   80 (81)
                      +.+..|.|+.|++.|.-.++|.+|.--|+|.+| |.|.+|.|.|..+..|..|+|.|.||||
T Consensus       890 te~gmyaCDqCDK~FqKqSSLaRHKYEHsGqRP-yqC~iCkKAFKHKHHLtEHkRLHSGEKP  950 (1007)
T KOG3623|consen  890 TEDGMYACDQCDKAFQKQSSLARHKYEHSGQRP-YQCIICKKAFKHKHHLTEHKRLHSGEKP  950 (1007)
T ss_pred             CccccchHHHHHHHHHhhHHHHHhhhhhcCCCC-cccchhhHhhhhhhhhhhhhhhccCCCc
Confidence            345679999999999999999999999999999 9999999999999999999999999997


No 6  
>KOG1074|consensus
Probab=99.39  E-value=3.2e-14  Score=85.30  Aligned_cols=76  Identities=25%  Similarity=0.489  Sum_probs=62.9

Q ss_pred             cccccccchhcccccccCCCceecCcchhhccCchHHHHHHHhhcCCCC---CeecC---CCCcccCCchHHHHHHHhhc
Q psy12029          3 LQLLVPFYFQITESSYFADRLFSCSGCARVYKNKKSLARHQTYECGQEP---QYFCP---LCPYRAKQKTNLMTHMSIKH   76 (81)
Q Consensus         3 ~~f~~~~~l~~~~~~~~~~~~~~C~~c~~~~~~~~~l~~h~~~~~~~~~---~~~c~---~c~~~f~~~~~l~~h~~~~~   76 (81)
                      ++.+.++.|+.|.++|+|++||+|++||+.|..+.+|..|+..|....+   .+.|+   +|-+.|...-.+..|+++|.
T Consensus       613 rVlSC~saLqmHyrtHtGERPFkCKiCgRAFtTkGNLkaH~~vHka~p~~R~q~ScP~~~ic~~kftn~V~lpQhIriH~  692 (958)
T KOG1074|consen  613 RVLSCPSALQMHYRTHTGERPFKCKICGRAFTTKGNLKAHMSVHKAKPPARVQFSCPSTFICQKKFTNAVTLPQHIRIHL  692 (958)
T ss_pred             ecccchhhhhhhhhcccCcCccccccccchhccccchhhcccccccCccccccccCCchhhhcccccccccccceEEeec
Confidence            3566788899999999999999999999999999999999988765422   16677   78888888888888999888


Q ss_pred             CC
Q psy12029         77 SH   78 (81)
Q Consensus        77 ~~   78 (81)
                      +.
T Consensus       693 ~~  694 (958)
T KOG1074|consen  693 GG  694 (958)
T ss_pred             CC
Confidence            43


No 7  
>PHA02768 hypothetical protein; Provisional
Probab=99.38  E-value=1.9e-13  Score=57.43  Aligned_cols=44  Identities=16%  Similarity=0.320  Sum_probs=39.4

Q ss_pred             ceecCcchhhccCchHHHHHHHhhcCCCCCeecCCCCcccCCchHHH
Q psy12029         23 LFSCSGCARVYKNKKSLARHQTYECGQEPQYFCPLCPYRAKQKTNLM   69 (81)
Q Consensus        23 ~~~C~~c~~~~~~~~~l~~h~~~~~~~~~~~~c~~c~~~f~~~~~l~   69 (81)
                      -|.|+.||+.|.....|..|+++|+  ++ ++|..|++.|...+.|.
T Consensus         5 ~y~C~~CGK~Fs~~~~L~~H~r~H~--k~-~kc~~C~k~f~~~s~l~   48 (55)
T PHA02768          5 GYECPICGEIYIKRKSMITHLRKHN--TN-LKLSNCKRISLRTGEYI   48 (55)
T ss_pred             ccCcchhCCeeccHHHHHHHHHhcC--Cc-ccCCcccceecccceeE
Confidence            3789999999999999999999998  57 99999999999877664


No 8  
>KOG3576|consensus
Probab=99.35  E-value=7.9e-13  Score=68.78  Aligned_cols=76  Identities=20%  Similarity=0.389  Sum_probs=64.7

Q ss_pred             cccccccchhcccccccCCCceecCcchhhccCchHHHHHHHhhcC-----------CCCCeecCCCCcccCCchHHHHH
Q psy12029          3 LQLLVPFYFQITESSYFADRLFSCSGCARVYKNKKSLARHQTYECG-----------QEPQYFCPLCPYRAKQKTNLMTH   71 (81)
Q Consensus         3 ~~f~~~~~l~~~~~~~~~~~~~~C~~c~~~~~~~~~l~~h~~~~~~-----------~~~~~~c~~c~~~f~~~~~l~~h   71 (81)
                      +-|....+|.+|+++|+|.+||.|..|++.|....+|..|.+.-+|           .+. |.|..||.+-.....+..|
T Consensus       153 kgfndtfdlkrh~rthtgvrpykc~~c~kaftqrcsleshl~kvhgv~~~yaykerr~kl-~vcedcg~t~~~~e~~~~h  231 (267)
T KOG3576|consen  153 KGFNDTFDLKRHTRTHTGVRPYKCSLCEKAFTQRCSLESHLKKVHGVQHQYAYKERRAKL-YVCEDCGYTSERPEVYYLH  231 (267)
T ss_pred             CcccchhhhhhhhccccCccccchhhhhHHHHhhccHHHHHHHHcCchHHHHHHHhhhhe-eeecccCCCCCChhHHHHH
Confidence            4577788899999999999999999999999999999999875444           345 8999999998888888888


Q ss_pred             HHhhcCCC
Q psy12029         72 MSIKHSHY   79 (81)
Q Consensus        72 ~~~~~~~~   79 (81)
                      ...++..-
T Consensus       232 ~~~~hp~S  239 (267)
T KOG3576|consen  232 LKLHHPFS  239 (267)
T ss_pred             HHhcCCCC
Confidence            88877543


No 9  
>PHA00733 hypothetical protein
Probab=99.33  E-value=3.1e-12  Score=62.99  Aligned_cols=63  Identities=22%  Similarity=0.442  Sum_probs=52.7

Q ss_pred             hhcccccccCCCceecCcchhhccCchHHHHHHHhhcCCCCCeecCCCCcccCCchHHHHHHHhhcC
Q psy12029         11 FQITESSYFADRLFSCSGCARVYKNKKSLARHQTYECGQEPQYFCPLCPYRAKQKTNLMTHMSIKHS   77 (81)
Q Consensus        11 l~~~~~~~~~~~~~~C~~c~~~~~~~~~l~~h~~~~~~~~~~~~c~~c~~~f~~~~~l~~h~~~~~~   77 (81)
                      |..++.++ +.+||.|..|++.|.....|..|++.+  ..+ +.|..|++.|.....|..|+...|+
T Consensus        62 l~~~~~~~-~~kPy~C~~Cgk~Fss~s~L~~H~r~h--~~~-~~C~~CgK~F~~~~sL~~H~~~~h~  124 (128)
T PHA00733         62 LYKLLTSK-AVSPYVCPLCLMPFSSSVSLKQHIRYT--EHS-KVCPVCGKEFRNTDSTLDHVCKKHN  124 (128)
T ss_pred             HHhhcccC-CCCCccCCCCCCcCCCHHHHHHHHhcC--CcC-ccCCCCCCccCCHHHHHHHHHHhcC
Confidence            44444443 578999999999999999999999865  356 9999999999999999999987764


No 10 
>KOG1074|consensus
Probab=99.26  E-value=1.2e-12  Score=78.89  Aligned_cols=57  Identities=28%  Similarity=0.585  Sum_probs=52.4

Q ss_pred             ceecCcchhhccCchHHHHHHHhhcCCCCCeecCCCCcccCCchHHHHHHHhhcCCCC
Q psy12029         23 LFSCSGCARVYKNKKSLARHQTYECGQEPQYFCPLCPYRAKQKTNLMTHMSIKHSHYQ   80 (81)
Q Consensus        23 ~~~C~~c~~~~~~~~~l~~h~~~~~~~~~~~~c~~c~~~f~~~~~l~~h~~~~~~~~~   80 (81)
                      .+.|..|++.|...+.|..|.|+|+|++| |+|++||..|..+.+|..|...|+-.+|
T Consensus       353 khkCr~CakvfgS~SaLqiHlRSHTGERP-fqCnvCG~~FSTkGNLKvH~~rH~e~~p  409 (958)
T KOG1074|consen  353 KHKCRFCAKVFGSDSALQIHLRSHTGERP-FQCNVCGNRFSTKGNLKVHFQRHREKYP  409 (958)
T ss_pred             cchhhhhHhhcCchhhhhhhhhccCCCCC-eeecccccccccccceeeeeeeccccCC
Confidence            46799999999999999999999999999 9999999999999999999888876553


No 11 
>PF13465 zf-H2C2_2:  Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A ....
Probab=99.09  E-value=1.5e-10  Score=42.09  Aligned_cols=24  Identities=38%  Similarity=0.791  Sum_probs=15.9

Q ss_pred             HHHHHHhhcCCCCCeecCCCCcccC
Q psy12029         39 LARHQTYECGQEPQYFCPLCPYRAK   63 (81)
Q Consensus        39 l~~h~~~~~~~~~~~~c~~c~~~f~   63 (81)
                      |..|++.|++++| |.|..|++.|.
T Consensus         2 l~~H~~~H~~~k~-~~C~~C~k~F~   25 (26)
T PF13465_consen    2 LRRHMRTHTGEKP-YKCPYCGKSFS   25 (26)
T ss_dssp             HHHHHHHHSSSSS-EEESSSSEEES
T ss_pred             HHHHhhhcCCCCC-CCCCCCcCeeC
Confidence            5566666666666 77777766664


No 12 
>PF13465 zf-H2C2_2:  Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A ....
Probab=99.07  E-value=2.4e-11  Score=44.27  Aligned_cols=25  Identities=8%  Similarity=0.400  Sum_probs=22.9

Q ss_pred             chhcccccccCCCceecCcchhhcc
Q psy12029         10 YFQITESSYFADRLFSCSGCARVYK   34 (81)
Q Consensus        10 ~l~~~~~~~~~~~~~~C~~c~~~~~   34 (81)
                      +|..|+++|++++||.|+.|++.|.
T Consensus         1 ~l~~H~~~H~~~k~~~C~~C~k~F~   25 (26)
T PF13465_consen    1 NLRRHMRTHTGEKPYKCPYCGKSFS   25 (26)
T ss_dssp             HHHHHHHHHSSSSSEEESSSSEEES
T ss_pred             CHHHHhhhcCCCCCCCCCCCcCeeC
Confidence            4788999999999999999999885


No 13 
>KOG3993|consensus
Probab=98.99  E-value=1.3e-10  Score=65.97  Aligned_cols=72  Identities=15%  Similarity=0.339  Sum_probs=59.1

Q ss_pred             cccccchhcccccccCCCceecCcchhhccCchHHHHHHHhhcC--------CC-------------------------C
Q psy12029          5 LLVPFYFQITESSYFADRLFSCSGCARVYKNKKSLARHQTYECG--------QE-------------------------P   51 (81)
Q Consensus         5 f~~~~~l~~~~~~~~~~~~~~C~~c~~~~~~~~~l~~h~~~~~~--------~~-------------------------~   51 (81)
                      |-....|..|...-.....|+|++|+++|....+|..|.|+|.-        ..                         .
T Consensus       277 YeD~F~LAQHrC~RIV~vEYrCPEC~KVFsCPANLASHRRWHKPR~eaa~a~~~P~k~~~~~rae~~ea~rsg~dss~gi  356 (500)
T KOG3993|consen  277 YEDAFALAQHRCPRIVHVEYRCPECDKVFSCPANLASHRRWHKPRPEAAKAGSPPPKQAVETRAEVQEAERSGDDSSSGI  356 (500)
T ss_pred             hhhHHHHhhccCCeeEEeeecCCcccccccCchhhhhhhcccCCchhhhhcCCCChhhhhhhhhhhhhccccCCcccCce
Confidence            44555677787766666779999999999999999999999841        11                         2


Q ss_pred             CeecCCCCcccCCchHHHHHHHhhcC
Q psy12029         52 QYFCPLCPYRAKQKTNLMTHMSIKHS   77 (81)
Q Consensus        52 ~~~c~~c~~~f~~~~~l~~h~~~~~~   77 (81)
                       |.|..|++.|.....|..|+.+|+.
T Consensus       357 -~~C~~C~KkFrRqAYLrKHqlthq~  381 (500)
T KOG3993|consen  357 -FSCHTCGKKFRRQAYLRKHQLTHQR  381 (500)
T ss_pred             -eecHHhhhhhHHHHHHHHhHHhhhc
Confidence             7899999999999999999888774


No 14 
>PHA00616 hypothetical protein
Probab=98.92  E-value=7.9e-10  Score=44.55  Aligned_cols=34  Identities=18%  Similarity=0.422  Sum_probs=29.0

Q ss_pred             ceecCcchhhccCchHHHHHHHhhcCCCCCeecCC
Q psy12029         23 LFSCSGCARVYKNKKSLARHQTYECGQEPQYFCPL   57 (81)
Q Consensus        23 ~~~C~~c~~~~~~~~~l~~h~~~~~~~~~~~~c~~   57 (81)
                      ||.|..||+.|...+.+..|++.++++++ +.|+.
T Consensus         1 pYqC~~CG~~F~~~s~l~~H~r~~hg~~~-~~~~~   34 (44)
T PHA00616          1 MYQCLRCGGIFRKKKEVIEHLLSVHKQNK-LTLEY   34 (44)
T ss_pred             CCccchhhHHHhhHHHHHHHHHHhcCCCc-cceeE
Confidence            57899999999999999999999999888 77653


No 15 
>KOG3608|consensus
Probab=98.91  E-value=3.1e-10  Score=63.46  Aligned_cols=69  Identities=14%  Similarity=0.356  Sum_probs=50.9

Q ss_pred             ccccccchhcccccccCCCceecCcchhhccCchHHHHHHHhhcC--CCCCeecCCCCcccCCchHHHHHHH
Q psy12029          4 QLLVPFYFQITESSYFADRLFSCSGCARVYKNKKSLARHQTYECG--QEPQYFCPLCPYRAKQKTNLMTHMS   73 (81)
Q Consensus         4 ~f~~~~~l~~~~~~~~~~~~~~C~~c~~~~~~~~~l~~h~~~~~~--~~~~~~c~~c~~~f~~~~~l~~h~~   73 (81)
                      .|..++.|..|.++|+++|...|+.||..|.....|..|.+..+.  ..+ |.|..|-+.|.....|..|+.
T Consensus       188 ~~~~k~~LreH~r~Hs~eKvvACp~Cg~~F~~~tkl~DH~rRqt~l~~n~-fqC~~C~KrFaTeklL~~Hv~  258 (467)
T KOG3608|consen  188 HMGNKYRLREHIRTHSNEKVVACPHCGELFRTKTKLFDHLRRQTELNTNS-FQCAQCFKRFATEKLLKSHVV  258 (467)
T ss_pred             hhccHHHHHHHHHhcCCCeEEecchHHHHhccccHHHHHHHhhhhhcCCc-hHHHHHHHHHhHHHHHHHHHH
Confidence            467788899999999999999999999999999999999886543  334 555555544444444444433


No 16 
>KOG3608|consensus
Probab=98.90  E-value=9.4e-10  Score=61.61  Aligned_cols=70  Identities=17%  Similarity=0.411  Sum_probs=39.7

Q ss_pred             ccccccchhcccccccCCCceecCcchhhccCchHHHHHHHh-hcCCCCCeecCCCCcccCCchHHHHHHHhhc
Q psy12029          4 QLLVPFYFQITESSYFADRLFSCSGCARVYKNKKSLARHQTY-ECGQEPQYFCPLCPYRAKQKTNLMTHMSIKH   76 (81)
Q Consensus         4 ~f~~~~~l~~~~~~~~~~~~~~C~~c~~~~~~~~~l~~h~~~-~~~~~~~~~c~~c~~~f~~~~~l~~h~~~~~   76 (81)
                      +|.+.-.|..|+..|..  .|.|+.|+......++|..|++. |...+| |+|..|.+.+...+.|+.|..+|.
T Consensus       246 rFaTeklL~~Hv~rHvn--~ykCplCdmtc~~~ssL~~H~r~rHs~dkp-fKCd~Cd~~c~~esdL~kH~~~HS  316 (467)
T KOG3608|consen  246 RFATEKLLKSHVVRHVN--CYKCPLCDMTCSSASSLTTHIRYRHSKDKP-FKCDECDTRCVRESDLAKHVQVHS  316 (467)
T ss_pred             HHhHHHHHHHHHHHhhh--cccccccccCCCChHHHHHHHHhhhccCCC-ccccchhhhhccHHHHHHHHHhcc
Confidence            44444455555555443  35566666666666666666663 444455 666666666666666666655443


No 17 
>PHA00616 hypothetical protein
Probab=98.75  E-value=5.2e-09  Score=42.19  Aligned_cols=28  Identities=21%  Similarity=0.437  Sum_probs=26.8

Q ss_pred             eecCCCCcccCCchHHHHHHHhhcCCCC
Q psy12029         53 YFCPLCPYRAKQKTNLMTHMSIKHSHYQ   80 (81)
Q Consensus        53 ~~c~~c~~~f~~~~~l~~h~~~~~~~~~   80 (81)
                      |.|..||+.|...+++..|++.+||+++
T Consensus         2 YqC~~CG~~F~~~s~l~~H~r~~hg~~~   29 (44)
T PHA00616          2 YQCLRCGGIFRKKKEVIEHLLSVHKQNK   29 (44)
T ss_pred             CccchhhHHHhhHHHHHHHHHHhcCCCc
Confidence            8999999999999999999999999875


No 18 
>PHA00732 hypothetical protein
Probab=98.74  E-value=9e-09  Score=46.80  Aligned_cols=45  Identities=22%  Similarity=0.422  Sum_probs=36.2

Q ss_pred             ceecCcchhhccCchHHHHHHHh-hcCCCCCeecCCCCcccCCchHHHHHHHh
Q psy12029         23 LFSCSGCARVYKNKKSLARHQTY-ECGQEPQYFCPLCPYRAKQKTNLMTHMSI   74 (81)
Q Consensus        23 ~~~C~~c~~~~~~~~~l~~h~~~-~~~~~~~~~c~~c~~~f~~~~~l~~h~~~   74 (81)
                      ||.|..|++.|.....|..|++. |.   + +.|..|++.|.+   +..|.++
T Consensus         1 py~C~~Cgk~F~s~s~Lk~H~r~~H~---~-~~C~~CgKsF~~---l~~H~~~   46 (79)
T PHA00732          1 MFKCPICGFTTVTLFALKQHARRNHT---L-TKCPVCNKSYRR---LNQHFYS   46 (79)
T ss_pred             CccCCCCCCccCCHHHHHHHhhcccC---C-CccCCCCCEeCC---hhhhhcc
Confidence            57899999999999999999884 43   4 789999999874   5566643


No 19 
>PHA02768 hypothetical protein; Provisional
Probab=98.48  E-value=1.2e-07  Score=40.03  Aligned_cols=24  Identities=25%  Similarity=0.661  Sum_probs=23.4

Q ss_pred             eecCCCCcccCCchHHHHHHHhhc
Q psy12029         53 YFCPLCPYRAKQKTNLMTHMSIKH   76 (81)
Q Consensus        53 ~~c~~c~~~f~~~~~l~~h~~~~~   76 (81)
                      |.|+.||+.|...++|..|+++|+
T Consensus         6 y~C~~CGK~Fs~~~~L~~H~r~H~   29 (55)
T PHA02768          6 YECPICGEIYIKRKSMITHLRKHN   29 (55)
T ss_pred             cCcchhCCeeccHHHHHHHHHhcC
Confidence            899999999999999999999998


No 20 
>PLN03086 PRLI-interacting factor K; Provisional
Probab=98.47  E-value=2.2e-07  Score=55.35  Aligned_cols=63  Identities=19%  Similarity=0.358  Sum_probs=42.0

Q ss_pred             ccchhcccccccCCCceecCcchhhccCchHHHHHHHhhcCCCCCeecCCCCcccCC----------chHHHHHHHhh
Q psy12029          8 PFYFQITESSYFADRLFSCSGCARVYKNKKSLARHQTYECGQEPQYFCPLCPYRAKQ----------KTNLMTHMSIK   75 (81)
Q Consensus         8 ~~~l~~~~~~~~~~~~~~C~~c~~~~~~~~~l~~h~~~~~~~~~~~~c~~c~~~f~~----------~~~l~~h~~~~   75 (81)
                      ...+..|+..++  +++.|+ |+..+ ....|..|+..|...++ +.|..|+..+..          .+.|..|..+.
T Consensus       465 ~s~LekH~~~~H--kpv~Cp-Cg~~~-~R~~L~~H~~thCp~Kp-i~C~fC~~~v~~g~~~~d~~d~~s~Lt~HE~~C  537 (567)
T PLN03086        465 QGEMEKHMKVFH--EPLQCP-CGVVL-EKEQMVQHQASTCPLRL-ITCRFCGDMVQAGGSAMDVRDRLRGMSEHESIC  537 (567)
T ss_pred             hHHHHHHHHhcC--CCccCC-CCCCc-chhHHHhhhhccCCCCc-eeCCCCCCccccCccccchhhhhhhHHHHHHhc
Confidence            345667777653  677787 87544 45677777777777777 888888777641          24667776653


No 21 
>PF00096 zf-C2H2:  Zinc finger, C2H2 type;  InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger: #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C], where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter []. This entry represents the classical C2H2 zinc finger domain.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0005622 intracellular; PDB: 2D9H_A 2EPC_A 1SP1_A 1VA3_A 2WBT_B 2ELR_A 2YTP_A 2YTT_A 1VA1_A 2ELO_A ....
Probab=98.45  E-value=2.3e-07  Score=32.51  Aligned_cols=22  Identities=41%  Similarity=0.766  Sum_probs=12.4

Q ss_pred             eecCCCCcccCCchHHHHHHHh
Q psy12029         53 YFCPLCPYRAKQKTNLMTHMSI   74 (81)
Q Consensus        53 ~~c~~c~~~f~~~~~l~~h~~~   74 (81)
                      |.|..|++.|.....|..|++.
T Consensus         1 y~C~~C~~~f~~~~~l~~H~~~   22 (23)
T PF00096_consen    1 YKCPICGKSFSSKSNLKRHMRR   22 (23)
T ss_dssp             EEETTTTEEESSHHHHHHHHHH
T ss_pred             CCCCCCCCccCCHHHHHHHHhH
Confidence            3455555555555555555554


No 22 
>PF05605 zf-Di19:  Drought induced 19 protein (Di19), zinc-binding;  InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins. Di19 has been found to be strongly expressed in both the roots and leaves of Arabidopsis thaliana during progressive drought [], whilst RING finger proteins are thought to play a role in spermatogenesis. The precise function is unknown.
Probab=98.40  E-value=9.6e-07  Score=37.41  Aligned_cols=51  Identities=27%  Similarity=0.613  Sum_probs=38.7

Q ss_pred             ceecCcchhhccCchHHHHHHHh-hcCC-CCCeecCCCCcccCCchHHHHHHHhhcC
Q psy12029         23 LFSCSGCARVYKNKKSLARHQTY-ECGQ-EPQYFCPLCPYRAKQKTNLMTHMSIKHS   77 (81)
Q Consensus        23 ~~~C~~c~~~~~~~~~l~~h~~~-~~~~-~~~~~c~~c~~~f~~~~~l~~h~~~~~~   77 (81)
                      .|.|+.|++. .....|..|... |..+ +. +.|++|...+.  .+|..|+..+++
T Consensus         2 ~f~CP~C~~~-~~~~~L~~H~~~~H~~~~~~-v~CPiC~~~~~--~~l~~Hl~~~H~   54 (54)
T PF05605_consen    2 SFTCPYCGKG-FSESSLVEHCEDEHRSESKN-VVCPICSSRVT--DNLIRHLNSQHR   54 (54)
T ss_pred             CcCCCCCCCc-cCHHHHHHHHHhHCcCCCCC-ccCCCchhhhh--hHHHHHHHHhcC
Confidence            4889999994 556789899775 4443 45 89999987544  488999988774


No 23 
>PF00096 zf-C2H2:  Zinc finger, C2H2 type;  InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger: #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C], where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter []. This entry represents the classical C2H2 zinc finger domain.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0005622 intracellular; PDB: 2D9H_A 2EPC_A 1SP1_A 1VA3_A 2WBT_B 2ELR_A 2YTP_A 2YTT_A 1VA1_A 2ELO_A ....
Probab=98.38  E-value=3.6e-07  Score=31.98  Aligned_cols=23  Identities=26%  Similarity=0.700  Sum_probs=21.0

Q ss_pred             eecCcchhhccCchHHHHHHHhh
Q psy12029         24 FSCSGCARVYKNKKSLARHQTYE   46 (81)
Q Consensus        24 ~~C~~c~~~~~~~~~l~~h~~~~   46 (81)
                      |.|+.|++.|.....|..|++.|
T Consensus         1 y~C~~C~~~f~~~~~l~~H~~~H   23 (23)
T PF00096_consen    1 YKCPICGKSFSSKSNLKRHMRRH   23 (23)
T ss_dssp             EEETTTTEEESSHHHHHHHHHHH
T ss_pred             CCCCCCCCccCCHHHHHHHHhHC
Confidence            68999999999999999999864


No 24 
>PF13894 zf-C2H2_4:  C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A ....
Probab=98.30  E-value=9.9e-07  Score=30.88  Aligned_cols=24  Identities=33%  Similarity=0.786  Sum_probs=13.7

Q ss_pred             eecCCCCcccCCchHHHHHHHhhc
Q psy12029         53 YFCPLCPYRAKQKTNLMTHMSIKH   76 (81)
Q Consensus        53 ~~c~~c~~~f~~~~~l~~h~~~~~   76 (81)
                      |.|..|++.|.+...|..|+..++
T Consensus         1 ~~C~~C~~~~~~~~~l~~H~~~~H   24 (24)
T PF13894_consen    1 FQCPICGKSFRSKSELRQHMRTHH   24 (24)
T ss_dssp             EE-SSTS-EESSHHHHHHHHHHHS
T ss_pred             CCCcCCCCcCCcHHHHHHHHHhhC
Confidence            456666666666666666666553


No 25 
>PF13912 zf-C2H2_6:  C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B.
Probab=98.25  E-value=9e-07  Score=32.15  Aligned_cols=24  Identities=17%  Similarity=0.252  Sum_probs=17.3

Q ss_pred             eecCCCCcccCCchHHHHHHHhhc
Q psy12029         53 YFCPLCPYRAKQKTNLMTHMSIKH   76 (81)
Q Consensus        53 ~~c~~c~~~f~~~~~l~~h~~~~~   76 (81)
                      |.|..|++.|.....|..|++.|.
T Consensus         2 ~~C~~C~~~F~~~~~l~~H~~~h~   25 (27)
T PF13912_consen    2 FECDECGKTFSSLSALREHKRSHC   25 (27)
T ss_dssp             EEETTTTEEESSHHHHHHHHCTTT
T ss_pred             CCCCccCCccCChhHHHHHhHHhc
Confidence            677777777777777777776654


No 26 
>PF09237 GAGA:  GAGA factor;  InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  Members of this entry bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 1YUI_A 1YUJ_A.
Probab=98.21  E-value=2.5e-06  Score=35.33  Aligned_cols=29  Identities=34%  Similarity=0.660  Sum_probs=16.2

Q ss_pred             eecCCCCcccCCchHHHHHHHhhcCCCCC
Q psy12029         53 YFCPLCPYRAKQKTNLMTHMSIKHSHYQG   81 (81)
Q Consensus        53 ~~c~~c~~~f~~~~~l~~h~~~~~~~~~~   81 (81)
                      -.|++|+..+.+..+|..|+.+.|+.+||
T Consensus        25 atCP~C~a~~~~srnLrRHle~~H~~k~~   53 (54)
T PF09237_consen   25 ATCPICGAVIRQSRNLRRHLEIRHFKKPG   53 (54)
T ss_dssp             EE-TTT--EESSHHHHHHHHHHHTTTS--
T ss_pred             CCCCcchhhccchhhHHHHHHHHhcccCC
Confidence            56666666666666666666666666654


No 27 
>PLN03086 PRLI-interacting factor K; Provisional
Probab=98.17  E-value=3.7e-06  Score=50.40  Aligned_cols=67  Identities=18%  Similarity=0.275  Sum_probs=53.4

Q ss_pred             cccchhcccccccCCCceecCcchhhccC----------chHHHHHHHhhcCCCCCeecCCCCcccCCchHHHHHHHhhc
Q psy12029          7 VPFYFQITESSYFADRLFSCSGCARVYKN----------KKSLARHQTYECGQEPQYFCPLCPYRAKQKTNLMTHMSIKH   76 (81)
Q Consensus         7 ~~~~l~~~~~~~~~~~~~~C~~c~~~~~~----------~~~l~~h~~~~~~~~~~~~c~~c~~~f~~~~~l~~h~~~~~   76 (81)
                      ....|..|+.+|.+.+++.|..|+..+..          ...|..|...+ |.++ +.|..|++.+... .+..|+..-|
T Consensus       488 ~R~~L~~H~~thCp~Kpi~C~fC~~~v~~g~~~~d~~d~~s~Lt~HE~~C-G~rt-~~C~~Cgk~Vrlr-dm~~H~~~~h  564 (567)
T PLN03086        488 EKEQMVQHQASTCPLRLITCRFCGDMVQAGGSAMDVRDRLRGMSEHESIC-GSRT-APCDSCGRSVMLK-EMDIHQIAVH  564 (567)
T ss_pred             chhHHHhhhhccCCCCceeCCCCCCccccCccccchhhhhhhHHHHHHhc-CCcc-eEccccCCeeeeh-hHHHHHHHhh
Confidence            44678889999999999999999998842          24688888874 8888 9999999987766 4677776544


No 28 
>PF09237 GAGA:  GAGA factor;  InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  Members of this entry bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 1YUI_A 1YUJ_A.
Probab=98.14  E-value=5.4e-06  Score=34.33  Aligned_cols=34  Identities=21%  Similarity=0.415  Sum_probs=24.6

Q ss_pred             ccCCCceecCcchhhccCchHHHHHHHhhcCCCC
Q psy12029         18 YFADRLFSCSGCARVYKNKKSLARHQTYECGQEP   51 (81)
Q Consensus        18 ~~~~~~~~C~~c~~~~~~~~~l~~h~~~~~~~~~   51 (81)
                      +..+.|..|++|+..+....+|.+|+...++.+|
T Consensus        19 ~~S~~PatCP~C~a~~~~srnLrRHle~~H~~k~   52 (54)
T PF09237_consen   19 SQSEQPATCPICGAVIRQSRNLRRHLEIRHFKKP   52 (54)
T ss_dssp             CTTS--EE-TTT--EESSHHHHHHHHHHHTTTS-
T ss_pred             hccCCCCCCCcchhhccchhhHHHHHHHHhcccC
Confidence            4467889999999999999999999998887765


No 29 
>PHA00733 hypothetical protein
Probab=98.11  E-value=1.5e-06  Score=42.98  Aligned_cols=55  Identities=18%  Similarity=0.300  Sum_probs=42.2

Q ss_pred             CCCceecCcchhhccCchHHHHH--HH---hhcCCCCCeecCCCCcccCCchHHHHHHHhh
Q psy12029         20 ADRLFSCSGCARVYKNKKSLARH--QT---YECGQEPQYFCPLCPYRAKQKTNLMTHMSIK   75 (81)
Q Consensus        20 ~~~~~~C~~c~~~~~~~~~l~~h--~~---~~~~~~~~~~c~~c~~~f~~~~~l~~h~~~~   75 (81)
                      ..+++.|.+|...|.....|..+  .+   ...+..+ |.|..|++.|...+.|..|++.+
T Consensus        37 ~~~~~~~~~~~~~~~~~~~l~~~~~l~~~~~~~~~kP-y~C~~Cgk~Fss~s~L~~H~r~h   96 (128)
T PHA00733         37 EQKRLIRAVVKTLIYNPQLLDESSYLYKLLTSKAVSP-YVCPLCLMPFSSSVSLKQHIRYT   96 (128)
T ss_pred             hhhhHHHHHHhhhccChhhhcchHHHHhhcccCCCCC-ccCCCCCCcCCCHHHHHHHHhcC
Confidence            45778899999888876665544  11   2234667 99999999999999999999865


No 30 
>PF13912 zf-C2H2_6:  C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B.
Probab=98.11  E-value=1.7e-06  Score=31.38  Aligned_cols=25  Identities=24%  Similarity=0.761  Sum_probs=22.6

Q ss_pred             ceecCcchhhccCchHHHHHHHhhc
Q psy12029         23 LFSCSGCARVYKNKKSLARHQTYEC   47 (81)
Q Consensus        23 ~~~C~~c~~~~~~~~~l~~h~~~~~   47 (81)
                      +|.|..|+..|.....|..|++.|.
T Consensus         1 ~~~C~~C~~~F~~~~~l~~H~~~h~   25 (27)
T PF13912_consen    1 PFECDECGKTFSSLSALREHKRSHC   25 (27)
T ss_dssp             SEEETTTTEEESSHHHHHHHHCTTT
T ss_pred             CCCCCccCCccCChhHHHHHhHHhc
Confidence            5899999999999999999998764


No 31 
>PF13894 zf-C2H2_4:  C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A ....
Probab=98.03  E-value=6.2e-06  Score=28.73  Aligned_cols=23  Identities=26%  Similarity=0.706  Sum_probs=19.2

Q ss_pred             eecCcchhhccCchHHHHHHHhh
Q psy12029         24 FSCSGCARVYKNKKSLARHQTYE   46 (81)
Q Consensus        24 ~~C~~c~~~~~~~~~l~~h~~~~   46 (81)
                      |.|+.|+..|.....|..|+..+
T Consensus         1 ~~C~~C~~~~~~~~~l~~H~~~~   23 (24)
T PF13894_consen    1 FQCPICGKSFRSKSELRQHMRTH   23 (24)
T ss_dssp             EE-SSTS-EESSHHHHHHHHHHH
T ss_pred             CCCcCCCCcCCcHHHHHHHHHhh
Confidence            67999999999999999999875


No 32 
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning]
Probab=97.93  E-value=3.7e-06  Score=47.11  Aligned_cols=52  Identities=29%  Similarity=0.598  Sum_probs=41.0

Q ss_pred             CCceecCc--chhhccCchHHHHHHHh-h------------------cCCCCCeecCCCCcccCCchHHHHHHH
Q psy12029         21 DRLFSCSG--CARVYKNKKSLARHQTY-E------------------CGQEPQYFCPLCPYRAKQKTNLMTHMS   73 (81)
Q Consensus        21 ~~~~~C~~--c~~~~~~~~~l~~h~~~-~------------------~~~~~~~~c~~c~~~f~~~~~l~~h~~   73 (81)
                      ++||.|++  |++.++..--|.-|+.- |                  ...+| |+|++|+|.+.....|.-|+.
T Consensus       347 ~KpykCpV~gC~K~YknqnGLKYH~lhGH~~~~~~~~p~p~~~~~F~~~~KP-YrCevC~KRYKNlNGLKYHr~  419 (423)
T COG5189         347 GKPYKCPVEGCNKKYKNQNGLKYHMLHGHQNQKLHENPSPEKMNIFSAKDKP-YRCEVCDKRYKNLNGLKYHRK  419 (423)
T ss_pred             CceecCCCCCchhhhccccchhhhhhccccCcccCCCCCccccccccccCCc-eeccccchhhccCccceeccc
Confidence            59999987  99999998888777652 2                  01267 999999999999888877754


No 33 
>smart00355 ZnF_C2H2 zinc finger.
Probab=97.84  E-value=2.3e-05  Score=27.59  Aligned_cols=22  Identities=36%  Similarity=0.561  Sum_probs=12.6

Q ss_pred             ecCCCCcccCCchHHHHHHHhh
Q psy12029         54 FCPLCPYRAKQKTNLMTHMSIK   75 (81)
Q Consensus        54 ~c~~c~~~f~~~~~l~~h~~~~   75 (81)
                      .|..|++.|.....+..|++.|
T Consensus         2 ~C~~C~~~f~~~~~l~~H~~~H   23 (26)
T smart00355        2 RCPECGKVFKSKSALKEHMRTH   23 (26)
T ss_pred             CCCCCcchhCCHHHHHHHHHHh
Confidence            4555666666666666665543


No 34 
>PRK04860 hypothetical protein; Provisional
Probab=97.81  E-value=2.7e-05  Score=39.95  Aligned_cols=39  Identities=23%  Similarity=0.481  Sum_probs=32.7

Q ss_pred             CceecCcchhhccCchHHHHHHHhhcCCCCCeecCCCCcccCCc
Q psy12029         22 RLFSCSGCARVYKNKKSLARHQTYECGQEPQYFCPLCPYRAKQK   65 (81)
Q Consensus        22 ~~~~C~~c~~~~~~~~~l~~h~~~~~~~~~~~~c~~c~~~f~~~   65 (81)
                      -+|.|. |+.   ....+..|.+++.++++ |.|..|+..|...
T Consensus       118 ~~Y~C~-C~~---~~~~~rrH~ri~~g~~~-YrC~~C~~~l~~~  156 (160)
T PRK04860        118 FPYRCK-CQE---HQLTVRRHNRVVRGEAV-YRCRRCGETLVFK  156 (160)
T ss_pred             EEEEcC-CCC---eeCHHHHHHHHhcCCcc-EECCCCCceeEEe
Confidence            368998 986   56678899999999999 9999999887654


No 35 
>PF12756 zf-C2H2_2:  C2H2 type zinc-finger (2 copies); PDB: 2DMI_A.
Probab=97.64  E-value=5.7e-05  Score=35.39  Aligned_cols=23  Identities=30%  Similarity=0.675  Sum_probs=20.4

Q ss_pred             eecCCCCcccCCchHHHHHHHhh
Q psy12029         53 YFCPLCPYRAKQKTNLMTHMSIK   75 (81)
Q Consensus        53 ~~c~~c~~~f~~~~~l~~h~~~~   75 (81)
                      +.|..|++.|.+...|..|++.+
T Consensus        51 ~~C~~C~~~f~s~~~l~~Hm~~~   73 (100)
T PF12756_consen   51 FRCPYCNKTFRSREALQEHMRSK   73 (100)
T ss_dssp             EEBSSSS-EESSHHHHHHHHHHT
T ss_pred             CCCCccCCCCcCHHHHHHHHcCc
Confidence            89999999999999999999864


No 36 
>smart00355 ZnF_C2H2 zinc finger.
Probab=97.62  E-value=7.2e-05  Score=26.25  Aligned_cols=24  Identities=29%  Similarity=0.761  Sum_probs=20.9

Q ss_pred             eecCcchhhccCchHHHHHHHhhc
Q psy12029         24 FSCSGCARVYKNKKSLARHQTYEC   47 (81)
Q Consensus        24 ~~C~~c~~~~~~~~~l~~h~~~~~   47 (81)
                      +.|..|++.|.....+..|++.|.
T Consensus         1 ~~C~~C~~~f~~~~~l~~H~~~H~   24 (26)
T smart00355        1 YRCPECGKVFKSKSALKEHMRTHX   24 (26)
T ss_pred             CCCCCCcchhCCHHHHHHHHHHhc
Confidence            579999999999999999988653


No 37 
>PF13909 zf-H2C2_5:  C2H2-type zinc-finger domain; PDB: 1X5W_A.
Probab=97.41  E-value=0.00023  Score=24.90  Aligned_cols=23  Identities=43%  Similarity=0.954  Sum_probs=11.9

Q ss_pred             eecCCCCcccCCchHHHHHHHhhc
Q psy12029         53 YFCPLCPYRAKQKTNLMTHMSIKH   76 (81)
Q Consensus        53 ~~c~~c~~~f~~~~~l~~h~~~~~   76 (81)
                      |.|..|+.... ...|..|++.++
T Consensus         1 y~C~~C~y~t~-~~~l~~H~~~~H   23 (24)
T PF13909_consen    1 YKCPHCSYSTS-KSNLKRHLKRHH   23 (24)
T ss_dssp             EE-SSSS-EES-HHHHHHHHHHHH
T ss_pred             CCCCCCCCcCC-HHHHHHHHHhhC
Confidence            45666665554 556666666554


No 38 
>PF12874 zf-met:  Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A.
Probab=97.39  E-value=0.00018  Score=25.35  Aligned_cols=21  Identities=19%  Similarity=0.692  Sum_probs=12.0

Q ss_pred             eecCCCCcccCCchHHHHHHH
Q psy12029         53 YFCPLCPYRAKQKTNLMTHMS   73 (81)
Q Consensus        53 ~~c~~c~~~f~~~~~l~~h~~   73 (81)
                      |.|.+|++.|.+...+..|++
T Consensus         1 ~~C~~C~~~f~s~~~~~~H~~   21 (25)
T PF12874_consen    1 FYCDICNKSFSSENSLRQHLR   21 (25)
T ss_dssp             EEETTTTEEESSHHHHHHHHT
T ss_pred             CCCCCCCCCcCCHHHHHHHHC
Confidence            345556666666666655554


No 39 
>PF12874 zf-met:  Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A.
Probab=97.37  E-value=0.00014  Score=25.66  Aligned_cols=23  Identities=26%  Similarity=0.641  Sum_probs=20.3

Q ss_pred             eecCcchhhccCchHHHHHHHhh
Q psy12029         24 FSCSGCARVYKNKKSLARHQTYE   46 (81)
Q Consensus        24 ~~C~~c~~~~~~~~~l~~h~~~~   46 (81)
                      |.|.+|+..|.....+..|.+.+
T Consensus         1 ~~C~~C~~~f~s~~~~~~H~~s~   23 (25)
T PF12874_consen    1 FYCDICNKSFSSENSLRQHLRSK   23 (25)
T ss_dssp             EEETTTTEEESSHHHHHHHHTTH
T ss_pred             CCCCCCCCCcCCHHHHHHHHCcC
Confidence            67999999999999999998753


No 40 
>KOG3993|consensus
Probab=97.36  E-value=2.7e-05  Score=45.16  Aligned_cols=54  Identities=24%  Similarity=0.407  Sum_probs=45.6

Q ss_pred             CceecCcchhhccCchHHHHHHHhhcCCCCCeecCCCCcccCCchHHHHHHHhhc
Q psy12029         22 RLFSCSGCARVYKNKKSLARHQTYECGQEPQYFCPLCPYRAKQKTNLMTHMSIKH   76 (81)
Q Consensus        22 ~~~~C~~c~~~~~~~~~l~~h~~~~~~~~~~~~c~~c~~~f~~~~~l~~h~~~~~   76 (81)
                      ..|-|..|...|.+.-.|.+|.-......- |+|.+|+|.|.=.+||..|.+=|.
T Consensus       266 GdyiCqLCK~kYeD~F~LAQHrC~RIV~vE-YrCPEC~KVFsCPANLASHRRWHK  319 (500)
T KOG3993|consen  266 GDYICQLCKEKYEDAFALAQHRCPRIVHVE-YRCPECDKVFSCPANLASHRRWHK  319 (500)
T ss_pred             HHHHHHHHHHhhhhHHHHhhccCCeeEEee-ecCCcccccccCchhhhhhhcccC
Confidence            347899999999999899988765555555 999999999999999999998765


No 41 
>PHA00732 hypothetical protein
Probab=97.23  E-value=0.00032  Score=32.01  Aligned_cols=25  Identities=20%  Similarity=0.485  Sum_probs=22.2

Q ss_pred             eecCCCCcccCCchHHHHHHHh-hcC
Q psy12029         53 YFCPLCPYRAKQKTNLMTHMSI-KHS   77 (81)
Q Consensus        53 ~~c~~c~~~f~~~~~l~~h~~~-~~~   77 (81)
                      |.|..|++.|.+.+.|..|++. |.+
T Consensus         2 y~C~~Cgk~F~s~s~Lk~H~r~~H~~   27 (79)
T PHA00732          2 FKCPICGFTTVTLFALKQHARRNHTL   27 (79)
T ss_pred             ccCCCCCCccCCHHHHHHHhhcccCC
Confidence            8999999999999999999984 543


No 42 
>PF12171 zf-C2H2_jaz:  Zinc-finger double-stranded RNA-binding;  InterPro: IPR022755  This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length. The mammalian members of this group occur multiple times along the protein, joined by flexible linkers, and are referred to as JAZ - dsRNA-binding ZF protein - zinc-fingers. The JAZ proteins are expressed in all tissues tested and localise in the nucleus, particularly the nucleolus []. JAZ preferentially binds to double-stranded (ds) RNA or RNA/DNA hybrids rather than DNA. In addition to binding double-stranded RNA, these zinc-fingers are required for nucleolar localisation.   This entry represents the multiple-adjacent-C2H2 zinc finger, JAZ. ; PDB: 4DGW_A 1ZR9_A.
Probab=96.86  E-value=0.00035  Score=25.20  Aligned_cols=21  Identities=24%  Similarity=0.637  Sum_probs=13.4

Q ss_pred             eecCCCCcccCCchHHHHHHH
Q psy12029         53 YFCPLCPYRAKQKTNLMTHMS   73 (81)
Q Consensus        53 ~~c~~c~~~f~~~~~l~~h~~   73 (81)
                      |.|..|++.|.+...+..|++
T Consensus         2 ~~C~~C~k~f~~~~~~~~H~~   22 (27)
T PF12171_consen    2 FYCDACDKYFSSENQLKQHMK   22 (27)
T ss_dssp             CBBTTTTBBBSSHHHHHCCTT
T ss_pred             CCcccCCCCcCCHHHHHHHHc
Confidence            456666666666666666554


No 43 
>PF13913 zf-C2HC_2:  zinc-finger of a C2HC-type
Probab=96.63  E-value=0.0025  Score=22.66  Aligned_cols=20  Identities=25%  Similarity=0.536  Sum_probs=11.7

Q ss_pred             eecCCCCcccCCchHHHHHHH
Q psy12029         53 YFCPLCPYRAKQKTNLMTHMS   73 (81)
Q Consensus        53 ~~c~~c~~~f~~~~~l~~h~~   73 (81)
                      ..|..||+.| ..+.|..|+.
T Consensus         3 ~~C~~CgR~F-~~~~l~~H~~   22 (25)
T PF13913_consen    3 VPCPICGRKF-NPDRLEKHEK   22 (25)
T ss_pred             CcCCCCCCEE-CHHHHHHHHH
Confidence            3566677776 4445666654


No 44 
>smart00451 ZnF_U1 U1-like zinc finger. Family of C2H2-type zinc fingers, present in matrin, U1 small nuclear ribonucleoprotein C and other RNA-binding proteins.
Probab=95.93  E-value=0.0087  Score=22.61  Aligned_cols=21  Identities=19%  Similarity=0.697  Sum_probs=15.5

Q ss_pred             eecCCCCcccCCchHHHHHHH
Q psy12029         53 YFCPLCPYRAKQKTNLMTHMS   73 (81)
Q Consensus        53 ~~c~~c~~~f~~~~~l~~h~~   73 (81)
                      |.|..|+..|.....+..|..
T Consensus         4 ~~C~~C~~~~~~~~~~~~H~~   24 (35)
T smart00451        4 FYCKLCNVTFTDEISVEAHLK   24 (35)
T ss_pred             eEccccCCccCCHHHHHHHHC
Confidence            677888887777777777654


No 45 
>COG4049 Uncharacterized protein containing archaeal-type C2H2 Zn-finger [General function prediction only]
Probab=95.57  E-value=0.01  Score=25.16  Aligned_cols=30  Identities=20%  Similarity=0.528  Sum_probs=24.0

Q ss_pred             cccCCCceecCcchhhccCchHHHHHHHhh
Q psy12029         17 SYFADRLFSCSGCARVYKNKKSLARHQTYE   46 (81)
Q Consensus        17 ~~~~~~~~~C~~c~~~~~~~~~l~~h~~~~   46 (81)
                      +--|+.-+.|+.||..|....+...|....
T Consensus        11 ~RDGE~~lrCPRC~~~FR~~K~Y~RHVNKa   40 (65)
T COG4049          11 DRDGEEFLRCPRCGMVFRRRKDYIRHVNKA   40 (65)
T ss_pred             ccCCceeeeCCchhHHHHHhHHHHHHhhHH
Confidence            345677789999999999999888887643


No 46 
>KOG2893|consensus
Probab=95.52  E-value=0.003  Score=34.61  Aligned_cols=40  Identities=25%  Similarity=0.521  Sum_probs=30.5

Q ss_pred             ecCcchhhccCchHHHHHHHhhcCCCCCeecCCCCcccCCchHHH
Q psy12029         25 SCSGCARVYKNKKSLARHQTYECGQEPQYFCPLCPYRAKQKTNLM   69 (81)
Q Consensus        25 ~C~~c~~~~~~~~~l~~h~~~~~~~~~~~~c~~c~~~f~~~~~l~   69 (81)
                      .|..|...|.....|.+||+    .+- |+|-+|-+.+.+-..|.
T Consensus        12 wcwycnrefddekiliqhqk----akh-fkchichkkl~sgpgls   51 (341)
T KOG2893|consen   12 WCWYCNREFDDEKILIQHQK----AKH-FKCHICHKKLFSGPGLS   51 (341)
T ss_pred             eeeecccccchhhhhhhhhh----hcc-ceeeeehhhhccCCCce
Confidence            48889999999999999988    356 99999976554433343


No 47 
>KOG1146|consensus
Probab=95.50  E-value=0.011  Score=39.30  Aligned_cols=56  Identities=25%  Similarity=0.460  Sum_probs=45.0

Q ss_pred             ccCCCceecCcchhhccCchHHHHHHHhhc-------------------------CCCCCeecCCCCcccCCchHHHHHH
Q psy12029         18 YFADRLFSCSGCARVYKNKKSLARHQTYEC-------------------------GQEPQYFCPLCPYRAKQKTNLMTHM   72 (81)
Q Consensus        18 ~~~~~~~~C~~c~~~~~~~~~l~~h~~~~~-------------------------~~~~~~~c~~c~~~f~~~~~l~~h~   72 (81)
                      ++-.+.+.|+.|++.|+....|..|+|..+                         +.++ |.|..|...+....+|.+|+
T Consensus       460 ~S~~kt~~cpkc~~~yk~a~~L~vhmRskhp~~~~~~c~~gq~~~~~arg~~~~~~~~p-~~C~~C~~stttng~Lsihl  538 (1406)
T KOG1146|consen  460 HSFFKTLKCPKCNWHYKLAQTLGVHMRSKHPESQSAYCKAGQNHPRLARGEVYRCPGKP-YPCRACNYSTTTNGNLSIHL  538 (1406)
T ss_pred             ecccccccCCccchhhhhHHHhhhcccccccccchhHhHhccccccccccccccCCCCc-ccceeeeeeeecchHHHHHH
Confidence            555688999999999999999999999711                         1235 88889998888888888887


Q ss_pred             Hh
Q psy12029         73 SI   74 (81)
Q Consensus        73 ~~   74 (81)
                      ..
T Consensus       539 qS  540 (1406)
T KOG1146|consen  539 QS  540 (1406)
T ss_pred             HH
Confidence            63


No 48 
>PRK04860 hypothetical protein; Provisional
Probab=95.50  E-value=0.0047  Score=31.92  Aligned_cols=29  Identities=10%  Similarity=0.284  Sum_probs=24.5

Q ss_pred             ccchhcccccccCCCceecCcchhhccCc
Q psy12029          8 PFYFQITESSYFADRLFSCSGCARVYKNK   36 (81)
Q Consensus         8 ~~~l~~~~~~~~~~~~~~C~~c~~~~~~~   36 (81)
                      ..++..|.++++++++|.|..|+..|...
T Consensus       128 ~~~~rrH~ri~~g~~~YrC~~C~~~l~~~  156 (160)
T PRK04860        128 QLTVRRHNRVVRGEAVYRCRRCGETLVFK  156 (160)
T ss_pred             eCHHHHHHHHhcCCccEECCCCCceeEEe
Confidence            34568899999999999999999887654


No 49 
>cd00350 rubredoxin_like Rubredoxin_like; nonheme iron binding domain containing a [Fe(SCys)4] center. The family includes rubredoxins, a small electron transfer protein, and a slightly smaller modular rubredoxin domain present in rubrerythrin and nigerythrin and detected either N- or C-terminal to such proteins as flavin reductase, NAD(P)H-nitrite reductase, and ferredoxin-thioredoxin reductase. In rubredoxin, the iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), but iron can also be replaced by cobalt, nickel or zinc and believed to be involved in electron transfer.  Rubrerythrins and nigerythrins are small homodimeric proteins, generally consisting of 2 domains: a rubredoxin domain C-terminal to a non-sulfur, oxo-bridged diiron site in the N-terminal rubrerythrin domain.  Rubrerythrins and nigerythrins have putative peroxide activity.
Probab=95.45  E-value=0.011  Score=22.31  Aligned_cols=24  Identities=29%  Similarity=1.075  Sum_probs=16.3

Q ss_pred             eecCcchhhccCchHHHHHHHhhcCCCCCeecCCCCc
Q psy12029         24 FSCSGCARVYKNKKSLARHQTYECGQEPQYFCPLCPY   60 (81)
Q Consensus        24 ~~C~~c~~~~~~~~~l~~h~~~~~~~~~~~~c~~c~~   60 (81)
                      |.|.+||..+....            .+ +.|+.|+.
T Consensus         2 ~~C~~CGy~y~~~~------------~~-~~CP~Cg~   25 (33)
T cd00350           2 YVCPVCGYIYDGEE------------AP-WVCPVCGA   25 (33)
T ss_pred             EECCCCCCEECCCc------------CC-CcCcCCCC
Confidence            67888887654432            45 88888874


No 50 
>KOG2186|consensus
Probab=95.01  E-value=0.027  Score=31.18  Aligned_cols=47  Identities=19%  Similarity=0.378  Sum_probs=33.8

Q ss_pred             eecCcchhhccCchHHHHHHHhhcCCCCCeecCCCCcccCCchHHHHHHHh
Q psy12029         24 FSCSGCARVYKNKKSLARHQTYECGQEPQYFCPLCPYRAKQKTNLMTHMSI   74 (81)
Q Consensus        24 ~~C~~c~~~~~~~~~l~~h~~~~~~~~~~~~c~~c~~~f~~~~~l~~h~~~   74 (81)
                      |.|.+||.... ...+.+|+...++ .. |.|--|++.|... .+.+|...
T Consensus         4 FtCnvCgEsvK-Kp~vekH~srCrn-~~-fSCIDC~k~F~~~-sYknH~kC   50 (276)
T KOG2186|consen    4 FTCNVCGESVK-KPQVEKHMSRCRN-AY-FSCIDCGKTFERV-SYKNHTKC   50 (276)
T ss_pred             Eehhhhhhhcc-ccchHHHHHhccC-Ce-eEEeecccccccc-hhhhhhhh
Confidence            67888987644 3456778877766 44 8898899999884 46667654


No 51 
>COG5048 FOG: Zn-finger [General function prediction only]
Probab=94.57  E-value=0.0063  Score=35.13  Aligned_cols=55  Identities=24%  Similarity=0.512  Sum_probs=37.6

Q ss_pred             ceecCcchhhccCchHHHHHHH--hhcCC--CCCeecC--CCCcccCCchHHHHHHHhhcCC
Q psy12029         23 LFSCSGCARVYKNKKSLARHQT--YECGQ--EPQYFCP--LCPYRAKQKTNLMTHMSIKHSH   78 (81)
Q Consensus        23 ~~~C~~c~~~~~~~~~l~~h~~--~~~~~--~~~~~c~--~c~~~f~~~~~l~~h~~~~~~~   78 (81)
                      ++.|..|...|.....+..|.+  .|.++  ++ +.|.  .|++.|.+...+..|..+|.+-
T Consensus       289 ~~~~~~~~~~~s~~~~l~~~~~~~~h~~~~~~~-~~~p~~~~~~~~~~~~~~~~~~~~~~~~  349 (467)
T COG5048         289 PIKSKQCNISFSRSSPLTRHLRSVNHSGESLKP-FSCPYSLCGKLFSRNDALKRHILLHTSI  349 (467)
T ss_pred             CCCCccccCCccccccccccccccccccccCCc-eeeeccCCCccccccccccCCcccccCC
Confidence            5667777777777777777777  57776  66 7777  5777777776666666665543


No 52 
>PF12756 zf-C2H2_2:  C2H2 type zinc-finger (2 copies); PDB: 2DMI_A.
Probab=94.44  E-value=0.044  Score=25.47  Aligned_cols=24  Identities=21%  Similarity=0.674  Sum_probs=21.2

Q ss_pred             ceecCcchhhccCchHHHHHHHhh
Q psy12029         23 LFSCSGCARVYKNKKSLARHQTYE   46 (81)
Q Consensus        23 ~~~C~~c~~~~~~~~~l~~h~~~~   46 (81)
                      .+.|..|+..|.....|..|++.+
T Consensus        50 ~~~C~~C~~~f~s~~~l~~Hm~~~   73 (100)
T PF12756_consen   50 SFRCPYCNKTFRSREALQEHMRSK   73 (100)
T ss_dssp             SEEBSSSS-EESSHHHHHHHHHHT
T ss_pred             CCCCCccCCCCcCHHHHHHHHcCc
Confidence            689999999999999999999964


No 53 
>PF13719 zinc_ribbon_5:  zinc-ribbon domain
Probab=93.46  E-value=0.1  Score=20.24  Aligned_cols=34  Identities=18%  Similarity=0.532  Sum_probs=22.7

Q ss_pred             eecCcchhhccCchHHHHHHHhhcCCCCCeecCCCCcccC
Q psy12029         24 FSCSGCARVYKNKKSLARHQTYECGQEPQYFCPLCPYRAK   63 (81)
Q Consensus        24 ~~C~~c~~~~~~~~~l~~h~~~~~~~~~~~~c~~c~~~f~   63 (81)
                      ..|+.|+..|.....     +...+... .+|..|+..|.
T Consensus         3 i~CP~C~~~f~v~~~-----~l~~~~~~-vrC~~C~~~f~   36 (37)
T PF13719_consen    3 ITCPNCQTRFRVPDD-----KLPAGGRK-VRCPKCGHVFR   36 (37)
T ss_pred             EECCCCCceEEcCHH-----HcccCCcE-EECCCCCcEee
Confidence            468999888877653     12233345 88999987764


No 54 
>COG2888 Predicted Zn-ribbon RNA-binding protein with a function in translation [Translation, ribosomal structure and biogenesis]
Probab=93.32  E-value=0.068  Score=23.04  Aligned_cols=32  Identities=28%  Similarity=0.591  Sum_probs=19.5

Q ss_pred             CceecCcchhhccCchHHHHHHHhhcCCCCCeecCCCC
Q psy12029         22 RLFSCSGCARVYKNKKSLARHQTYECGQEPQYFCPLCP   59 (81)
Q Consensus        22 ~~~~C~~c~~~~~~~~~l~~h~~~~~~~~~~~~c~~c~   59 (81)
                      ..|.|+.||..--...     ++-.....+ |.|+.||
T Consensus        26 v~F~CPnCGe~~I~Rc-----~~CRk~g~~-Y~Cp~CG   57 (61)
T COG2888          26 VKFPCPNCGEVEIYRC-----AKCRKLGNP-YRCPKCG   57 (61)
T ss_pred             eEeeCCCCCceeeehh-----hhHHHcCCc-eECCCcC
Confidence            3488999986543322     222223456 9999987


No 55 
>PF09538 FYDLN_acid:  Protein of unknown function (FYDLN_acid);  InterPro: IPR012644 Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues. The function of members of this family is unknown.
Probab=93.11  E-value=0.075  Score=25.80  Aligned_cols=30  Identities=20%  Similarity=0.657  Sum_probs=20.8

Q ss_pred             eecCcchhhccCchHHHHHHHhhcCCCCCeecCCCCcccCCc
Q psy12029         24 FSCSGCARVYKNKKSLARHQTYECGQEPQYFCPLCPYRAKQK   65 (81)
Q Consensus        24 ~~C~~c~~~~~~~~~l~~h~~~~~~~~~~~~c~~c~~~f~~~   65 (81)
                      ..|+.||..|-.           ....| ..|+.||..|.-.
T Consensus        10 R~Cp~CG~kFYD-----------Lnk~P-ivCP~CG~~~~~~   39 (108)
T PF09538_consen   10 RTCPSCGAKFYD-----------LNKDP-IVCPKCGTEFPPE   39 (108)
T ss_pred             ccCCCCcchhcc-----------CCCCC-ccCCCCCCccCcc
Confidence            478999877633           22346 8899999877655


No 56 
>TIGR02098 MJ0042_CXXC MJ0042 family finger-like domain. This domain contains a CXXCX(19)CXXC motif suggestive of both zinc fingers and thioredoxin, usually found at the N-terminus of prokaryotic proteins. One partially characterized gene, agmX, is among a large set in Myxococcus whose interruption affects adventurous gliding motility.
Probab=92.59  E-value=0.11  Score=19.99  Aligned_cols=34  Identities=15%  Similarity=0.280  Sum_probs=21.8

Q ss_pred             eecCcchhhccCchHHHHHHHhhcCCCCCeecCCCCcccC
Q psy12029         24 FSCSGCARVYKNKKSLARHQTYECGQEPQYFCPLCPYRAK   63 (81)
Q Consensus        24 ~~C~~c~~~~~~~~~l~~h~~~~~~~~~~~~c~~c~~~f~   63 (81)
                      ..|+.|+..|.......     ...... ..|..|+..|.
T Consensus         3 ~~CP~C~~~~~v~~~~~-----~~~~~~-v~C~~C~~~~~   36 (38)
T TIGR02098         3 IQCPNCKTSFRVVDSQL-----GANGGK-VRCGKCGHVWY   36 (38)
T ss_pred             EECCCCCCEEEeCHHHc-----CCCCCE-EECCCCCCEEE
Confidence            57999998877765421     111224 78999987664


No 57 
>PF09986 DUF2225:  Uncharacterized protein conserved in bacteria (DUF2225);  InterPro: IPR018708 This conserved bacterial family has no known function.
Probab=92.48  E-value=0.022  Score=30.82  Aligned_cols=45  Identities=29%  Similarity=0.696  Sum_probs=27.9

Q ss_pred             CCceecCcchhhccCchHHHHHHHh---hc-------CCCCC----eecCCCCcccCCc
Q psy12029         21 DRLFSCSGCARVYKNKKSLARHQTY---EC-------GQEPQ----YFCPLCPYRAKQK   65 (81)
Q Consensus        21 ~~~~~C~~c~~~~~~~~~l~~h~~~---~~-------~~~~~----~~c~~c~~~f~~~   65 (81)
                      ++...|++|+..|..........+.   ..       +..|.    +.|+.||.++...
T Consensus         3 ~k~~~CPvC~~~F~~~~vrs~~~r~~~~d~D~~~~Y~~vnP~~Y~V~vCP~CgyA~~~~   61 (214)
T PF09986_consen    3 DKKITCPVCGKEFKTKKVRSGKIRVIRRDSDFCPRYKGVNPLFYEVWVCPHCGYAAFEE   61 (214)
T ss_pred             CCceECCCCCCeeeeeEEEcCCceEeeecCCCccccCCCCCeeeeEEECCCCCCccccc
Confidence            4568999999999887654433321   11       11120    4799999876543


No 58 
>COG1997 RPL43A Ribosomal protein L37AE/L43A [Translation, ribosomal structure and biogenesis]
Probab=92.10  E-value=0.046  Score=25.40  Aligned_cols=32  Identities=16%  Similarity=0.328  Sum_probs=21.3

Q ss_pred             CceecCcchhhccCchHHHHHHHhhcCCCCCeecCCCCcccCC
Q psy12029         22 RLFSCSGCARVYKNKKSLARHQTYECGQEPQYFCPLCPYRAKQ   64 (81)
Q Consensus        22 ~~~~C~~c~~~~~~~~~l~~h~~~~~~~~~~~~c~~c~~~f~~   64 (81)
                      ..|.|+.|++. .       ..+.  +... |.|..|+..|.=
T Consensus        34 ~~~~Cp~C~~~-~-------VkR~--a~GI-W~C~kCg~~fAG   65 (89)
T COG1997          34 AKHVCPFCGRT-T-------VKRI--ATGI-WKCRKCGAKFAG   65 (89)
T ss_pred             cCCcCCCCCCc-c-------eeee--ccCe-EEcCCCCCeecc
Confidence            46889999865 1       1232  2346 999999987753


No 59 
>PF13717 zinc_ribbon_4:  zinc-ribbon domain
Probab=92.06  E-value=0.18  Score=19.43  Aligned_cols=33  Identities=15%  Similarity=0.318  Sum_probs=21.7

Q ss_pred             eecCcchhhccCchHHHHHHHhhcCCCCCeecCCCCccc
Q psy12029         24 FSCSGCARVYKNKKSLARHQTYECGQEPQYFCPLCPYRA   62 (81)
Q Consensus        24 ~~C~~c~~~~~~~~~l~~h~~~~~~~~~~~~c~~c~~~f   62 (81)
                      ..|+.|+..|......     ....... .+|..|+..|
T Consensus         3 i~Cp~C~~~y~i~d~~-----ip~~g~~-v~C~~C~~~f   35 (36)
T PF13717_consen    3 ITCPNCQAKYEIDDEK-----IPPKGRK-VRCSKCGHVF   35 (36)
T ss_pred             EECCCCCCEEeCCHHH-----CCCCCcE-EECCCCCCEe
Confidence            5788898888776542     2222334 7898888766


No 60 
>COG5048 FOG: Zn-finger [General function prediction only]
Probab=90.88  E-value=0.074  Score=30.78  Aligned_cols=52  Identities=15%  Similarity=0.265  Sum_probs=43.3

Q ss_pred             cccccccchhcccc--cccCC--CceecC--cchhhccCchHHHHHHHhhcCCCCCeec
Q psy12029          3 LQLLVPFYFQITES--SYFAD--RLFSCS--GCARVYKNKKSLARHQTYECGQEPQYFC   55 (81)
Q Consensus         3 ~~f~~~~~l~~~~~--~~~~~--~~~~C~--~c~~~~~~~~~l~~h~~~~~~~~~~~~c   55 (81)
                      ..|+....+..|..  .|.++  +++.|+  .|++.|.....+..|...|.+..+ +.+
T Consensus       297 ~~~s~~~~l~~~~~~~~h~~~~~~~~~~p~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~  354 (467)
T COG5048         297 ISFSRSSPLTRHLRSVNHSGESLKPFSCPYSLCGKLFSRNDALKRHILLHTSISP-AKE  354 (467)
T ss_pred             CCccccccccccccccccccccCCceeeeccCCCccccccccccCCcccccCCCc-ccc
Confidence            45677778888999  79999  999999  799999999999888888887665 544


No 61 
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning]
Probab=90.86  E-value=0.057  Score=31.07  Aligned_cols=23  Identities=35%  Similarity=0.748  Sum_probs=18.6

Q ss_pred             CCCceecCcchhhccCchHHHHH
Q psy12029         20 ADRLFSCSGCARVYKNKKSLARH   42 (81)
Q Consensus        20 ~~~~~~C~~c~~~~~~~~~l~~h   42 (81)
                      ..|||+|.+|++.++.-.-|.-|
T Consensus       395 ~~KPYrCevC~KRYKNlNGLKYH  417 (423)
T COG5189         395 KDKPYRCEVCDKRYKNLNGLKYH  417 (423)
T ss_pred             cCCceeccccchhhccCccceec
Confidence            35999999999999887666554


No 62 
>PF05443 ROS_MUCR:  ROS/MUCR transcriptional regulator protein;  InterPro: IPR008807 This family consists of several ROS/MUCR transcriptional regulator proteins. The ros chromosomal gene is present in octopine and nopaline strains of Agrobacterium tumefaciens as well as in Rhizobium meliloti (Sinorhizobium meliloti). This gene encodes a 15.5 kDa protein that specifically represses the virC and virD operons in the virulence region of the Ti plasmid [] and is necessary for succinoglycan production []. S. meliloti can produce two types of acidic exopolysaccharides, succinoglycan and galactoglucan, that are interchangeable for infection of Medicago sativa (Alfalfa) nodules. MucR from S. meliloti acts as a transcriptional repressor that blocks the expression of the exp genes responsible for galactoglucan production therefore allowing the exclusive production of succinoglycan [].; GO: 0003677 DNA binding, 0008270 zinc ion binding, 0006355 regulation of transcription, DNA-dependent; PDB: 2JSP_A.
Probab=90.75  E-value=0.2  Score=25.26  Aligned_cols=23  Identities=22%  Similarity=0.400  Sum_probs=14.7

Q ss_pred             eecCCCCcccCCchHHHHHHHhhcCC
Q psy12029         53 YFCPLCPYRAKQKTNLMTHMSIKHSH   78 (81)
Q Consensus        53 ~~c~~c~~~f~~~~~l~~h~~~~~~~   78 (81)
                      ..|.+||+.|...   ..|.+.|+|-
T Consensus        73 i~clecGk~~k~L---krHL~~~~gl   95 (132)
T PF05443_consen   73 IICLECGKKFKTL---KRHLRTHHGL   95 (132)
T ss_dssp             EE-TBT--EESBH---HHHHHHTT-S
T ss_pred             eEEccCCcccchH---HHHHHHccCC
Confidence            6899999987764   7788888763


No 63 
>PF04959 ARS2:  Arsenite-resistance protein 2;  InterPro: IPR007042 This entry represents Arsenite-resistance protein 2 (also known as Serrate RNA effector molecule homolog) which is thought to play a role in arsenite resistance [], although does not directly confer arsenite resistance but rather modulates arsenic sensitivity []. Arsenite is a carcinogenic compound which can act as a comutagen by inhibiting DNA repair. It is also involved in cell cycle progression at S phase. ; PDB: 3AX1_A.
Probab=90.73  E-value=0.24  Score=27.04  Aligned_cols=30  Identities=13%  Similarity=0.365  Sum_probs=22.1

Q ss_pred             cCCCceecCcchhhccCchHHHHHHHhhcC
Q psy12029         19 FADRLFSCSGCARVYKNKKSLARHQTYECG   48 (81)
Q Consensus        19 ~~~~~~~C~~c~~~~~~~~~l~~h~~~~~~   48 (81)
                      .++..|.|..|++.|.....+.+|+...+.
T Consensus        73 ~~~~K~~C~lc~KlFkg~eFV~KHI~nKH~  102 (214)
T PF04959_consen   73 EDEDKWRCPLCGKLFKGPEFVRKHIFNKHP  102 (214)
T ss_dssp             SSSEEEEE-SSS-EESSHHHHHHHHHHH-H
T ss_pred             HcCCEECCCCCCcccCChHHHHHHHhhcCH
Confidence            355679999999999999999999886443


No 64 
>COG1592 Rubrerythrin [Energy production and conversion]
Probab=90.70  E-value=0.17  Score=26.52  Aligned_cols=24  Identities=29%  Similarity=0.949  Sum_probs=17.5

Q ss_pred             CceecCcchhhccCchHHHHHHHhhcCCCCCeecCCCC
Q psy12029         22 RLFSCSGCARVYKNKKSLARHQTYECGQEPQYFCPLCP   59 (81)
Q Consensus        22 ~~~~C~~c~~~~~~~~~l~~h~~~~~~~~~~~~c~~c~   59 (81)
                      +.|.|.+||..             +.++.| ..|++||
T Consensus       133 ~~~vC~vCGy~-------------~~ge~P-~~CPiCg  156 (166)
T COG1592         133 KVWVCPVCGYT-------------HEGEAP-EVCPICG  156 (166)
T ss_pred             CEEEcCCCCCc-------------ccCCCC-CcCCCCC
Confidence            36899999744             344445 8999998


No 65 
>KOG4167|consensus
Probab=90.67  E-value=0.076  Score=33.76  Aligned_cols=26  Identities=27%  Similarity=0.539  Sum_probs=23.3

Q ss_pred             CceecCcchhhccCchHHHHHHHhhc
Q psy12029         22 RLFSCSGCARVYKNKKSLARHQTYEC   47 (81)
Q Consensus        22 ~~~~C~~c~~~~~~~~~l~~h~~~~~   47 (81)
                      .-|.|.+|++.|.-..++..||++|.
T Consensus       791 giFpCreC~kvF~KiKSrNAHMK~Hr  816 (907)
T KOG4167|consen  791 GIFPCRECGKVFFKIKSRNAHMKTHR  816 (907)
T ss_pred             ceeehHHHHHHHHHHhhhhHHHHHHH
Confidence            45999999999999999999999885


No 66 
>cd00729 rubredoxin_SM Rubredoxin, Small Modular nonheme iron binding domain containing a [Fe(SCys)4] center, present in rubrerythrin and nigerythrin and detected either N- or C-terminal to such proteins as flavin reductase, NAD(P)H-nitrite reductase, and ferredoxin-thioredoxin reductase. In rubredoxin, the iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), and  believed to be involved in electron transfer. Rubrerythrins and nigerythrins are small homodimeric proteins, generally consisting of 2 domains: a rubredoxin domain C-terminal to a non-sulfur, oxo-bridged diiron site in the N-terminal rubrerythrin domain. Rubrerythrins and nigerythrins have putative peroxide activity.
Probab=90.60  E-value=0.22  Score=18.92  Aligned_cols=25  Identities=24%  Similarity=0.797  Sum_probs=15.5

Q ss_pred             ceecCcchhhccCchHHHHHHHhhcCCCCCeecCCCCc
Q psy12029         23 LFSCSGCARVYKNKKSLARHQTYECGQEPQYFCPLCPY   60 (81)
Q Consensus        23 ~~~C~~c~~~~~~~~~l~~h~~~~~~~~~~~~c~~c~~   60 (81)
                      .|.|.+||..+...            ..| ..|+.|+.
T Consensus         2 ~~~C~~CG~i~~g~------------~~p-~~CP~Cg~   26 (34)
T cd00729           2 VWVCPVCGYIHEGE------------EAP-EKCPICGA   26 (34)
T ss_pred             eEECCCCCCEeECC------------cCC-CcCcCCCC
Confidence            46788888654321            134 67888874


No 67 
>PF04959 ARS2:  Arsenite-resistance protein 2;  InterPro: IPR007042 This entry represents Arsenite-resistance protein 2 (also known as Serrate RNA effector molecule homolog) which is thought to play a role in arsenite resistance [], although does not directly confer arsenite resistance but rather modulates arsenic sensitivity []. Arsenite is a carcinogenic compound which can act as a comutagen by inhibiting DNA repair. It is also involved in cell cycle progression at S phase. ; PDB: 3AX1_A.
Probab=90.39  E-value=0.14  Score=27.87  Aligned_cols=26  Identities=31%  Similarity=0.498  Sum_probs=20.5

Q ss_pred             eecCCCCcccCCchHHHHHHHhhcCC
Q psy12029         53 YFCPLCPYRAKQKTNLMTHMSIKHSH   78 (81)
Q Consensus        53 ~~c~~c~~~f~~~~~l~~h~~~~~~~   78 (81)
                      |.|.+|+|.|.-...+..|+..-|.|
T Consensus        78 ~~C~lc~KlFkg~eFV~KHI~nKH~e  103 (214)
T PF04959_consen   78 WRCPLCGKLFKGPEFVRKHIFNKHPE  103 (214)
T ss_dssp             EEE-SSS-EESSHHHHHHHHHHH-HH
T ss_pred             ECCCCCCcccCChHHHHHHHhhcCHH
Confidence            89999999999999999998876655


No 68 
>PF12013 DUF3505:  Protein of unknown function (DUF3505);  InterPro: IPR022698  This family of proteins is functionally uncharacterised. This protein is found in eukaryotes. Proteins in this family are typically between 247 to 1018 amino acids in length. This region contains two segments that are likely to be C2H2 zinc binding domains. 
Probab=89.86  E-value=0.4  Score=23.09  Aligned_cols=25  Identities=32%  Similarity=0.745  Sum_probs=22.4

Q ss_pred             eec----CCCCcccCCchHHHHHHHhhcC
Q psy12029         53 YFC----PLCPYRAKQKTNLMTHMSIKHS   77 (81)
Q Consensus        53 ~~c----~~c~~~f~~~~~l~~h~~~~~~   77 (81)
                      |.|    ..|+....+...+..|.+..||
T Consensus        81 ~~C~~~~~~C~y~~~~~~~m~~H~~~~Hg  109 (109)
T PF12013_consen   81 YRCQCDPPHCGYITRSKKTMRKHWRKEHG  109 (109)
T ss_pred             eeeecCCCCCCcEeccHHHHHHHHHHhcC
Confidence            789    8899999999999999998875


No 69 
>smart00834 CxxC_CXXC_SSSS Putative regulatory protein. CxxC_CXXC_SSSS represents a region of about 41 amino acids found in a number of small proteins in a wide range of bacteria. The region usually begins with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One protein in this entry has been noted as a putative regulatory protein, designated FmdB. Most proteins in this entry have a C-terminal region containing highly degenerate sequence.
Probab=88.67  E-value=0.12  Score=20.13  Aligned_cols=30  Identities=17%  Similarity=0.510  Sum_probs=19.5

Q ss_pred             ceecCcchhhccCchHHHHHHHhhcCCCCCeecCCCCc
Q psy12029         23 LFSCSGCARVYKNKKSLARHQTYECGQEPQYFCPLCPY   60 (81)
Q Consensus        23 ~~~C~~c~~~~~~~~~l~~h~~~~~~~~~~~~c~~c~~   60 (81)
                      .|.|..||..|......      .. ... ..|+.||.
T Consensus         5 ~y~C~~Cg~~fe~~~~~------~~-~~~-~~CP~Cg~   34 (41)
T smart00834        5 EYRCEDCGHTFEVLQKI------SD-DPL-ATCPECGG   34 (41)
T ss_pred             EEEcCCCCCEEEEEEec------CC-CCC-CCCCCCCC
Confidence            47899999887654432      11 233 57888886


No 70 
>TIGR02605 CxxC_CxxC_SSSS putative regulatory protein, FmdB family. This model represents a region of about 50 amino acids found in a number of small proteins in a wide range of bacteria. The region begins usually with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One member of this family is has been noted as a putative regulatory protein, designated FmdB (PubMed:8841393). Most members of this family have a C-terminal region containing highly degenerate sequence, such as SSTSESTKSSGSSGSSGSSESKASGSTEKSTSSTTAAAAV in Mycobacterium tuberculosis and VAVGGSAPAPSPAPRAGGGGGGCCGGGCCG in Streptomyces avermitilis. These low complexity regions, which are not included in the model, resemble low-complexity C-terminal regions of some heterocycle-containing bacteriocin precursors.
Probab=88.65  E-value=0.12  Score=21.37  Aligned_cols=30  Identities=17%  Similarity=0.506  Sum_probs=19.3

Q ss_pred             ceecCcchhhccCchHHHHHHHhhcCCCCCeecCCCCc
Q psy12029         23 LFSCSGCARVYKNKKSLARHQTYECGQEPQYFCPLCPY   60 (81)
Q Consensus        23 ~~~C~~c~~~~~~~~~l~~h~~~~~~~~~~~~c~~c~~   60 (81)
                      .|.|..|+..|......      .. ... ..|+.||.
T Consensus         5 ey~C~~Cg~~fe~~~~~------~~-~~~-~~CP~Cg~   34 (52)
T TIGR02605         5 EYRCTACGHRFEVLQKM------SD-DPL-ATCPECGG   34 (52)
T ss_pred             EEEeCCCCCEeEEEEec------CC-CCC-CCCCCCCC
Confidence            47899999887654321      11 234 57888885


No 71 
>smart00659 RPOLCX RNA polymerase subunit CX. present in RNA polymerase I, II and III
Probab=88.45  E-value=0.5  Score=19.12  Aligned_cols=27  Identities=30%  Similarity=0.752  Sum_probs=17.7

Q ss_pred             ceecCcchhhccCchHHHHHHHhhcCCCCCeecCCCCcc
Q psy12029         23 LFSCSGCARVYKNKKSLARHQTYECGQEPQYFCPLCPYR   61 (81)
Q Consensus        23 ~~~C~~c~~~~~~~~~l~~h~~~~~~~~~~~~c~~c~~~   61 (81)
                      .|.|..||..+...           ...+ ..|+.||..
T Consensus         2 ~Y~C~~Cg~~~~~~-----------~~~~-irC~~CG~r   28 (44)
T smart00659        2 IYICGECGRENEIK-----------SKDV-VRCRECGYR   28 (44)
T ss_pred             EEECCCCCCEeecC-----------CCCc-eECCCCCce
Confidence            47888888766543           1234 788888754


No 72 
>smart00614 ZnF_BED BED zinc finger. DNA-binding domain in chromatin-boundary-element-binding proteins and transposases
Probab=88.27  E-value=0.64  Score=19.12  Aligned_cols=8  Identities=38%  Similarity=0.667  Sum_probs=3.8

Q ss_pred             hHHHHHHH
Q psy12029         66 TNLMTHMS   73 (81)
Q Consensus        66 ~~l~~h~~   73 (81)
                      ++|..|+.
T Consensus        37 s~L~rHl~   44 (50)
T smart00614       37 SNLRRHLR   44 (50)
T ss_pred             HHHHHHHH
Confidence            34555544


No 73 
>TIGR02300 FYDLN_acid conserved hypothetical protein TIGR02300. Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues. The function of members of this family is unknown.
Probab=87.81  E-value=0.44  Score=23.87  Aligned_cols=30  Identities=10%  Similarity=0.217  Sum_probs=19.6

Q ss_pred             eecCcchhhccCchHHHHHHHhhcCCCCCeecCCCCcccCCc
Q psy12029         24 FSCSGCARVYKNKKSLARHQTYECGQEPQYFCPLCPYRAKQK   65 (81)
Q Consensus        24 ~~C~~c~~~~~~~~~l~~h~~~~~~~~~~~~c~~c~~~f~~~   65 (81)
                      ..|+.||+.|-.           ....| ..|+.||..|...
T Consensus        10 r~Cp~cg~kFYD-----------Lnk~p-~vcP~cg~~~~~~   39 (129)
T TIGR02300        10 RICPNTGSKFYD-----------LNRRP-AVSPYTGEQFPPE   39 (129)
T ss_pred             ccCCCcCccccc-----------cCCCC-ccCCCcCCccCcc
Confidence            468888877633           22345 7888888776544


No 74 
>TIGR00373 conserved hypothetical protein TIGR00373. This family of proteins is, so far, restricted to archaeal genomes. The family appears to be distantly related to the N-terminal region of the eukaryotic transcription initiation factor IIE alpha chain.
Probab=87.50  E-value=0.44  Score=24.69  Aligned_cols=38  Identities=13%  Similarity=0.311  Sum_probs=26.5

Q ss_pred             cccCCCceecCcchhhccCchHHHHHHHhhcCCCCCeecCCCCcccCC
Q psy12029         17 SYFADRLFSCSGCARVYKNKKSLARHQTYECGQEPQYFCPLCPYRAKQ   64 (81)
Q Consensus        17 ~~~~~~~~~C~~c~~~~~~~~~l~~h~~~~~~~~~~~~c~~c~~~f~~   64 (81)
                      ......-|.|+.|+..|+....+.         .. |.|+.||.....
T Consensus       103 ~e~~~~~Y~Cp~c~~r~tf~eA~~---------~~-F~Cp~Cg~~L~~  140 (158)
T TIGR00373       103 FETNNMFFICPNMCVRFTFNEAME---------LN-FTCPRCGAMLDY  140 (158)
T ss_pred             hccCCCeEECCCCCcEeeHHHHHH---------cC-CcCCCCCCEeee
Confidence            344556688999998877765542         24 999999876543


No 75 
>smart00734 ZnF_Rad18 Rad18-like CCHC zinc finger. Yeast Rad18p functions with Rad5p in error-free post-replicative DNA repair. This zinc finger is likely to bind nucleic-acids.
Probab=87.25  E-value=0.85  Score=16.19  Aligned_cols=19  Identities=21%  Similarity=0.607  Sum_probs=11.3

Q ss_pred             ecCCCCcccCCchHHHHHHH
Q psy12029         54 FCPLCPYRAKQKTNLMTHMS   73 (81)
Q Consensus        54 ~c~~c~~~f~~~~~l~~h~~   73 (81)
                      .|++|++.+ ....++.|..
T Consensus         3 ~CPiC~~~v-~~~~in~HLD   21 (26)
T smart00734        3 QCPVCFREV-PENLINSHLD   21 (26)
T ss_pred             cCCCCcCcc-cHHHHHHHHH
Confidence            566776665 4445666654


No 76 
>PRK00398 rpoP DNA-directed RNA polymerase subunit P; Provisional
Probab=86.65  E-value=0.28  Score=19.82  Aligned_cols=30  Identities=27%  Similarity=0.654  Sum_probs=19.4

Q ss_pred             CceecCcchhhccCchHHHHHHHhhcCCCCCeecCCCCccc
Q psy12029         22 RLFSCSGCARVYKNKKSLARHQTYECGQEPQYFCPLCPYRA   62 (81)
Q Consensus        22 ~~~~C~~c~~~~~~~~~l~~h~~~~~~~~~~~~c~~c~~~f   62 (81)
                      ..|.|+.||..+.....          ... +.|+.||..+
T Consensus         2 ~~y~C~~CG~~~~~~~~----------~~~-~~Cp~CG~~~   31 (46)
T PRK00398          2 AEYKCARCGREVELDEY----------GTG-VRCPYCGYRI   31 (46)
T ss_pred             CEEECCCCCCEEEECCC----------CCc-eECCCCCCeE
Confidence            35889999877655331          114 7888888644


No 77 
>smart00531 TFIIE Transcription initiation factor IIE.
Probab=86.48  E-value=0.84  Score=23.32  Aligned_cols=40  Identities=15%  Similarity=0.459  Sum_probs=25.9

Q ss_pred             cCCCceecCcchhhccCchHHHHHHHhhcCCCCCeecCCCCcccC
Q psy12029         19 FADRLFSCSGCARVYKNKKSLARHQTYECGQEPQYFCPLCPYRAK   63 (81)
Q Consensus        19 ~~~~~~~C~~c~~~~~~~~~l~~h~~~~~~~~~~~~c~~c~~~f~   63 (81)
                      ....-|.|+.|+..|.....+..   ... ... |.|+.||....
T Consensus        95 ~~~~~Y~Cp~C~~~y~~~ea~~~---~d~-~~~-f~Cp~Cg~~l~  134 (147)
T smart00531       95 TNNAYYKCPNCQSKYTFLEANQL---LDM-DGT-FTCPRCGEELE  134 (147)
T ss_pred             cCCcEEECcCCCCEeeHHHHHHh---cCC-CCc-EECCCCCCEEE
Confidence            34556999999988876443221   112 334 99999997654


No 78 
>PRK06266 transcription initiation factor E subunit alpha; Validated
Probab=85.94  E-value=0.55  Score=24.87  Aligned_cols=37  Identities=16%  Similarity=0.437  Sum_probs=25.7

Q ss_pred             ccCCCceecCcchhhccCchHHHHHHHhhcCCCCCeecCCCCcccCC
Q psy12029         18 YFADRLFSCSGCARVYKNKKSLARHQTYECGQEPQYFCPLCPYRAKQ   64 (81)
Q Consensus        18 ~~~~~~~~C~~c~~~~~~~~~l~~h~~~~~~~~~~~~c~~c~~~f~~   64 (81)
                      .....-|.|+.|+..|+....+.         .. |.|+.||.....
T Consensus       112 e~~~~~Y~Cp~C~~rytf~eA~~---------~~-F~Cp~Cg~~L~~  148 (178)
T PRK06266        112 EENNMFFFCPNCHIRFTFDEAME---------YG-FRCPQCGEMLEE  148 (178)
T ss_pred             ccCCCEEECCCCCcEEeHHHHhh---------cC-CcCCCCCCCCee
Confidence            33455689999998877765431         24 999999976543


No 79 
>PF15269 zf-C2H2_7:  Zinc-finger
Probab=85.33  E-value=0.8  Score=18.62  Aligned_cols=22  Identities=36%  Similarity=0.898  Sum_probs=15.9

Q ss_pred             eecCCCCcccCCchHHHHHHHh
Q psy12029         53 YFCPLCPYRAKQKTNLMTHMSI   74 (81)
Q Consensus        53 ~~c~~c~~~f~~~~~l~~h~~~   74 (81)
                      |+|.+|.-+....+.|-+|+.-
T Consensus        21 ykcfqcpftc~~kshl~nhmky   42 (54)
T PF15269_consen   21 YKCFQCPFTCNEKSHLFNHMKY   42 (54)
T ss_pred             ceeecCCcccchHHHHHHHHHH
Confidence            5677777777777777777764


No 80 
>KOG3408|consensus
Probab=85.20  E-value=0.9  Score=22.60  Aligned_cols=27  Identities=30%  Similarity=0.492  Sum_probs=22.6

Q ss_pred             cCCCceecCcchhhccCchHHHHHHHh
Q psy12029         19 FADRLFSCSGCARVYKNKKSLARHQTY   45 (81)
Q Consensus        19 ~~~~~~~C~~c~~~~~~~~~l~~h~~~   45 (81)
                      +|...|.|..|.+-|.....|..|-++
T Consensus        53 PG~GqfyCi~CaRyFi~~~~l~~H~kt   79 (129)
T KOG3408|consen   53 PGGGQFYCIECARYFIDAKALKTHFKT   79 (129)
T ss_pred             CCCceeehhhhhhhhcchHHHHHHHhc
Confidence            455678999999999999999888774


No 81 
>PRK09678 DNA-binding transcriptional regulator; Provisional
Probab=84.87  E-value=0.28  Score=22.11  Aligned_cols=37  Identities=16%  Similarity=0.193  Sum_probs=18.2

Q ss_pred             ecCcchhhccCchHHHHHHHhhcCCCCCeecC--CCCcccCC
Q psy12029         25 SCSGCARVYKNKKSLARHQTYECGQEPQYFCP--LCPYRAKQ   64 (81)
Q Consensus        25 ~C~~c~~~~~~~~~l~~h~~~~~~~~~~~~c~--~c~~~f~~   64 (81)
                      .|+.||.......+-..  .....+.. +.|.  .||..|..
T Consensus         3 ~CP~Cg~~a~irtSr~~--s~~~~~~Y-~qC~N~eCg~tF~t   41 (72)
T PRK09678          3 HCPLCQHAAHARTSRYI--TDTTKERY-HQCQNVNCSATFIT   41 (72)
T ss_pred             cCCCCCCccEEEEChhc--Chhhheee-eecCCCCCCCEEEE
Confidence            57777765433332111  11123344 6676  67776654


No 82 
>cd00924 Cyt_c_Oxidase_Vb Cytochrome c oxidase subunit Vb.  Cytochrome c oxidase (CcO), the terminal oxidase in the respiratory chains of eukaryotes and most bacteria, is a multi-chain transmembrane protein located in the inner membrane of mitochondria and the cell membrane of prokaryotes.  It catalyzes the reduction of O2 and simultaneously pumps protons across the membrane.  The number of subunits varies from three to five in bacteria and up to 13 in mammalian mitochondria. Subunits I, II, and III of mammalian CcO are encoded within the mitochondrial genome and the remaining 10 subunits are encoded within the nuclear genome.  Found only in eukaryotes, subunit Vb is one of three mammalian subunits that lacks a transmembrane region.  Subunit Vb is located on the matrix side of the membrane and binds the regulatory subunit of protein kinase A.  The abnormally extended conformation is stable only in the CcO assembly.
Probab=84.44  E-value=0.45  Score=22.71  Aligned_cols=10  Identities=30%  Similarity=0.481  Sum_probs=5.3

Q ss_pred             eecCCCCccc
Q psy12029         53 YFCPLCPYRA   62 (81)
Q Consensus        53 ~~c~~c~~~f   62 (81)
                      .+|.+||..|
T Consensus        80 ~rC~eCG~~f   89 (97)
T cd00924          80 KRCPECGHVF   89 (97)
T ss_pred             eeCCCCCcEE
Confidence            5555555444


No 83 
>PRK14890 putative Zn-ribbon RNA-binding protein; Provisional
Probab=84.00  E-value=1.3  Score=19.16  Aligned_cols=33  Identities=27%  Similarity=0.695  Sum_probs=18.6

Q ss_pred             CceecCcchhhccCchHHHHHHHhhcCCCCCeecCCCCc
Q psy12029         22 RLFSCSGCARVYKNKKSLARHQTYECGQEPQYFCPLCPY   60 (81)
Q Consensus        22 ~~~~C~~c~~~~~~~~~l~~h~~~~~~~~~~~~c~~c~~   60 (81)
                      ..|.|+.||..--...     .+-.....+ |.|+.||.
T Consensus        24 ~~F~CPnCG~~~I~RC-----~~CRk~~~~-Y~CP~CGF   56 (59)
T PRK14890         24 VKFLCPNCGEVIIYRC-----EKCRKQSNP-YTCPKCGF   56 (59)
T ss_pred             CEeeCCCCCCeeEeec-----hhHHhcCCc-eECCCCCC
Confidence            4588999886522221     111112356 89988873


No 84 
>PF02892 zf-BED:  BED zinc finger;  InterPro: IPR003656 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents predicted BED-type zinc finger domains. The BED finger which was named after the Drosophila proteins BEAF and DREF, is found in one or more copies in cellular regulatory factors and transposases from plants, animals and fungi. The BED finger is an about 50 to 60 amino acid residues domain that contains a characteristic motif with two highly conserved aromatic positions, as well as a shared pattern of cysteines and histidines that is predicted to form a zinc finger. As diverse BED fingers are able to bind DNA, it has been suggested that DNA-binding is the general function of this domain []. Some proteins known to contain a BED domain include animal, plant and fungi AC1 and Hobo-like transposases; Caenorhabditis elegans Dpy-20 protein, a predicted cuticular gene transcriptional regulator; Drosophila BEAF (boundary element-associated factor), thought to be involved in chromatin insulation; Drosophila DREF, a transcriptional regulator for S-phase genes; and tobacco 3AF1 and tomato E4/E8-BP1, light- and ethylene-regulated DNA binding proteins that contain two BED fingers. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003677 DNA binding; PDB: 2DJR_A 2CT5_A.
Probab=83.28  E-value=2.1  Score=16.89  Aligned_cols=11  Identities=36%  Similarity=0.788  Sum_probs=4.3

Q ss_pred             eecCcchhhcc
Q psy12029         24 FSCSGCARVYK   34 (81)
Q Consensus        24 ~~C~~c~~~~~   34 (81)
                      ..|..|++.+.
T Consensus        17 a~C~~C~~~~~   27 (45)
T PF02892_consen   17 AKCKYCGKVIK   27 (45)
T ss_dssp             EEETTTTEE--
T ss_pred             EEeCCCCeEEe
Confidence            44555544433


No 85 
>COG3091 SprT Zn-dependent metalloprotease, SprT family [General function prediction only]
Probab=81.79  E-value=0.48  Score=24.48  Aligned_cols=36  Identities=28%  Similarity=0.622  Sum_probs=23.0

Q ss_pred             CCceecCcchhhccCchHHHHHHHhhcCCCCCeecCCCCccc
Q psy12029         21 DRLFSCSGCARVYKNKKSLARHQTYECGQEPQYFCPLCPYRA   62 (81)
Q Consensus        21 ~~~~~C~~c~~~~~~~~~l~~h~~~~~~~~~~~~c~~c~~~f   62 (81)
                      .-+|.|. |+..+....   +|-....|+ . |.|..|+...
T Consensus       115 ~~~Y~C~-C~q~~l~~R---Rhn~~~~g~-~-YrC~~C~gkL  150 (156)
T COG3091         115 TYPYRCQ-CQQHYLRIR---RHNTVRRGE-V-YRCGKCGGKL  150 (156)
T ss_pred             ceeEEee-cCCccchhh---hcccccccc-e-EEeccCCceE
Confidence            4468899 987754432   333344455 5 9999997543


No 86 
>PRK00464 nrdR transcriptional regulator NrdR; Validated
Probab=81.66  E-value=0.23  Score=25.67  Aligned_cols=11  Identities=27%  Similarity=0.383  Sum_probs=5.8

Q ss_pred             eecCCCCcccC
Q psy12029         53 YFCPLCPYRAK   63 (81)
Q Consensus        53 ~~c~~c~~~f~   63 (81)
                      +.|+.||++|.
T Consensus        29 ~~c~~c~~~f~   39 (154)
T PRK00464         29 RECLACGKRFT   39 (154)
T ss_pred             eeccccCCcce
Confidence            45555555554


No 87 
>COG1996 RPC10 DNA-directed RNA polymerase, subunit RPC10 (contains C4-type Zn-finger) [Transcription]
Probab=81.43  E-value=1  Score=18.72  Aligned_cols=29  Identities=24%  Similarity=0.555  Sum_probs=18.4

Q ss_pred             CceecCcchhhccCchHHHHHHHhhcCCCCCeecCCCCcc
Q psy12029         22 RLFSCSGCARVYKNKKSLARHQTYECGQEPQYFCPLCPYR   61 (81)
Q Consensus        22 ~~~~C~~c~~~~~~~~~l~~h~~~~~~~~~~~~c~~c~~~   61 (81)
                      ..|.|..|++.+...          ..... ..|+.||..
T Consensus         5 ~~Y~C~~Cg~~~~~~----------~~~~~-irCp~Cg~r   33 (49)
T COG1996           5 MEYKCARCGREVELD----------QETRG-IRCPYCGSR   33 (49)
T ss_pred             EEEEhhhcCCeeehh----------hccCc-eeCCCCCcE
Confidence            458899999887211          11233 788888753


No 88 
>PF10013 DUF2256:  Uncharacterized protein conserved in bacteria (DUF2256);  InterPro: IPR017136 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function.
Probab=80.72  E-value=1.5  Score=17.60  Aligned_cols=14  Identities=29%  Similarity=0.724  Sum_probs=9.2

Q ss_pred             cCcchhhccCchHH
Q psy12029         26 CSGCARVYKNKKSL   39 (81)
Q Consensus        26 C~~c~~~~~~~~~l   39 (81)
                      |.+|+..|......
T Consensus        11 C~~C~rpf~WRKKW   24 (42)
T PF10013_consen   11 CPVCGRPFTWRKKW   24 (42)
T ss_pred             CcccCCcchHHHHH
Confidence            77777777665543


No 89 
>PTZ00255 60S ribosomal protein L37a; Provisional
Probab=80.53  E-value=0.49  Score=22.29  Aligned_cols=31  Identities=13%  Similarity=0.319  Sum_probs=19.3

Q ss_pred             CceecCcchhhccCchHHHHHHHhhcCCCCCeecCCCCcccC
Q psy12029         22 RLFSCSGCARVYKNKKSLARHQTYECGQEPQYFCPLCPYRAK   63 (81)
Q Consensus        22 ~~~~C~~c~~~~~~~~~l~~h~~~~~~~~~~~~c~~c~~~f~   63 (81)
                      ..|.|+.|++.-     +   .+.  +.-. |.|..|++.|.
T Consensus        35 a~y~CpfCgk~~-----v---kR~--a~GI-W~C~~C~~~~A   65 (90)
T PTZ00255         35 AKYFCPFCGKHA-----V---KRQ--AVGI-WRCKGCKKTVA   65 (90)
T ss_pred             CCccCCCCCCCc-----e---eee--eeEE-EEcCCCCCEEe
Confidence            468899887531     1   112  1235 99999988764


No 90 
>KOG4167|consensus
Probab=80.53  E-value=0.31  Score=31.29  Aligned_cols=24  Identities=17%  Similarity=0.236  Sum_probs=21.4

Q ss_pred             eecCCCCcccCCchHHHHHHHhhc
Q psy12029         53 YFCPLCPYRAKQKTNLMTHMSIKH   76 (81)
Q Consensus        53 ~~c~~c~~~f~~~~~l~~h~~~~~   76 (81)
                      |-|.+|++.|.-...++.|+++|.
T Consensus       793 FpCreC~kvF~KiKSrNAHMK~Hr  816 (907)
T KOG4167|consen  793 FPCRECGKVFFKIKSRNAHMKTHR  816 (907)
T ss_pred             eehHHHHHHHHHHhhhhHHHHHHH
Confidence            889999999998888999998874


No 91 
>KOG2593|consensus
Probab=80.47  E-value=1.3  Score=26.74  Aligned_cols=43  Identities=16%  Similarity=0.354  Sum_probs=27.1

Q ss_pred             cccccCCCceecCcchhhccCchHHHHHHHhhcCCCCCeecCCCCcc
Q psy12029         15 ESSYFADRLFSCSGCARVYKNKKSLARHQTYECGQEPQYFCPLCPYR   61 (81)
Q Consensus        15 ~~~~~~~~~~~C~~c~~~~~~~~~l~~h~~~~~~~~~~~~c~~c~~~   61 (81)
                      ++..+...-|.|+.|.+.|..--.+   +-.....-. |.|..|+.-
T Consensus       120 ~~d~t~~~~Y~Cp~C~kkyt~Lea~---~L~~~~~~~-F~C~~C~ge  162 (436)
T KOG2593|consen  120 LRDDTNVAGYVCPNCQKKYTSLEAL---QLLDNETGE-FHCENCGGE  162 (436)
T ss_pred             hhhccccccccCCccccchhhhHHH---HhhcccCce-EEEecCCCc
Confidence            3445566779999999888765443   222222234 899888753


No 92 
>TIGR00280 L37a ribosomal protein L37a. This model finds eukaryotic ribosomal protein L37a and its archaeal orthologs. The nomeclature is tricky because eukaryotes have proteins called both L37 and L37a.
Probab=79.61  E-value=0.49  Score=22.31  Aligned_cols=31  Identities=13%  Similarity=0.358  Sum_probs=19.0

Q ss_pred             CceecCcchhhccCchHHHHHHHhhcCCCCCeecCCCCcccC
Q psy12029         22 RLFSCSGCARVYKNKKSLARHQTYECGQEPQYFCPLCPYRAK   63 (81)
Q Consensus        22 ~~~~C~~c~~~~~~~~~l~~h~~~~~~~~~~~~c~~c~~~f~   63 (81)
                      ..|.|+.|++.-     +   .+.-  .-. |.|..|++.|.
T Consensus        34 a~y~CpfCgk~~-----v---kR~a--~GI-W~C~~C~~~~A   64 (91)
T TIGR00280        34 AKYVCPFCGKKT-----V---KRGS--TGI-WTCRKCGAKFA   64 (91)
T ss_pred             cCccCCCCCCCc-----e---EEEe--eEE-EEcCCCCCEEe
Confidence            458888887531     1   1222  235 89999988764


No 93 
>KOG2785|consensus
Probab=79.60  E-value=3.4  Score=24.74  Aligned_cols=52  Identities=19%  Similarity=0.269  Sum_probs=38.7

Q ss_pred             CceecCcchhhccCchHHHHHHHhhcCCCCC----------------------eecCCCC---cccCCchHHHHHHH
Q psy12029         22 RLFSCSGCARVYKNKKSLARHQTYECGQEPQ----------------------YFCPLCP---YRAKQKTNLMTHMS   73 (81)
Q Consensus        22 ~~~~C~~c~~~~~~~~~l~~h~~~~~~~~~~----------------------~~c~~c~---~~f~~~~~l~~h~~   73 (81)
                      .|-.|-.|++.+.....-..||..++|--.|                      +.|..|+   +.|.+......|+.
T Consensus       165 ~Pt~CLfC~~~~k~~e~~~~HM~~~HgffIPdreYL~D~~GLl~YLgeKV~~~~~CL~CN~~~~~f~sleavr~HM~  241 (390)
T KOG2785|consen  165 IPTDCLFCDKKSKSLEENLKHMFKEHGFFIPDREYLTDEKGLLKYLGEKVGIGFICLFCNELGRPFSSLEAVRAHMR  241 (390)
T ss_pred             CCcceeecCCCcccHHHHHHHHhhccCCcCCchHhhhchhHHHHHHHHHhccCceEEEeccccCcccccHHHHHHHh
Confidence            4566888999888877777888877663222                      5677776   88888888888876


No 94 
>PF07754 DUF1610:  Domain of unknown function (DUF1610);  InterPro: IPR011668 This domain is found in archaeal species. It is likely to bind zinc via its four well-conserved cysteine residues.
Probab=79.56  E-value=0.94  Score=15.89  Aligned_cols=10  Identities=30%  Similarity=0.806  Sum_probs=7.6

Q ss_pred             CceecCcchh
Q psy12029         22 RLFSCSGCAR   31 (81)
Q Consensus        22 ~~~~C~~c~~   31 (81)
                      ..|.|+.||.
T Consensus        15 v~f~CPnCG~   24 (24)
T PF07754_consen   15 VPFPCPNCGF   24 (24)
T ss_pred             ceEeCCCCCC
Confidence            4688998873


No 95 
>COG3364 Zn-ribbon containing protein [General function prediction only]
Probab=79.45  E-value=1.1  Score=21.62  Aligned_cols=17  Identities=18%  Similarity=0.606  Sum_probs=13.8

Q ss_pred             CceecCcchhhccCchH
Q psy12029         22 RLFSCSGCARVYKNKKS   38 (81)
Q Consensus        22 ~~~~C~~c~~~~~~~~~   38 (81)
                      .|+.|..||..|.....
T Consensus         1 MpH~CtrCG~vf~~g~~   17 (112)
T COG3364           1 MPHQCTRCGEVFDDGSE   17 (112)
T ss_pred             CCceecccccccccccH
Confidence            37889999999988654


No 96 
>PLN02294 cytochrome c oxidase subunit Vb
Probab=79.26  E-value=0.96  Score=23.87  Aligned_cols=22  Identities=14%  Similarity=0.230  Sum_probs=15.3

Q ss_pred             ccccccCCCceecCcchhhccCc
Q psy12029         14 TESSYFADRLFSCSGCARVYKNK   36 (81)
Q Consensus        14 ~~~~~~~~~~~~C~~c~~~~~~~   36 (81)
                      ++..+-+ ++++|++||..|...
T Consensus       133 Wf~L~kG-kp~RCpeCG~~fkL~  154 (174)
T PLN02294        133 WFWLEKG-KSFECPVCTQYFELE  154 (174)
T ss_pred             EEEecCC-CceeCCCCCCEEEEE
Confidence            3444444 688999999888654


No 97 
>PF14353 CpXC:  CpXC protein
Probab=78.65  E-value=2.7  Score=20.80  Aligned_cols=12  Identities=25%  Similarity=0.808  Sum_probs=8.2

Q ss_pred             eecCCCCcccCC
Q psy12029         53 YFCPLCPYRAKQ   64 (81)
Q Consensus        53 ~~c~~c~~~f~~   64 (81)
                      +.|+.||..|.-
T Consensus        39 ~~CP~Cg~~~~~   50 (128)
T PF14353_consen   39 FTCPSCGHKFRL   50 (128)
T ss_pred             EECCCCCCceec
Confidence            678888776543


No 98 
>PF13878 zf-C2H2_3:  zinc-finger of acetyl-transferase ESCO
Probab=76.81  E-value=3.3  Score=16.37  Aligned_cols=24  Identities=21%  Similarity=0.515  Sum_probs=16.5

Q ss_pred             eecCcchhhccCc--hHHHHHHHhhc
Q psy12029         24 FSCSGCARVYKNK--KSLARHQTYEC   47 (81)
Q Consensus        24 ~~C~~c~~~~~~~--~~l~~h~~~~~   47 (81)
                      -.|+.||-.|...  .+...|.+.|.
T Consensus        14 ~~C~~CgM~Y~~~~~eD~~~H~~yH~   39 (41)
T PF13878_consen   14 TTCPTCGMLYSPGSPEDEKLHKKYHD   39 (41)
T ss_pred             cCCCCCCCEECCCCHHHHHHHHHHHh
Confidence            5799999877654  45667766653


No 99 
>PRK03824 hypA hydrogenase nickel incorporation protein; Provisional
Probab=76.46  E-value=0.93  Score=22.92  Aligned_cols=15  Identities=20%  Similarity=0.662  Sum_probs=11.8

Q ss_pred             CceecCcchhhccCc
Q psy12029         22 RLFSCSGCARVYKNK   36 (81)
Q Consensus        22 ~~~~C~~c~~~~~~~   36 (81)
                      ..+.|..||..|...
T Consensus        69 ~~~~C~~CG~~~~~~   83 (135)
T PRK03824         69 AVLKCRNCGNEWSLK   83 (135)
T ss_pred             eEEECCCCCCEEecc
Confidence            458899999887664


No 100
>PHA00626 hypothetical protein
Probab=76.08  E-value=1.6  Score=18.73  Aligned_cols=16  Identities=13%  Similarity=0.389  Sum_probs=12.1

Q ss_pred             CCceecCcchhhccCc
Q psy12029         21 DRLFSCSGCARVYKNK   36 (81)
Q Consensus        21 ~~~~~C~~c~~~~~~~   36 (81)
                      ...|.|+.||..|+..
T Consensus        21 snrYkCkdCGY~ft~~   36 (59)
T PHA00626         21 SDDYVCCDCGYNDSKD   36 (59)
T ss_pred             CcceEcCCCCCeechh
Confidence            4679999999777553


No 101
>COG4957 Predicted transcriptional regulator [Transcription]
Probab=75.05  E-value=2.5  Score=21.56  Aligned_cols=22  Identities=18%  Similarity=0.232  Sum_probs=16.3

Q ss_pred             eecCCCCcccCCchHHHHHHHhhcC
Q psy12029         53 YFCPLCPYRAKQKTNLMTHMSIKHS   77 (81)
Q Consensus        53 ~~c~~c~~~f~~~~~l~~h~~~~~~   77 (81)
                      ..|.++|+.|.   .|..|..+|.|
T Consensus        77 IicLEDGkkfK---SLKRHL~t~~g   98 (148)
T COG4957          77 IICLEDGKKFK---SLKRHLTTHYG   98 (148)
T ss_pred             EEEeccCcchH---HHHHHHhcccC
Confidence            56888888765   46778888775


No 102
>PRK03976 rpl37ae 50S ribosomal protein L37Ae; Reviewed
Probab=74.94  E-value=0.7  Score=21.76  Aligned_cols=31  Identities=16%  Similarity=0.343  Sum_probs=18.4

Q ss_pred             CceecCcchhhccCchHHHHHHHhhcCCCCCeecCCCCcccC
Q psy12029         22 RLFSCSGCARVYKNKKSLARHQTYECGQEPQYFCPLCPYRAK   63 (81)
Q Consensus        22 ~~~~C~~c~~~~~~~~~l~~h~~~~~~~~~~~~c~~c~~~f~   63 (81)
                      ..|.|+.|++.-     +   .+.-  .-. |.|..|++.|.
T Consensus        35 a~y~CpfCgk~~-----v---kR~a--~GI-W~C~~C~~~~A   65 (90)
T PRK03976         35 AKHVCPVCGRPK-----V---KRVG--TGI-WECRKCGAKFA   65 (90)
T ss_pred             cCccCCCCCCCc-----e---EEEE--EEE-EEcCCCCCEEe
Confidence            457888886431     1   1222  225 88998987664


No 103
>PF10571 UPF0547:  Uncharacterised protein family UPF0547;  InterPro: IPR018886  This domain may well be a type of zinc-finger as it carries two pairs of highly conserved cysteine residues though with no accompanying histidines. Several members are annotated as putative helicases. 
Probab=74.23  E-value=2  Score=15.26  Aligned_cols=11  Identities=45%  Similarity=1.162  Sum_probs=7.0

Q ss_pred             eecCCCCcccC
Q psy12029         53 YFCPLCPYRAK   63 (81)
Q Consensus        53 ~~c~~c~~~f~   63 (81)
                      -.|+.||..|.
T Consensus        15 ~~Cp~CG~~F~   25 (26)
T PF10571_consen   15 KFCPHCGYDFE   25 (26)
T ss_pred             CcCCCCCCCCc
Confidence            35677777664


No 104
>KOG1842|consensus
Probab=74.09  E-value=1.9  Score=26.36  Aligned_cols=25  Identities=24%  Similarity=0.727  Sum_probs=13.2

Q ss_pred             eecCCCCcccCCchHHHHHHHhhcC
Q psy12029         53 YFCPLCPYRAKQKTNLMTHMSIKHS   77 (81)
Q Consensus        53 ~~c~~c~~~f~~~~~l~~h~~~~~~   77 (81)
                      |.|++|...|.+...|+.|....|+
T Consensus        16 flCPiC~~dl~~~~~L~~H~d~eH~   40 (505)
T KOG1842|consen   16 FLCPICLLDLPNLSALNDHLDVEHF   40 (505)
T ss_pred             ccCchHhhhhhhHHHHHHHHhhhcc
Confidence            4555555555555555555554443


No 105
>PF09723 Zn-ribbon_8:  Zinc ribbon domain;  InterPro: IPR013429  This entry represents a region of about 41 amino acids found in a number of small proteins in a wide range of bacteria. The region usually begins with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One protein in this entry has been noted as a putative regulatory protein, designated FmdB []. Most proteins in this entry have a C-terminal region containing highly degenerate sequence.
Probab=74.08  E-value=1.8  Score=17.15  Aligned_cols=13  Identities=23%  Similarity=0.416  Sum_probs=9.5

Q ss_pred             eecCCCCcccCCc
Q psy12029         53 YFCPLCPYRAKQK   65 (81)
Q Consensus        53 ~~c~~c~~~f~~~   65 (81)
                      |.|..||..|...
T Consensus         6 y~C~~Cg~~fe~~   18 (42)
T PF09723_consen    6 YRCEECGHEFEVL   18 (42)
T ss_pred             EEeCCCCCEEEEE
Confidence            7788888777544


No 106
>KOG1146|consensus
Probab=73.12  E-value=3.1  Score=28.91  Aligned_cols=58  Identities=21%  Similarity=0.387  Sum_probs=44.1

Q ss_pred             cCCCceecCcchhhccCchHHHHHHHhhc--C---------------CCCCeecCCCCcccCCchHHHHHHHhhcCC
Q psy12029         19 FADRLFSCSGCARVYKNKKSLARHQTYEC--G---------------QEPQYFCPLCPYRAKQKTNLMTHMSIKHSH   78 (81)
Q Consensus        19 ~~~~~~~C~~c~~~~~~~~~l~~h~~~~~--~---------------~~~~~~c~~c~~~f~~~~~l~~h~~~~~~~   78 (81)
                      ....+|.|..|...|.....|..|++...  +               ..+ | |..|...|.....|..|++.-+++
T Consensus      1280 ~~~~~~~~~~~~~~~~~~~~l~~~~~k~~~~~~~~~~~~~~~l~~~d~~~-~-c~~c~~~~~~~~alqihm~~~~~~ 1354 (1406)
T KOG1146|consen 1280 DVTHRYLCRQCKMAFDGEAPLTAHQRKFCFAGRGSGGSMPPPLRVPDCTY-H-CLACEVLLSGREALQIHMRSSAHR 1354 (1406)
T ss_pred             ccchhHHHHHHHhhhcchhHHHHHHHHHHhccCccccCCCCcccCccccc-c-chHHHhhcchhHHHHHHHHHhhhc
Confidence            34567889999999999998988886431  1               123 5 888999999999999999975543


No 107
>PF09845 DUF2072:  Zn-ribbon containing protein (DUF2072);  InterPro: IPR018645  This archaeal Zinc-ribbon containing proteins have no known function. 
Probab=72.47  E-value=1.6  Score=22.04  Aligned_cols=15  Identities=27%  Similarity=0.829  Sum_probs=12.9

Q ss_pred             ceecCcchhhccCch
Q psy12029         23 LFSCSGCARVYKNKK   37 (81)
Q Consensus        23 ~~~C~~c~~~~~~~~   37 (81)
                      |+.|..||..|....
T Consensus         1 PH~Ct~Cg~~f~dgs   15 (131)
T PF09845_consen    1 PHQCTKCGRVFEDGS   15 (131)
T ss_pred             CcccCcCCCCcCCCc
Confidence            678999999998866


No 108
>PF09963 DUF2197:  Uncharacterized protein conserved in bacteria (DUF2197);  InterPro: IPR019241  This family represents various hypothetical bacterial proteins with no known function. 
Probab=71.13  E-value=2.2  Score=18.29  Aligned_cols=37  Identities=16%  Similarity=0.374  Sum_probs=19.1

Q ss_pred             eecCcchhhccCchHHHHHHHhhc-CCCCCeecCCCCcc
Q psy12029         24 FSCSGCARVYKNKKSLARHQTYEC-GQEPQYFCPLCPYR   61 (81)
Q Consensus        24 ~~C~~c~~~~~~~~~l~~h~~~~~-~~~~~~~c~~c~~~   61 (81)
                      ..|..|++.+........-.+... .... |.|..|...
T Consensus         3 vkC~lCdk~~~Id~~~~~aKrLrnrPi~t-YmC~eC~~R   40 (56)
T PF09963_consen    3 VKCILCDKKEEIDEDTPEAKRLRNRPIHT-YMCDECKER   40 (56)
T ss_pred             eEEEecCCEEEeccCCHHHHHhhcCCCcc-eeChhHHHH
Confidence            467788876555332112222212 2234 889888643


No 109
>PF01215 COX5B:  Cytochrome c oxidase subunit Vb This family consists of chains F and S ;  InterPro: IPR002124 Cytochrome c oxidase (1.9.3.1 from EC) is an oligomeric enzymatic complex which is a component of the respiratory chain complex and is involved in the transfer of electrons from cytochrome c to oxygen []. In eukaryotes this enzyme complex is located in the mitochondrial inner membrane; in aerobic prokaryotes it is found in the plasma membrane.  In eukaryotes, in addition to the three large subunits, I, II and III, that form the catalytic centre of the enzyme complex, there are a variable number of small polypeptidic subunits. One of these subunits, which is known as Vb in mammals, V in Dictyostelium discoideum (Slime mold) and IV in yeast, binds a zinc atom. The sequence of subunit Vb is well conserved and includes three conserved cysteines that coordinate the zinc ion [, ]. Two of these cysteines are clustered in the C-terminal section of the subunit.; GO: 0004129 cytochrome-c oxidase activity, 0005740 mitochondrial envelope; PDB: 2EIL_S 2ZXW_S 3ASN_S 1OCO_S 3AG4_S 3ABK_S 1OCZ_S 1OCC_F 3ASO_S 3ABL_S ....
Probab=70.53  E-value=1.7  Score=22.13  Aligned_cols=22  Identities=23%  Similarity=0.249  Sum_probs=14.0

Q ss_pred             ccccccCCCceecCcchhhccCc
Q psy12029         14 TESSYFADRLFSCSGCARVYKNK   36 (81)
Q Consensus        14 ~~~~~~~~~~~~C~~c~~~~~~~   36 (81)
                      ++..+-+ ++.+|+.||..|...
T Consensus       104 W~~l~~g-~~~RCpeCG~~fkL~  125 (136)
T PF01215_consen  104 WFWLHKG-KPQRCPECGQVFKLK  125 (136)
T ss_dssp             EEEEETT-SEEEETTTEEEEEEE
T ss_pred             EEEEeCC-CccCCCCCCeEEEEE
Confidence            3444444 478888888777654


No 110
>COG1773 Rubredoxin [Energy production and conversion]
Probab=70.48  E-value=1.8  Score=18.47  Aligned_cols=15  Identities=40%  Similarity=0.822  Sum_probs=11.9

Q ss_pred             ceecCcchhhccCch
Q psy12029         23 LFSCSGCARVYKNKK   37 (81)
Q Consensus        23 ~~~C~~c~~~~~~~~   37 (81)
                      .+.|.+||..|.-..
T Consensus         3 ~~~C~~CG~vYd~e~   17 (55)
T COG1773           3 RWRCSVCGYVYDPEK   17 (55)
T ss_pred             ceEecCCceEecccc
Confidence            588999999887653


No 111
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only]
Probab=69.65  E-value=9.9  Score=22.78  Aligned_cols=65  Identities=14%  Similarity=0.185  Sum_probs=36.4

Q ss_pred             cccchhcccccccCC---Cce-ecCcchhhccCchHHHHHHHhhcCCCCCeecCCCC----cccCCchHHHHHHH
Q psy12029          7 VPFYFQITESSYFAD---RLF-SCSGCARVYKNKKSLARHQTYECGQEPQYFCPLCP----YRAKQKTNLMTHMS   73 (81)
Q Consensus         7 ~~~~l~~~~~~~~~~---~~~-~C~~c~~~~~~~~~l~~h~~~~~~~~~~~~c~~c~----~~f~~~~~l~~h~~   73 (81)
                      ....|..|+.....+   +-+ .|.-|...|-.-..|..|.+..+.. - +.|...+    ..|..-..|-.|.+
T Consensus       200 ~~~~Lr~H~~~G~~e~GFKGHP~C~FC~~~FYdDDEL~~HcR~~HE~-C-hICD~v~p~~~QYFK~Y~~Le~HF~  272 (493)
T COG5236         200 RSSTLRDHKNGGLEEEGFKGHPLCIFCKIYFYDDDELRRHCRLRHEA-C-HICDMVGPIRYQYFKSYEDLEAHFR  272 (493)
T ss_pred             ecccccccccCCccccCcCCCchhhhccceecChHHHHHHHHhhhhh-h-hhhhccCccchhhhhCHHHHHHHhh
Confidence            344566676654433   222 3777888787777888888864432 2 4554433    23444455555544


No 112
>COG2331 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=69.25  E-value=3  Score=19.07  Aligned_cols=30  Identities=20%  Similarity=0.631  Sum_probs=17.7

Q ss_pred             ceecCcchhhccCchHHHHHHHhhcCCCCCeecCCCCc
Q psy12029         23 LFSCSGCARVYKNKKSLARHQTYECGQEPQYFCPLCPY   60 (81)
Q Consensus        23 ~~~C~~c~~~~~~~~~l~~h~~~~~~~~~~~~c~~c~~   60 (81)
                      .|.|..|+..|.    +.+++.    +-|.-.|+.|+.
T Consensus        12 ~Y~c~~cg~~~d----vvq~~~----ddplt~ce~c~a   41 (82)
T COG2331          12 SYECTECGNRFD----VVQAMT----DDPLTTCEECGA   41 (82)
T ss_pred             EEeecccchHHH----HHHhcc----cCccccChhhCh
Confidence            478999987763    333333    223246777764


No 113
>PF08274 PhnA_Zn_Ribbon:  PhnA Zinc-Ribbon ;  InterPro: IPR013987 The PhnA protein family includes the uncharacterised Escherichia coli protein PhnA and its homologues. The E. coli phnA gene is part of a large operon associated with alkylphosphonate uptake and carbon-phosphorus bond cleavage []. The protein is not related to the characterised phosphonoacetate hydrolase designated PhnA []. This entry represents the N-terminal domain of PhnA, which is predicted to form a zinc-ribbon.; PDB: 2AKL_A.
Probab=67.61  E-value=3.5  Score=15.24  Aligned_cols=8  Identities=38%  Similarity=1.003  Sum_probs=5.4

Q ss_pred             eecCCCCc
Q psy12029         53 YFCPLCPY   60 (81)
Q Consensus        53 ~~c~~c~~   60 (81)
                      +.|+.|+.
T Consensus        20 ~vCp~C~~   27 (30)
T PF08274_consen   20 LVCPECGH   27 (30)
T ss_dssp             EEETTTTE
T ss_pred             EeCCcccc
Confidence            67777764


No 114
>TIGR00100 hypA hydrogenase nickel insertion protein HypA. In Hpylori, hypA mutant abolished hydrogenase activity and decrease in urease activity. Nickel supplementation in media restored urease activity and partial hydrogenase activity. HypA probably involved in inserting Ni in enzymes.
Probab=67.41  E-value=3  Score=20.50  Aligned_cols=26  Identities=23%  Similarity=0.525  Sum_probs=17.2

Q ss_pred             CceecCcchhhccCchHHHHHHHhhcCCCCCeecCCCCc
Q psy12029         22 RLFSCSGCARVYKNKKSLARHQTYECGQEPQYFCPLCPY   60 (81)
Q Consensus        22 ~~~~C~~c~~~~~~~~~l~~h~~~~~~~~~~~~c~~c~~   60 (81)
                      -...|..|+..|.....            . +.|+.||.
T Consensus        69 ~~~~C~~Cg~~~~~~~~------------~-~~CP~Cgs   94 (115)
T TIGR00100        69 VECECEDCSEEVSPEID------------L-YRCPKCHG   94 (115)
T ss_pred             cEEEcccCCCEEecCCc------------C-ccCcCCcC
Confidence            34779999876654321            3 67888874


No 115
>COG4530 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=67.19  E-value=3.6  Score=20.22  Aligned_cols=14  Identities=14%  Similarity=0.280  Sum_probs=9.1

Q ss_pred             CCCeecCCCCcccCC
Q psy12029         50 EPQYFCPLCPYRAKQ   64 (81)
Q Consensus        50 ~~~~~c~~c~~~f~~   64 (81)
                      .| ..|+.||+.|+.
T Consensus        25 dP-iVsPytG~s~P~   38 (129)
T COG4530          25 DP-IVSPYTGKSYPR   38 (129)
T ss_pred             Cc-cccCcccccchH
Confidence            35 677777777743


No 116
>PTZ00043 cytochrome c oxidase subunit; Provisional
Probab=65.78  E-value=2.8  Score=23.33  Aligned_cols=18  Identities=17%  Similarity=0.637  Sum_probs=14.4

Q ss_pred             CCCceecCcchhhccCch
Q psy12029         20 ADRLFSCSGCARVYKNKK   37 (81)
Q Consensus        20 ~~~~~~C~~c~~~~~~~~   37 (81)
                      ..++.+|.+||..|....
T Consensus       178 EGkpqRCpECGqVFKLVr  195 (268)
T PTZ00043        178 EGFLYRCGECDQIFMLVR  195 (268)
T ss_pred             CCCCccCCCCCcEEEEEE
Confidence            456899999999887754


No 117
>PF13451 zf-trcl:  Probable zinc-binding domain
Probab=64.80  E-value=3.1  Score=17.34  Aligned_cols=17  Identities=18%  Similarity=0.604  Sum_probs=13.2

Q ss_pred             CCceecCcchhhccCch
Q psy12029         21 DRLFSCSGCARVYKNKK   37 (81)
Q Consensus        21 ~~~~~C~~c~~~~~~~~   37 (81)
                      ++.+.|..||..|....
T Consensus         2 Dk~l~C~dCg~~FvfTa   18 (49)
T PF13451_consen    2 DKTLTCKDCGAEFVFTA   18 (49)
T ss_pred             CeeEEcccCCCeEEEeh
Confidence            46788999998877654


No 118
>PRK12380 hydrogenase nickel incorporation protein HybF; Provisional
Probab=64.41  E-value=4.1  Score=19.96  Aligned_cols=26  Identities=23%  Similarity=0.461  Sum_probs=16.4

Q ss_pred             CceecCcchhhccCchHHHHHHHhhcCCCCCeecCCCCc
Q psy12029         22 RLFSCSGCARVYKNKKSLARHQTYECGQEPQYFCPLCPY   60 (81)
Q Consensus        22 ~~~~C~~c~~~~~~~~~l~~h~~~~~~~~~~~~c~~c~~   60 (81)
                      ....|..|+..|....            .. +.|+.||.
T Consensus        69 ~~~~C~~Cg~~~~~~~------------~~-~~CP~Cgs   94 (113)
T PRK12380         69 AQAWCWDCSQVVEIHQ------------HD-AQCPHCHG   94 (113)
T ss_pred             cEEEcccCCCEEecCC------------cC-ccCcCCCC
Confidence            3477888986654432            23 66888874


No 119
>COG1571 Predicted DNA-binding protein containing a Zn-ribbon domain [General function prediction only]
Probab=63.88  E-value=5.9  Score=24.16  Aligned_cols=29  Identities=28%  Similarity=0.701  Sum_probs=19.0

Q ss_pred             ecCcchhhccCchHHHHHHHhhcCCCCCeecCCCCcccCCc
Q psy12029         25 SCSGCARVYKNKKSLARHQTYECGQEPQYFCPLCPYRAKQK   65 (81)
Q Consensus        25 ~C~~c~~~~~~~~~l~~h~~~~~~~~~~~~c~~c~~~f~~~   65 (81)
                      .|+.||....+           .|..- |+|..||..+...
T Consensus       352 ~Cp~Cg~~m~S-----------~G~~g-~rC~kCg~~~~~~  380 (421)
T COG1571         352 VCPRCGGRMKS-----------AGRNG-FRCKKCGTRARET  380 (421)
T ss_pred             CCCccCCchhh-----------cCCCC-cccccccccCCcc
Confidence            68888865322           23445 8898898776554


No 120
>PF02176 zf-TRAF:  TRAF-type zinc finger; PDB: 2EOD_A 2YUC_A 3HCU_A 3HCS_B 3HCT_A.
Probab=63.76  E-value=4.6  Score=16.92  Aligned_cols=40  Identities=33%  Similarity=0.742  Sum_probs=20.9

Q ss_pred             CceecCc--chhhccCchHHHHHHHhhcCCCCCeecCC----CCcccC
Q psy12029         22 RLFSCSG--CARVYKNKKSLARHQTYECGQEPQYFCPL----CPYRAK   63 (81)
Q Consensus        22 ~~~~C~~--c~~~~~~~~~l~~h~~~~~~~~~~~~c~~----c~~~f~   63 (81)
                      .+..|+.  |...+. ...|..|....-...+ ..|..    |+..+.
T Consensus         8 ~~v~C~~~cc~~~i~-r~~l~~H~~~~C~~~~-v~C~~~~~GC~~~~~   53 (60)
T PF02176_consen    8 RPVPCPNGCCNEMIP-RKELDDHLENECPKRP-VPCPYSPYGCKERVP   53 (60)
T ss_dssp             SEEE-TT--S-BEEE-CCCHHHHHHTTSTTSE-EE-SS----S--EEE
T ss_pred             CEeeCCCCCccccee-HHHHHHHHHccCCCCc-EECCCCCCCCCCccc
Confidence            4567776  433333 4567788775555555 77877    765543


No 121
>PF04423 Rad50_zn_hook:  Rad50 zinc hook motif;  InterPro: IPR007517 The Mre11 complex (Mre11 Rad50 Nbs1) is central to chromosomal maintenance and functions in homologous recombination, telomere maintenance and sister chromatid association. The Rad50 coiled-coil region contains a dimer interface at the apex of the coiled coils in which pairs of conserved Cys-X-X-Cys motifs form interlocking hooks that bind one Zn ion. This alignment includes the zinc hook motif and a short stretch of coiled-coil on either side.; GO: 0004518 nuclease activity, 0005524 ATP binding, 0008270 zinc ion binding, 0006281 DNA repair; PDB: 1L8D_B.
Probab=63.62  E-value=2.8  Score=17.48  Aligned_cols=13  Identities=23%  Similarity=0.659  Sum_probs=7.0

Q ss_pred             ecCcchhhccCch
Q psy12029         25 SCSGCARVYKNKK   37 (81)
Q Consensus        25 ~C~~c~~~~~~~~   37 (81)
                      .|++|+..|....
T Consensus        22 ~CPlC~r~l~~e~   34 (54)
T PF04423_consen   22 CCPLCGRPLDEEH   34 (54)
T ss_dssp             E-TTT--EE-HHH
T ss_pred             cCCCCCCCCCHHH
Confidence            8999998887654


No 122
>smart00154 ZnF_AN1 AN1-like Zinc finger. Zinc finger at the C-terminus of An1, a ubiquitin-like protein in Xenopus laevis.
Probab=61.80  E-value=4.2  Score=15.90  Aligned_cols=14  Identities=21%  Similarity=0.729  Sum_probs=11.0

Q ss_pred             ceecCcchhhccCc
Q psy12029         23 LFSCSGCARVYKNK   36 (81)
Q Consensus        23 ~~~C~~c~~~~~~~   36 (81)
                      |+.|..|+..|...
T Consensus        12 ~f~C~~C~~~FC~~   25 (39)
T smart00154       12 GFKCRHCGNLFCGE   25 (39)
T ss_pred             CeECCccCCccccc
Confidence            78898888887664


No 123
>PF01927 Mut7-C:  Mut7-C RNAse domain;  InterPro: IPR002782 This prokaryotic family of proteins have no known function. The proteins contain four conserved cysteines that may be involved in metal binding or disulphide bridges.
Probab=61.63  E-value=8.6  Score=19.67  Aligned_cols=47  Identities=13%  Similarity=0.160  Sum_probs=26.7

Q ss_pred             eecCcchhhccCchHHHHHHHhh-----cCCCCCeecCCCCcccCCchHHHHH
Q psy12029         24 FSCSGCARVYKNKKSLARHQTYE-----CGQEPQYFCPLCPYRAKQKTNLMTH   71 (81)
Q Consensus        24 ~~C~~c~~~~~~~~~l~~h~~~~-----~~~~~~~~c~~c~~~f~~~~~l~~h   71 (81)
                      -+|..|+..+.....-.......     ....- |.|+.|++.|..-+++.+-
T Consensus        92 sRC~~CN~~L~~v~~~~v~~~vp~~v~~~~~~f-~~C~~C~kiyW~GsH~~~~  143 (147)
T PF01927_consen   92 SRCPKCNGPLRPVSKEEVKDRVPPYVYETYDEF-WRCPGCGKIYWEGSHWRRM  143 (147)
T ss_pred             CccCCCCcEeeechhhccccccCccccccCCeE-EECCCCCCEecccccHHHH
Confidence            56999987554432211000010     11223 7899999999887776543


No 124
>KOG4727|consensus
Probab=61.63  E-value=4.8  Score=21.45  Aligned_cols=22  Identities=23%  Similarity=0.428  Sum_probs=18.8

Q ss_pred             ceecCcchhhccCchHHHHHHH
Q psy12029         23 LFSCSGCARVYKNKKSLARHQT   44 (81)
Q Consensus        23 ~~~C~~c~~~~~~~~~l~~h~~   44 (81)
                      -|-|.+|+-++...-++..|+-
T Consensus        75 GyyCdVCdcvvKDSinflDHiN   96 (193)
T KOG4727|consen   75 GYYCDVCDCVVKDSINFLDHIN   96 (193)
T ss_pred             ceeeeecceeehhhHHHHHHhc
Confidence            3889999999999888888764


No 125
>COG3357 Predicted transcriptional regulator containing an HTH domain fused to a Zn-ribbon [Transcription]
Probab=61.21  E-value=3.2  Score=19.65  Aligned_cols=32  Identities=25%  Similarity=0.516  Sum_probs=21.9

Q ss_pred             CCceecCcchhhccCchHHHHHHHhhcCCCCCeecCCCCcccC
Q psy12029         21 DRLFSCSGCARVYKNKKSLARHQTYECGQEPQYFCPLCPYRAK   63 (81)
Q Consensus        21 ~~~~~C~~c~~~~~~~~~l~~h~~~~~~~~~~~~c~~c~~~f~   63 (81)
                      -+|..|..||..|....          -.+| ..|+.|.....
T Consensus        56 v~Pa~CkkCGfef~~~~----------ik~p-SRCP~CKSE~I   87 (97)
T COG3357          56 VRPARCKKCGFEFRDDK----------IKKP-SRCPKCKSEWI   87 (97)
T ss_pred             ecChhhcccCccccccc----------cCCc-ccCCcchhhcc
Confidence            46889999998886521          1245 88988875443


No 126
>COG5112 UFD2 U1-like Zn-finger-containing protein [General function prediction only]
Probab=60.89  E-value=6.5  Score=19.22  Aligned_cols=25  Identities=28%  Similarity=0.515  Sum_probs=20.5

Q ss_pred             CCCceecCcchhhccCchHHHHHHH
Q psy12029         20 ADRLFSCSGCARVYKNKKSLARHQT   44 (81)
Q Consensus        20 ~~~~~~C~~c~~~~~~~~~l~~h~~   44 (81)
                      |-..+-|.+|.+.|.....|..|.+
T Consensus        52 GlGqhYCieCaryf~t~~aL~~Hkk   76 (126)
T COG5112          52 GLGQHYCIECARYFITEKALMEHKK   76 (126)
T ss_pred             CCceeeeehhHHHHHHHHHHHHHhc
Confidence            4456789999999999988887765


No 127
>PF08790 zf-LYAR:  LYAR-type C2HC zinc finger ;  InterPro: IPR014898 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This C2HC zinc finger domain is found in LYAR proteins such as Q08288 from SWISSPROT, which are involved in cell growth regulation.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 1WJV_A.
Probab=60.81  E-value=1.6  Score=15.93  Aligned_cols=9  Identities=33%  Similarity=1.091  Sum_probs=4.8

Q ss_pred             ecCcchhhc
Q psy12029         25 SCSGCARVY   33 (81)
Q Consensus        25 ~C~~c~~~~   33 (81)
                      .|..|++.|
T Consensus         2 sCiDC~~~F   10 (28)
T PF08790_consen    2 SCIDCSKDF   10 (28)
T ss_dssp             EETTTTEEE
T ss_pred             eeecCCCCc
Confidence            455555555


No 128
>COG4391 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=60.41  E-value=3  Score=18.22  Aligned_cols=45  Identities=22%  Similarity=0.473  Sum_probs=28.5

Q ss_pred             ccccccCCCceecCcchhhccCchHHHHHHHhhcCCCCCeecCCCCcccC
Q psy12029         14 TESSYFADRLFSCSGCARVYKNKKSLARHQTYECGQEPQYFCPLCPYRAK   63 (81)
Q Consensus        14 ~~~~~~~~~~~~C~~c~~~~~~~~~l~~h~~~~~~~~~~~~c~~c~~~f~   63 (81)
                      +..++.+..++.|+.-+..+.....+.     ..+...+..|+.|+..|.
T Consensus        15 ~~~I~~~~~~l~C~g~~~p~~HPrV~L-----~mg~~gev~CPYC~t~y~   59 (62)
T COG4391          15 HETIEIGDLPLMCPGPEPPNDHPRVFL-----DMGDEGEVVCPYCSTRYR   59 (62)
T ss_pred             ceEEEeCCeeEEcCCCCCCCCCCEEEE-----EcCCCCcEecCccccEEE
Confidence            667788889999987665544332221     113333368999998765


No 129
>PF07975 C1_4:  TFIIH C1-like domain;  InterPro: IPR004595 All proteins in this domain for which functions are known are components of the TFIIH complex which is involved in the initiation of transcription and nucleotide excision repair. It includes the yeast transcription factor Ssl1 (Suppressor of stem-loop protein 1) that is essential for translation initiation and affects UV resistance. The C-terminal region is essential for transcription activity. This regions binds three zinc atoms through two independent domain. The first contains a C4 zinc finger motif, whereas the second is characterised by a CX(2)CX(2-4)FCADCD motif. The solution structure of the second C-terminal domain revealed homology with the regulatory domain of protein kinase C [].; GO: 0006281 DNA repair, 0005634 nucleus; PDB: 1Z60_A.
Probab=58.97  E-value=1.2  Score=18.72  Aligned_cols=25  Identities=16%  Similarity=0.377  Sum_probs=13.7

Q ss_pred             CCceecCcchhhccCchHHHHHHHh
Q psy12029         21 DRLFSCSGCARVYKNKKSLARHQTY   45 (81)
Q Consensus        21 ~~~~~C~~c~~~~~~~~~l~~h~~~   45 (81)
                      ...|.|+.|...|...-++-.|...
T Consensus        19 ~~~y~C~~C~~~FC~dCD~fiHE~L   43 (51)
T PF07975_consen   19 SSRYRCPKCKNHFCIDCDVFIHETL   43 (51)
T ss_dssp             -EEE--TTTT--B-HHHHHTTTTTS
T ss_pred             CCeEECCCCCCccccCcChhhhccc
Confidence            3569999999999887776655443


No 130
>KOG0717|consensus
Probab=58.96  E-value=7.1  Score=24.21  Aligned_cols=21  Identities=24%  Similarity=0.572  Sum_probs=17.5

Q ss_pred             eecCCCCcccCCchHHHHHHH
Q psy12029         53 YFCPLCPYRAKQKTNLMTHMS   73 (81)
Q Consensus        53 ~~c~~c~~~f~~~~~l~~h~~   73 (81)
                      +-|.+|.+.|.+...+.+|..
T Consensus       293 lyC~vCnKsFKseKq~kNHEn  313 (508)
T KOG0717|consen  293 LYCVVCNKSFKSEKQLKNHEN  313 (508)
T ss_pred             eEEeeccccccchHHHHhhHH
Confidence            578899999999888888865


No 131
>PF01428 zf-AN1:  AN1-like Zinc finger;  InterPro: IPR000058 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents the AN1-type zinc finger domain, which has a dimetal (zinc)-bound alpha/beta fold. This domain was first identified as a zinc finger at the C terminus of AN1 Q91889 from SWISSPROT, a ubiquitin-like protein in Xenopus laevis []. The AN1-type zinc finger contains six conserved cysteines and two histidines that could potentially coordinate 2 zinc atoms. Certain stress-associated proteins (SAP) contain AN1 domain, often in combination with A20 zinc finger domains (SAP8) or C2H2 domains (SAP16) []. For example, the human protein Znf216 has an A20 zinc-finger at the N terminus and an AN1 zinc-finger at the C terminus, acting to negatively regulate the NFkappaB activation pathway and to interact with components of the immune response like RIP, IKKgamma and TRAF6. The interact of Znf216 with IKK-gamma and RIP is mediated by the A20 zinc-finger domain, while its interaction with TRAF6 is mediated by the AN1 zinc-finger domain; therefore, both zinc-finger domains are involved in regulating the immune response []. The AN1 zinc finger domain is also found in proteins containing a ubiquitin-like domain, which are involved in the ubiquitination pathway []. Proteins containing an AN1-type zinc finger include:   Ascidian posterior end mark 6 (pem-6) protein []. Human AWP1 protein (associated with PRK1), which is expressed during early embryogenesis []. Human immunoglobulin mu binding protein 2 (SMUBP-2), mutations in which cause muscular atrophy with respiratory distress type 1 [].   More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 1WFP_A 1WYS_A 1WG2_A 1WFH_A 1X4W_A 1WFE_A 1WFL_A 1X4V_A.
Probab=58.65  E-value=4  Score=16.20  Aligned_cols=15  Identities=27%  Similarity=0.645  Sum_probs=9.7

Q ss_pred             CceecCcchhhccCc
Q psy12029         22 RLFSCSGCARVYKNK   36 (81)
Q Consensus        22 ~~~~C~~c~~~~~~~   36 (81)
                      .|+.|..|+..|...
T Consensus        12 ~~~~C~~C~~~FC~~   26 (43)
T PF01428_consen   12 LPFKCKHCGKSFCLK   26 (43)
T ss_dssp             SHEE-TTTS-EE-TT
T ss_pred             CCeECCCCCcccCcc
Confidence            578999999988764


No 132
>PRK00564 hypA hydrogenase nickel incorporation protein; Provisional
Probab=56.53  E-value=5.7  Score=19.59  Aligned_cols=14  Identities=29%  Similarity=0.788  Sum_probs=9.8

Q ss_pred             CceecCcchhhccC
Q psy12029         22 RLFSCSGCARVYKN   35 (81)
Q Consensus        22 ~~~~C~~c~~~~~~   35 (81)
                      -.+.|..|+..|..
T Consensus        70 ~~~~C~~Cg~~~~~   83 (117)
T PRK00564         70 VELECKDCSHVFKP   83 (117)
T ss_pred             CEEEhhhCCCcccc
Confidence            34779999866644


No 133
>KOG2231|consensus
Probab=56.50  E-value=15  Score=23.99  Aligned_cols=47  Identities=23%  Similarity=0.508  Sum_probs=28.3

Q ss_pred             ecCcchhhccCchHHHHHHHhhcCCCCCeecCCC------CcccCCchHHHHHHHhhc
Q psy12029         25 SCSGCARVYKNKKSLARHQTYECGQEPQYFCPLC------PYRAKQKTNLMTHMSIKH   76 (81)
Q Consensus        25 ~C~~c~~~~~~~~~l~~h~~~~~~~~~~~~c~~c------~~~f~~~~~l~~h~~~~~   76 (81)
                      .|..|...|.....|..|++.++     |.|..|      ...|..-..|..|.+..|
T Consensus       184 ~C~~C~~~fld~~el~rH~~~~h-----~~chfC~~~~~~neyy~~~~dLe~HfR~~H  236 (669)
T KOG2231|consen  184 LCKFCHERFLDDDELYRHLRFDH-----EFCHFCDYKTGQNEYYNDYDDLEEHFRKGH  236 (669)
T ss_pred             cchhhhhhhccHHHHHHhhccce-----eheeecCcccccchhcccchHHHHHhhhcC
Confidence            47777777777777777777543     333333      234555566777766544


No 134
>PF06397 Desulfoferrod_N:  Desulfoferrodoxin, N-terminal domain;  InterPro: IPR004462 This domain is found as essentially the full length of desulforedoxin, a 37-residue homodimeric non-haem iron protein. It is also found as the N-terminal domain of desulfoferrodoxin (rbo), a homodimeric non-haem iron protein with 2 Fe atoms per monomer in different oxidation states. This domain binds the ferric rather than the ferrous Fe of desulfoferrodoxin. Neelaredoxin, a monomeric blue non-haem iron protein, lacks this domain.; GO: 0005506 iron ion binding; PDB: 1DFX_A 1VZI_B 2JI2_D 1VZH_B 2JI3_C 2JI1_C 1VZG_A 1CFW_A 2LK5_B 1DHG_B ....
Probab=55.45  E-value=6.1  Score=15.31  Aligned_cols=12  Identities=17%  Similarity=0.894  Sum_probs=6.4

Q ss_pred             CceecCcchhhc
Q psy12029         22 RLFSCSGCARVY   33 (81)
Q Consensus        22 ~~~~C~~c~~~~   33 (81)
                      +-|.|..||...
T Consensus         5 ~~YkC~~CGniV   16 (36)
T PF06397_consen    5 EFYKCEHCGNIV   16 (36)
T ss_dssp             EEEE-TTT--EE
T ss_pred             cEEEccCCCCEE
Confidence            358899998754


No 135
>PRK05452 anaerobic nitric oxide reductase flavorubredoxin; Provisional
Probab=55.01  E-value=3.2  Score=25.50  Aligned_cols=38  Identities=26%  Similarity=0.616  Sum_probs=22.8

Q ss_pred             CCCceecCcchhhccCch-HHHHHHHhhcC------CCCCeecCCCCc
Q psy12029         20 ADRLFSCSGCARVYKNKK-SLARHQTYECG------QEPQYFCPLCPY   60 (81)
Q Consensus        20 ~~~~~~C~~c~~~~~~~~-~l~~h~~~~~~------~~~~~~c~~c~~   60 (81)
                      ....|.|..|+..+.... .-.  +....|      ... |.|+.|+.
T Consensus       422 ~~~~~~c~~c~~~yd~~~g~~~--~~~~~gt~~~~lp~~-~~cp~c~~  466 (479)
T PRK05452        422 LGPRMQCSVCQWIYDPAKGEPM--QDVAPGTPWSEVPDN-FLCPECSL  466 (479)
T ss_pred             CCCeEEECCCCeEECCCCCCcc--cCCCCCCChhhCCCC-CcCcCCCC
Confidence            456799999998887642 111  111111      123 89999974


No 136
>PF15135 UPF0515:  Uncharacterised protein UPF0515
Probab=54.96  E-value=9.3  Score=21.72  Aligned_cols=12  Identities=25%  Similarity=0.836  Sum_probs=8.7

Q ss_pred             eecCCCCcccCC
Q psy12029         53 YFCPLCPYRAKQ   64 (81)
Q Consensus        53 ~~c~~c~~~f~~   64 (81)
                      |.|..|+..|.-
T Consensus       156 f~C~~C~h~F~G  167 (278)
T PF15135_consen  156 FHCPKCRHNFRG  167 (278)
T ss_pred             eecccccccchh
Confidence            778888877653


No 137
>PF07282 OrfB_Zn_ribbon:  Putative transposase DNA-binding domain;  InterPro: IPR010095 This entry represents a region of a sequence similarity between a family of putative transposases of Thermoanaerobacter tengcongensis, smaller related proteins from Bacillus anthracis, putative transposes described by IPR001959 from INTERPRO, and other proteins. More information about these proteins can be found at Protein of the Month: Transposase [].
Probab=54.37  E-value=12  Score=16.22  Aligned_cols=30  Identities=20%  Similarity=0.610  Sum_probs=17.8

Q ss_pred             eecCcchhhccCchHHHHHHHhhcCCCCCeecCCCCcccCC
Q psy12029         24 FSCSGCARVYKNKKSLARHQTYECGQEPQYFCPLCPYRAKQ   64 (81)
Q Consensus        24 ~~C~~c~~~~~~~~~l~~h~~~~~~~~~~~~c~~c~~~f~~   64 (81)
                      ..|+.||.....          ...... |.|..||..+..
T Consensus        29 q~C~~CG~~~~~----------~~~~r~-~~C~~Cg~~~~r   58 (69)
T PF07282_consen   29 QTCPRCGHRNKK----------RRSGRV-FTCPNCGFEMDR   58 (69)
T ss_pred             cCccCccccccc----------ccccce-EEcCCCCCEECc
Confidence            357778755333          122334 899999876443


No 138
>KOG2807|consensus
Probab=54.35  E-value=30  Score=20.70  Aligned_cols=55  Identities=18%  Similarity=0.274  Sum_probs=32.4

Q ss_pred             CCceecCcchhhccCchHHHHHHHhh---------------------------cCCCCCeecCCCCcccCCchHHHHHHH
Q psy12029         21 DRLFSCSGCARVYKNKKSLARHQTYE---------------------------CGQEPQYFCPLCPYRAKQKTNLMTHMS   73 (81)
Q Consensus        21 ~~~~~C~~c~~~~~~~~~l~~h~~~~---------------------------~~~~~~~~c~~c~~~f~~~~~l~~h~~   73 (81)
                      .-|..|+.|+........|.+.-+..                           .+... |.|..|...|....+.-.|-.
T Consensus       288 sLP~eCpiC~ltLVss~hLARSyhhL~PL~~F~Eip~~~~~~~~~Cf~C~~~~~~~~~-y~C~~Ck~~FCldCDv~iHes  366 (378)
T KOG2807|consen  288 SLPIECPICSLTLVSSPHLARSYHHLFPLKPFVEIPETEYNGSRFCFACQGELLSSGR-YRCESCKNVFCLDCDVFIHES  366 (378)
T ss_pred             cCCccCCccceeEecchHHHHHHHhhcCCcchhhccccccCCCcceeeeccccCCCCc-EEchhccceeeccchHHHHhh
Confidence            34667888887777776665322110                           00112 667777777777766666666


Q ss_pred             hhc
Q psy12029         74 IKH   76 (81)
Q Consensus        74 ~~~   76 (81)
                      .|.
T Consensus       367 Lh~  369 (378)
T KOG2807|consen  367 LHN  369 (378)
T ss_pred             hhc
Confidence            554


No 139
>KOG0978|consensus
Probab=54.31  E-value=2.9  Score=27.06  Aligned_cols=18  Identities=17%  Similarity=0.196  Sum_probs=13.9

Q ss_pred             eecCCCCcccCCchHHHH
Q psy12029         53 YFCPLCPYRAKQKTNLMT   70 (81)
Q Consensus        53 ~~c~~c~~~f~~~~~l~~   70 (81)
                      -+|+.|+..|.....+..
T Consensus       679 RKCP~Cn~aFganDv~~I  696 (698)
T KOG0978|consen  679 RKCPKCNAAFGANDVHRI  696 (698)
T ss_pred             CCCCCCCCCCCccccccc
Confidence            589999999987765543


No 140
>PF13824 zf-Mss51:  Zinc-finger of mitochondrial splicing suppressor 51
Probab=54.18  E-value=11  Score=16.09  Aligned_cols=13  Identities=31%  Similarity=0.636  Sum_probs=7.1

Q ss_pred             CCCceecCcchhh
Q psy12029         20 ADRLFSCSGCARV   32 (81)
Q Consensus        20 ~~~~~~C~~c~~~   32 (81)
                      +...|.|+.||..
T Consensus        11 ~~v~~~Cp~cGip   23 (55)
T PF13824_consen   11 AHVNFECPDCGIP   23 (55)
T ss_pred             cccCCcCCCCCCc
Confidence            3445666666643


No 141
>PRK04351 hypothetical protein; Provisional
Probab=53.42  E-value=7.7  Score=20.09  Aligned_cols=33  Identities=27%  Similarity=0.591  Sum_probs=20.2

Q ss_pred             ceecCcchhhccCchHHHHHHHhhcCCCCCeecCCCCcccCC
Q psy12029         23 LFSCSGCARVYKNKKSLARHQTYECGQEPQYFCPLCPYRAKQ   64 (81)
Q Consensus        23 ~~~C~~c~~~~~~~~~l~~h~~~~~~~~~~~~c~~c~~~f~~   64 (81)
                      .|.|..|+..+...       +.+. ... |.|..|+..+..
T Consensus       112 ~Y~C~~Cg~~~~r~-------Rr~n-~~~-yrCg~C~g~L~~  144 (149)
T PRK04351        112 LYECQSCGQQYLRK-------RRIN-TKR-YRCGKCRGKLKL  144 (149)
T ss_pred             EEECCCCCCEeeee-------eecC-CCc-EEeCCCCcEeee
Confidence            47898888655332       2222 244 899999866543


No 142
>PF01286 XPA_N:  XPA protein N-terminal;  InterPro: IPR022652 Xeroderma pigmentosum (XP) [] is a human autosomal recessive disease, characterised by a high incidence of sunlight-induced skin cancer. Skin cells of individual's with this condition are hypersensitive to ultraviolet light, due to defects in the incision step of DNA excision repair. There are a minimum of seven genetic complementation groups involved in this pathway: XP-A to XP-G. XP-A is the most severe form of the disease and is due to defects in a 30 kDa nuclear protein called XPA (or XPAC) []. The sequence of the XPA protein is conserved from higher eukaryotes [] to yeast (gene RAD14) []. XPA is a hydrophilic protein of 247 to 296 amino-acid residues which has a C4-type zinc finger motif in its central section. This entry contains the zinc-finger containing region in the XPA protein. It is found N-terminal to PF05181 from PFAM ; PDB: 1D4U_A 1XPA_A.
Probab=53.17  E-value=7.1  Score=14.92  Aligned_cols=12  Identities=17%  Similarity=0.249  Sum_probs=5.3

Q ss_pred             ecCCCCcccCCc
Q psy12029         54 FCPLCPYRAKQK   65 (81)
Q Consensus        54 ~c~~c~~~f~~~   65 (81)
                      .|.+|++.|..+
T Consensus         5 ~C~eC~~~f~dS   16 (34)
T PF01286_consen    5 KCDECGKPFMDS   16 (34)
T ss_dssp             E-TTT--EES-S
T ss_pred             hHhHhCCHHHHH
Confidence            577777766543


No 143
>cd00730 rubredoxin Rubredoxin; nonheme iron binding domains containing a [Fe(SCys)4] center. Rubredoxins are small nonheme iron proteins. The iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), but iron can also be replaced by cobalt, nickel or zinc. They are believed to be involved in electron transfer.
Probab=53.07  E-value=5.1  Score=16.69  Aligned_cols=13  Identities=23%  Similarity=0.830  Sum_probs=10.5

Q ss_pred             eecCcchhhccCc
Q psy12029         24 FSCSGCARVYKNK   36 (81)
Q Consensus        24 ~~C~~c~~~~~~~   36 (81)
                      |.|.+||..+...
T Consensus         2 y~C~~CgyiYd~~   14 (50)
T cd00730           2 YECRICGYIYDPA   14 (50)
T ss_pred             cCCCCCCeEECCC
Confidence            6899999888754


No 144
>KOG4173|consensus
Probab=52.95  E-value=12  Score=20.76  Aligned_cols=50  Identities=30%  Similarity=0.480  Sum_probs=26.6

Q ss_pred             ecCcchhhccCchHHHHHHHh-h---------cCCCCCeecCC--CCcccCCchHHHHHHHhh
Q psy12029         25 SCSGCARVYKNKKSLARHQTY-E---------CGQEPQYFCPL--CPYRAKQKTNLMTHMSIK   75 (81)
Q Consensus        25 ~C~~c~~~~~~~~~l~~h~~~-~---------~~~~~~~~c~~--c~~~f~~~~~l~~h~~~~   75 (81)
                      .|..|.+.|....-|..|+.. |         .|..- |.|.+  |+-.|.....-.+|+-..
T Consensus       108 sCs~C~r~~Pt~hLLd~HI~E~HDs~Fqa~veRG~dM-y~ClvEgCt~KFkT~r~RkdH~I~~  169 (253)
T KOG4173|consen  108 SCSFCKRAFPTGHLLDAHILEWHDSLFQALVERGQDM-YQCLVEGCTEKFKTSRDRKDHMIRM  169 (253)
T ss_pred             hhHHHHHhCCchhhhhHHHHHHHHHHHHHHHHcCccH-HHHHHHhhhhhhhhhhhhhhHHHHh
Confidence            566666666666555555542 2         12222 55633  666666666666665543


No 145
>PF10537 WAC_Acf1_DNA_bd:  ATP-utilising chromatin assembly and remodelling N-terminal;  InterPro: IPR013136 ACF (for ATP-utilising chromatin assembly and remodeling factor) is a chromatin-remodeling complex that catalyzes the ATP-dependent assembly of periodic nucleosome arrays. This reaction utilises the energy of ATP hydrolysis by ISWI, the smaller of the two subunits of ACF. Acf1, the large subunit of ACF, is essential for the full activity of the complex. The WAC (WSTF/Acf1/cbp146) domain is an ~110-residue module present at the N-termini of Acf1-related proteins in a variety of organisms. It is found in association with other domains such as the bromodomain, the PHD-type zinc finger, DDT or WAKS. The DNA-binding region of Acf1 includes the WAC domain, which is necessary for the efficient binding of ACF complex to DNA. It seems probable that the WAC domain will be involved in DNA binding in other related factors [, ].   Some proteins known to contain a WAC domain are the Drosophila melanogaster (Fruit fly) ATP-dependent chromatin assembly factor large subunit Acf1, human WSTF (Williams syndrome transcription factor), mouse cbp146, yeast imitation switch two complex protein 1 (ITC1 or YGL133w), and yeast protein YPL216w. 
Probab=52.91  E-value=27  Score=16.92  Aligned_cols=36  Identities=8%  Similarity=0.231  Sum_probs=21.5

Q ss_pred             ceecCcchhhccCchHHHHHHHhhcCCCCCeecCCCCc
Q psy12029         23 LFSCSGCARVYKNKKSLARHQTYECGQEPQYFCPLCPY   60 (81)
Q Consensus        23 ~~~C~~c~~~~~~~~~l~~h~~~~~~~~~~~~c~~c~~   60 (81)
                      .|.|+..+..|.+-......+... ..+. |.|...|+
T Consensus         3 Vf~i~~T~EiF~dYe~Y~~R~~~y-~~~v-wtC~~TGk   38 (102)
T PF10537_consen    3 VFYIPFTGEIFRDYEEYLKRMILY-NQRV-WTCEITGK   38 (102)
T ss_pred             eEEeCCCCcccCCHHHHHHHHHHH-hCCe-eEEecCCC
Confidence            466777777777766655444332 2344 77777665


No 146
>PF00301 Rubredoxin:  Rubredoxin;  InterPro: IPR004039 Rubredoxin is a low molecular weight iron-containing bacterial protein involved in electron transfer [, ], sometimes replacing ferredoxin as an electron carrier []. The 3-D structures of a number of rubredoxins have been solved [, ]. The fold belongs to the alpha+beta class, with 2 alpha-helices and 2-3 beta-strands. Its active site contains an iron ion which is co-ordinated by the sulphurs of four conserved cysteine residues forming an almost regular tetrahedron. The conserved cysteines reside on two loops, which are the most conserved regions of the protein. In addition, a ring of acidic residues in the proximity of the [Fe(Cys)4] centre is also well-conserved []. ; GO: 0009055 electron carrier activity, 0046872 metal ion binding; PDB: 2RDV_C 1RDV_A 1S24_A 1T9O_B 1B2J_A 1SMW_A 2PVE_B 1BFY_A 1T9P_C 1C09_C ....
Probab=52.57  E-value=5.7  Score=16.31  Aligned_cols=14  Identities=36%  Similarity=0.935  Sum_probs=10.5

Q ss_pred             eecCcchhhccCch
Q psy12029         24 FSCSGCARVYKNKK   37 (81)
Q Consensus        24 ~~C~~c~~~~~~~~   37 (81)
                      |.|.+|+..+....
T Consensus         2 y~C~~CgyvYd~~~   15 (47)
T PF00301_consen    2 YQCPVCGYVYDPEK   15 (47)
T ss_dssp             EEETTTSBEEETTT
T ss_pred             cCCCCCCEEEcCCc
Confidence            68999998776643


No 147
>PF12760 Zn_Tnp_IS1595:  Transposase zinc-ribbon domain;  InterPro: IPR024442 This zinc binding domain is found in a range of transposase proteins such as ISSPO8, ISSOD11, ISRSSP2 etc. It may be a zinc-binding beta ribbon domain that could bind DNA.
Probab=51.73  E-value=3.8  Score=16.50  Aligned_cols=27  Identities=26%  Similarity=0.619  Sum_probs=14.7

Q ss_pred             eecCcchhhccCchHHHHHHHhhcCCCCCeecCCCCc
Q psy12029         24 FSCSGCARVYKNKKSLARHQTYECGQEPQYFCPLCPY   60 (81)
Q Consensus        24 ~~C~~c~~~~~~~~~l~~h~~~~~~~~~~~~c~~c~~   60 (81)
                      +.|+.||..  ....+       ..... |.|..|++
T Consensus        19 ~~CP~Cg~~--~~~~~-------~~~~~-~~C~~C~~   45 (46)
T PF12760_consen   19 FVCPHCGST--KHYRL-------KTRGR-YRCKACRK   45 (46)
T ss_pred             CCCCCCCCe--eeEEe-------CCCCe-EECCCCCC
Confidence            668888754  11111       11344 88887764


No 148
>KOG2482|consensus
Probab=50.89  E-value=12  Score=22.45  Aligned_cols=22  Identities=27%  Similarity=0.433  Sum_probs=19.9

Q ss_pred             eecCCCCcccCCchHHHHHHHh
Q psy12029         53 YFCPLCPYRAKQKTNLMTHMSI   74 (81)
Q Consensus        53 ~~c~~c~~~f~~~~~l~~h~~~   74 (81)
                      +.|..|-+.|.....|..||+.
T Consensus       196 ~~CLyCekifrdkntLkeHMrk  217 (423)
T KOG2482|consen  196 LRCLYCEKIFRDKNTLKEHMRK  217 (423)
T ss_pred             heeeeeccccCCcHHHHHHHHh
Confidence            5888999999999999999984


No 149
>TIGR00622 ssl1 transcription factor ssl1. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=50.39  E-value=13  Score=18.38  Aligned_cols=49  Identities=16%  Similarity=0.320  Sum_probs=30.5

Q ss_pred             ecCcchhhccCchHHHHHHHhhcCCCCCeecCCCCcccCCchHHHHHHHhhc
Q psy12029         25 SCSGCARVYKNKKSLARHQTYECGQEPQYFCPLCPYRAKQKTNLMTHMSIKH   76 (81)
Q Consensus        25 ~C~~c~~~~~~~~~l~~h~~~~~~~~~~~~c~~c~~~f~~~~~l~~h~~~~~   76 (81)
                      .|-.|...|........  ..-..... |.|..|...|-..-..-.|..+|.
T Consensus        57 ~C~~C~~~f~~~~~~~~--~~~~~~~~-y~C~~C~~~FC~dCD~fiHe~Lh~  105 (112)
T TIGR00622        57 FCFGCQGPFPKPPVSPF--DELKDSHR-YVCAVCKNVFCVDCDVFVHESLHC  105 (112)
T ss_pred             cccCcCCCCCCcccccc--cccccccc-eeCCCCCCccccccchhhhhhccC
Confidence            37778887765432110  11223334 899999998887777767766664


No 150
>PF04780 DUF629:  Protein of unknown function (DUF629);  InterPro: IPR006865 This domain represents a region of several plant proteins of unknown function. A C2H2 zinc finger is predicted in this region in some family members, but the spacing between the cysteine residues is not conserved throughout the family.
Probab=49.56  E-value=19  Score=22.49  Aligned_cols=23  Identities=22%  Similarity=0.670  Sum_probs=17.9

Q ss_pred             eecCCCCcccCCchHHHHHHHhh
Q psy12029         53 YFCPLCPYRAKQKTNLMTHMSIK   75 (81)
Q Consensus        53 ~~c~~c~~~f~~~~~l~~h~~~~   75 (81)
                      |.|+.|.+.|.....+..|+..-
T Consensus        58 WiCp~CskkF~d~~~~~~H~~~e   80 (466)
T PF04780_consen   58 WICPRCSKKFSDAESCLSHMEQE   80 (466)
T ss_pred             eeCCcccceeCCHHHHHHHHHHh
Confidence            57788888888888888887643


No 151
>PF13453 zf-TFIIB:  Transcription factor zinc-finger
Probab=48.96  E-value=19  Score=13.98  Aligned_cols=21  Identities=14%  Similarity=0.471  Sum_probs=15.8

Q ss_pred             CCceecCcchhhccCchHHHH
Q psy12029         21 DRLFSCSGCARVYKNKKSLAR   41 (81)
Q Consensus        21 ~~~~~C~~c~~~~~~~~~l~~   41 (81)
                      -....|..|+..+.....|.+
T Consensus        17 ~~id~C~~C~G~W~d~~el~~   37 (41)
T PF13453_consen   17 VEIDVCPSCGGIWFDAGELEK   37 (41)
T ss_pred             EEEEECCCCCeEEccHHHHHH
Confidence            345779999998888777654


No 152
>PF04606 Ogr_Delta:  Ogr/Delta-like zinc finger;  InterPro: IPR007684 This entry is represented by Bacteriophage P2, Ogr. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches. This is a viral family of phage zinc-binding transcriptional activators, which also contains cryptic members in some bacterial genomes []. The P4 phage delta protein contains two such domains attached covalently, while the P2 phage Ogr proteins possess one domain but function as dimers. All the members of this family have the following consensus sequence: C-X(2)-C-X(3)-A-(X)2-R-X(15)-C-X(4)-C-X(3)-F [].; GO: 0006355 regulation of transcription, DNA-dependent
Probab=48.77  E-value=3.3  Score=16.80  Aligned_cols=37  Identities=14%  Similarity=0.157  Sum_probs=18.3

Q ss_pred             ecCcchhhccCchHHHHHHHhhcCCCCCeecCC--CCcccCC
Q psy12029         25 SCSGCARVYKNKKSLARHQTYECGQEPQYFCPL--CPYRAKQ   64 (81)
Q Consensus        25 ~C~~c~~~~~~~~~l~~h~~~~~~~~~~~~c~~--c~~~f~~   64 (81)
                      .|+.||.......+...  .....+.. +.|..  ||..|..
T Consensus         1 ~CP~Cg~~a~ir~S~~~--s~~~~~~Y-~qC~N~~Cg~tfv~   39 (47)
T PF04606_consen    1 RCPHCGSKARIRTSRQL--SPLTRELY-CQCTNPECGHTFVA   39 (47)
T ss_pred             CcCCCCCeeEEEEchhh--CcceEEEE-EEECCCcCCCEEEE
Confidence            37777765544443221  11222334 56643  7776653


No 153
>PRK00432 30S ribosomal protein S27ae; Validated
Probab=48.48  E-value=12  Score=15.49  Aligned_cols=10  Identities=30%  Similarity=0.976  Sum_probs=7.9

Q ss_pred             eecCCCCccc
Q psy12029         53 YFCPLCPYRA   62 (81)
Q Consensus        53 ~~c~~c~~~f   62 (81)
                      +.|..|+..+
T Consensus        38 ~~C~~Cgyt~   47 (50)
T PRK00432         38 WHCGKCGYTE   47 (50)
T ss_pred             EECCCcCCEE
Confidence            8899898654


No 154
>COG1326 Uncharacterized archaeal Zn-finger protein [General function prediction only]
Probab=48.24  E-value=27  Score=19.15  Aligned_cols=35  Identities=20%  Similarity=0.427  Sum_probs=18.2

Q ss_pred             ceecCcchhhccCchHHHHHHHhhcCCCCCeecCCCCccc
Q psy12029         23 LFSCSGCARVYKNKKSLARHQTYECGQEPQYFCPLCPYRA   62 (81)
Q Consensus        23 ~~~C~~c~~~~~~~~~l~~h~~~~~~~~~~~~c~~c~~~f   62 (81)
                      -+.|+.|+ .-.....+.   +. -+..+.+.|..||..+
T Consensus         6 y~~Cp~Cg-~eev~hEVi---k~-~g~~~lvrC~eCG~V~   40 (201)
T COG1326           6 YIECPSCG-SEEVSHEVI---KE-RGREPLVRCEECGTVH   40 (201)
T ss_pred             EEECCCCC-cchhhHHHH---Hh-cCCceEEEccCCCcEe
Confidence            46799997 211111121   11 1332337899998765


No 155
>PF06651 DUF1163:  Protein of unknown function (DUF1163);  InterPro: IPR009544 This entry represents the C terminus of hypothetical Arabidopsis thaliana proteins of unknown function.
Probab=47.88  E-value=8.6  Score=17.12  Aligned_cols=36  Identities=6%  Similarity=0.152  Sum_probs=25.3

Q ss_pred             ccccccccchhcccccccCCCceecCcchhhccCch
Q psy12029          2 ELQLLVPFYFQITESSYFADRLFSCSGCARVYKNKK   37 (81)
Q Consensus         2 ~~~f~~~~~l~~~~~~~~~~~~~~C~~c~~~~~~~~   37 (81)
                      |-+|.....|......-+|...|.|.+.-..|-..+
T Consensus        18 evrfGsrl~L~DCR~~ttg~M~y~Cde~~LRFEpgs   53 (70)
T PF06651_consen   18 EVRFGSRLFLTDCRKGTTGVMSYACDEVTLRFEPGS   53 (70)
T ss_pred             eeeeeeeEeccccccCccceeeEEecceEEEecCCc
Confidence            346777777777777777888888887665554443


No 156
>KOG2636|consensus
Probab=47.77  E-value=15  Score=22.81  Aligned_cols=29  Identities=31%  Similarity=0.511  Sum_probs=21.3

Q ss_pred             ccccCCCceecCcch-hhccCchHHHHHHH
Q psy12029         16 SSYFADRLFSCSGCA-RVYKNKKSLARHQT   44 (81)
Q Consensus        16 ~~~~~~~~~~C~~c~-~~~~~~~~l~~h~~   44 (81)
                      +-|.-.+.|.|.+|| .++.-...+.+|=.
T Consensus       394 KLHGL~~ey~CEICGNy~Y~GrkaF~RHF~  423 (497)
T KOG2636|consen  394 KLHGLDIEYNCEICGNYVYKGRKAFDRHFN  423 (497)
T ss_pred             hhcCCCcccceeeccCccccCcHHHHHHhH
Confidence            446667889999999 56666677776654


No 157
>COG3677 Transposase and inactivated derivatives [DNA replication, recombination, and repair]
Probab=47.72  E-value=8.6  Score=19.39  Aligned_cols=16  Identities=13%  Similarity=0.686  Sum_probs=11.7

Q ss_pred             CCceecCcchhhccCc
Q psy12029         21 DRLFSCSGCARVYKNK   36 (81)
Q Consensus        21 ~~~~~C~~c~~~~~~~   36 (81)
                      ...|.|..|++.|...
T Consensus        51 ~qRyrC~~C~~tf~~~   66 (129)
T COG3677          51 HQRYKCKSCGSTFTVE   66 (129)
T ss_pred             ccccccCCcCcceeee
Confidence            5568888888877664


No 158
>PF10263 SprT-like:  SprT-like family;  InterPro: IPR006640 This is a family of uncharacterised bacterial proteins which includes Escherichia coli SprT (P39902 from SWISSPROT). SprT is described as a regulator of bolA gene in stationary phase []. The majority of members contain the metallopeptidase zinc binding signature which has a HExxH motif, however there is no evidence for them being metallopeptidases. 
Probab=47.69  E-value=11  Score=19.23  Aligned_cols=32  Identities=25%  Similarity=0.640  Sum_probs=18.4

Q ss_pred             ceecCcchhhccCchHHHHHHHhhcCCCCCeecCCCCcccC
Q psy12029         23 LFSCSGCARVYKNKKSLARHQTYECGQEPQYFCPLCPYRAK   63 (81)
Q Consensus        23 ~~~C~~c~~~~~~~~~l~~h~~~~~~~~~~~~c~~c~~~f~   63 (81)
                      .|.|..|+..+....      +.  .... |.|..|+..+.
T Consensus       123 ~~~C~~C~~~~~r~~------~~--~~~~-~~C~~C~~~l~  154 (157)
T PF10263_consen  123 VYRCPSCGREYKRHR------RS--KRKR-YRCGRCGGPLV  154 (157)
T ss_pred             EEEcCCCCCEeeeec------cc--chhh-EECCCCCCEEE
Confidence            477888876653322      22  1223 78888876543


No 159
>PLN03238 probable histone acetyltransferase MYST; Provisional
Probab=47.33  E-value=32  Score=20.10  Aligned_cols=21  Identities=29%  Similarity=0.782  Sum_probs=12.0

Q ss_pred             eecCCCCcccCCchHHHHHHH
Q psy12029         53 YFCPLCPYRAKQKTNLMTHMS   73 (81)
Q Consensus        53 ~~c~~c~~~f~~~~~l~~h~~   73 (81)
                      |.|..|-+.|.+...+..|+.
T Consensus        49 yiCe~Clky~~~~~~l~~H~~   69 (290)
T PLN03238         49 YICEYCLKYMRKKKSLLRHLA   69 (290)
T ss_pred             EEcCCCcchhCCHHHHHHHHH
Confidence            555555555555555555554


No 160
>TIGR00416 sms DNA repair protein RadA. The gene protuct codes for a probable ATP-dependent protease involved in both DNA repair and degradation of proteins, peptides, glycopeptides. Also known as sms. Residues 11-28 of the SEED alignment contain a putative Zn binding domain. Residues 110-117 of the seed contain a putative ATP binding site both documented in Haemophilus and in Listeria monocytogenes. for E.coli see ( J. BACTERIOL. 178:5045-5048(1996)).
Probab=47.08  E-value=14  Score=22.78  Aligned_cols=10  Identities=30%  Similarity=0.756  Sum_probs=6.6

Q ss_pred             ceecCcchhh
Q psy12029         23 LFSCSGCARV   32 (81)
Q Consensus        23 ~~~C~~c~~~   32 (81)
                      .|.|..||..
T Consensus         7 ~y~C~~Cg~~   16 (454)
T TIGR00416         7 KFVCQHCGAD   16 (454)
T ss_pred             eEECCcCCCC
Confidence            3777777754


No 161
>TIGR00686 phnA alkylphosphonate utilization operon protein PhnA. The protein family includes an uncharacterized member designated phnA in Escherichia coli, part of a large operon associated with alkylphosphonate uptake and carbon-phosphorus bond cleavage. This protein is not related to the characterized phosphonoacetate hydrolase designated PhnA by Kulakova, et al. (2001, 1997).
Probab=46.70  E-value=13  Score=18.30  Aligned_cols=11  Identities=36%  Similarity=0.987  Sum_probs=5.9

Q ss_pred             eecCCCCcccC
Q psy12029         53 YFCPLCPYRAK   63 (81)
Q Consensus        53 ~~c~~c~~~f~   63 (81)
                      |.|+.|+..+.
T Consensus        20 ~iCpeC~~EW~   30 (109)
T TIGR00686        20 LICPSCLYEWN   30 (109)
T ss_pred             eECcccccccc
Confidence            55665655443


No 162
>KOG2071|consensus
Probab=46.40  E-value=16  Score=23.35  Aligned_cols=27  Identities=15%  Similarity=0.390  Sum_probs=20.7

Q ss_pred             CCceecCcchhhccCchHHHHHHHhhc
Q psy12029         21 DRLFSCSGCARVYKNKKSLARHQTYEC   47 (81)
Q Consensus        21 ~~~~~C~~c~~~~~~~~~l~~h~~~~~   47 (81)
                      ..+-.|..||..|.+......||..|.
T Consensus       416 ~~pnqC~~CG~R~~~~ee~sk~md~H~  442 (579)
T KOG2071|consen  416 DSPNQCKSCGLRFDDSEERSKHMDIHD  442 (579)
T ss_pred             CCcchhcccccccccchhhhhHhhhhh
Confidence            456789999999999877666666553


No 163
>COG4338 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=46.19  E-value=6.6  Score=16.28  Aligned_cols=14  Identities=29%  Similarity=0.707  Sum_probs=10.9

Q ss_pred             cCcchhhccCchHH
Q psy12029         26 CSGCARVYKNKKSL   39 (81)
Q Consensus        26 C~~c~~~~~~~~~l   39 (81)
                      |++|+..|......
T Consensus        15 CpvCqRPFsWRkKW   28 (54)
T COG4338          15 CPVCQRPFSWRKKW   28 (54)
T ss_pred             hhhhcCchHHHHHH
Confidence            88999888876644


No 164
>PRK11823 DNA repair protein RadA; Provisional
Probab=45.96  E-value=15  Score=22.58  Aligned_cols=10  Identities=20%  Similarity=0.776  Sum_probs=7.0

Q ss_pred             ceecCcchhh
Q psy12029         23 LFSCSGCARV   32 (81)
Q Consensus        23 ~~~C~~c~~~   32 (81)
                      .|.|..||..
T Consensus         7 ~y~C~~Cg~~   16 (446)
T PRK11823          7 AYVCQECGAE   16 (446)
T ss_pred             eEECCcCCCC
Confidence            4778888754


No 165
>KOG3352|consensus
Probab=45.84  E-value=8.6  Score=20.04  Aligned_cols=15  Identities=20%  Similarity=0.501  Sum_probs=11.1

Q ss_pred             CceecCcchhhccCc
Q psy12029         22 RLFSCSGCARVYKNK   36 (81)
Q Consensus        22 ~~~~C~~c~~~~~~~   36 (81)
                      +.++|.+||..|...
T Consensus       132 e~~rc~eCG~~fkL~  146 (153)
T KOG3352|consen  132 ETQRCPECGHYFKLV  146 (153)
T ss_pred             CcccCCcccceEEee
Confidence            466799999887643


No 166
>COG0846 SIR2 NAD-dependent protein deacetylases, SIR2 family [Transcription]
Probab=44.90  E-value=21  Score=20.26  Aligned_cols=38  Identities=26%  Similarity=0.481  Sum_probs=22.1

Q ss_pred             ccCCCceecCcchhhccCchHHHHHHHhhcCCCCCeecCCCCc
Q psy12029         18 YFADRLFSCSGCARVYKNKKSLARHQTYECGQEPQYFCPLCPY   60 (81)
Q Consensus        18 ~~~~~~~~C~~c~~~~~~~~~l~~h~~~~~~~~~~~~c~~c~~   60 (81)
                      |..-....|..|+..+...... .  ....+..|  .|..|+.
T Consensus       117 HGsl~~~~C~~C~~~~~~~~~~-~--~~~~~~~p--~C~~Cg~  154 (250)
T COG0846         117 HGSLKRVRCSKCGNQYYDEDVI-K--FIEDGLIP--RCPKCGG  154 (250)
T ss_pred             ccceeeeEeCCCcCccchhhhh-h--hcccCCCC--cCccCCC
Confidence            4445668899998877644311 1  11222334  7888886


No 167
>PRK05978 hypothetical protein; Provisional
Probab=44.66  E-value=7.5  Score=20.18  Aligned_cols=31  Identities=16%  Similarity=0.251  Sum_probs=16.9

Q ss_pred             eecCcchhhccCchHHHHHHHhhcCCCCCeecCCCCcccCC
Q psy12029         24 FSCSGCARVYKNKKSLARHQTYECGQEPQYFCPLCPYRAKQ   64 (81)
Q Consensus        24 ~~C~~c~~~~~~~~~l~~h~~~~~~~~~~~~c~~c~~~f~~   64 (81)
                      -+|+.|++.--....|.         .. -.|..||..|..
T Consensus        34 grCP~CG~G~LF~g~Lk---------v~-~~C~~CG~~~~~   64 (148)
T PRK05978         34 GRCPACGEGKLFRAFLK---------PV-DHCAACGEDFTH   64 (148)
T ss_pred             CcCCCCCCCcccccccc---------cC-CCccccCCcccc
Confidence            46888886533332221         12 367778765543


No 168
>PF07295 DUF1451:  Protein of unknown function (DUF1451);  InterPro: IPR009912 This family consists of several hypothetical bacterial proteins of around 160 residues in length. Members of this family contain four highly conserved cysteine resides toward the C-terminal region of the protein. The function of this family is unknown.
Probab=44.47  E-value=10  Score=19.65  Aligned_cols=28  Identities=21%  Similarity=0.482  Sum_probs=17.2

Q ss_pred             CceecCcchhhccCchHHHHHHHhhcCCCCCeecCCCCc
Q psy12029         22 RLFSCSGCARVYKNKKSLARHQTYECGQEPQYFCPLCPY   60 (81)
Q Consensus        22 ~~~~C~~c~~~~~~~~~l~~h~~~~~~~~~~~~c~~c~~   60 (81)
                      ..+.|..||.....         .+++..|  .|+.|+.
T Consensus       111 G~l~C~~Cg~~~~~---------~~~~~l~--~Cp~C~~  138 (146)
T PF07295_consen  111 GTLVCENCGHEVEL---------THPERLP--PCPKCGH  138 (146)
T ss_pred             ceEecccCCCEEEe---------cCCCcCC--CCCCCCC
Confidence            35889999865322         2334444  7888875


No 169
>PRK03681 hypA hydrogenase nickel incorporation protein; Validated
Probab=43.72  E-value=8.5  Score=18.90  Aligned_cols=13  Identities=15%  Similarity=0.355  Sum_probs=8.8

Q ss_pred             CceecCcchhhcc
Q psy12029         22 RLFSCSGCARVYK   34 (81)
Q Consensus        22 ~~~~C~~c~~~~~   34 (81)
                      -.+.|..|+..|.
T Consensus        69 ~~~~C~~Cg~~~~   81 (114)
T PRK03681         69 AECWCETCQQYVT   81 (114)
T ss_pred             cEEEcccCCCeee
Confidence            3477888886553


No 170
>COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair]
Probab=43.64  E-value=6.1  Score=25.86  Aligned_cols=11  Identities=36%  Similarity=0.760  Sum_probs=7.1

Q ss_pred             CCCeecCCCCcc
Q psy12029         50 EPQYFCPLCPYR   61 (81)
Q Consensus        50 ~~~~~c~~c~~~   61 (81)
                      .| ..|+.||..
T Consensus       474 ~p-~~Cp~Cgs~  484 (730)
T COG1198         474 IP-QSCPECGSE  484 (730)
T ss_pred             CC-CCCCCCCCC
Confidence            44 777777753


No 171
>COG1656 Uncharacterized conserved protein [Function unknown]
Probab=42.90  E-value=24  Score=18.77  Aligned_cols=47  Identities=15%  Similarity=0.212  Sum_probs=26.6

Q ss_pred             eecCcchhhccCchHHHHHHHh-----hcCCCCCeecCCCCcccCCchHHHHH
Q psy12029         24 FSCSGCARVYKNKKSLARHQTY-----ECGQEPQYFCPLCPYRAKQKTNLMTH   71 (81)
Q Consensus        24 ~~C~~c~~~~~~~~~l~~h~~~-----~~~~~~~~~c~~c~~~f~~~~~l~~h   71 (81)
                      -+|+.|+......+.-..--+.     .....- |.|..||+.|.--+++..-
T Consensus        98 ~RCp~CN~~L~~vs~eev~~~Vp~~~~~~~~~f-~~C~~CgkiYW~GsHw~~m  149 (165)
T COG1656          98 SRCPECNGELEKVSREEVKEKVPEKVYRNYEEF-YRCPKCGKIYWKGSHWRRM  149 (165)
T ss_pred             ccCcccCCEeccCcHHHHhhccchhhhhcccce-eECCCCcccccCchHHHHH
Confidence            4699998765443321100000     011223 6799999999887776543


No 172
>PF02591 DUF164:  Putative zinc ribbon domain;  InterPro: IPR003743 This entry describes proteins of unknown function.
Probab=42.81  E-value=29  Score=14.47  Aligned_cols=32  Identities=31%  Similarity=0.643  Sum_probs=18.0

Q ss_pred             ecCcchhhccCchHHHHHHHhhcCCCCCeecCCCCcc
Q psy12029         25 SCSGCARVYKNKKSLARHQTYECGQEPQYFCPLCPYR   61 (81)
Q Consensus        25 ~C~~c~~~~~~~~~l~~h~~~~~~~~~~~~c~~c~~~   61 (81)
                      .|..|.-..+....    .....+... ..|+.|++.
T Consensus        24 ~C~gC~~~l~~~~~----~~i~~~~~i-~~Cp~CgRi   55 (56)
T PF02591_consen   24 TCSGCHMELPPQEL----NEIRKGDEI-VFCPNCGRI   55 (56)
T ss_pred             ccCCCCEEcCHHHH----HHHHcCCCe-EECcCCCcc
Confidence            57777654433221    223344556 789999863


No 173
>PRK14138 NAD-dependent deacetylase; Provisional
Probab=42.59  E-value=39  Score=18.97  Aligned_cols=38  Identities=18%  Similarity=0.361  Sum_probs=21.6

Q ss_pred             ccCCCceecCcchhhccCchHHHHHHHhhcCCCCCeecCCCCc
Q psy12029         18 YFADRLFSCSGCARVYKNKKSLARHQTYECGQEPQYFCPLCPY   60 (81)
Q Consensus        18 ~~~~~~~~C~~c~~~~~~~~~l~~h~~~~~~~~~~~~c~~c~~   60 (81)
                      |..-....|..|+..+.......   .......|  .|+.|+.
T Consensus       114 HG~~~~~~C~~C~~~~~~~~~~~---~~~~~~~p--~Cp~Cgg  151 (244)
T PRK14138        114 HGNVEEYYCVRCGKRYTVEDVIE---KLEKSDVP--RCDDCSG  151 (244)
T ss_pred             cCCcCeeEECCCCCcccHHHHHH---HHhcCCCC--CCCCCCC
Confidence            44445577999998776543322   11122334  6888874


No 174
>COG1655 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=42.55  E-value=3.4  Score=23.14  Aligned_cols=31  Identities=16%  Similarity=0.380  Sum_probs=21.7

Q ss_pred             ccCCCceecCcchhhccCchHHHHHHHhhcC
Q psy12029         18 YFADRLFSCSGCARVYKNKKSLARHQTYECG   48 (81)
Q Consensus        18 ~~~~~~~~C~~c~~~~~~~~~l~~h~~~~~~   48 (81)
                      ...++.+.|++|+..|.....+..-.|+-.|
T Consensus        14 ~f~kk~ieCPvC~tkFkkeev~tgsiRiiag   44 (267)
T COG1655          14 LFYKKTIECPVCNTKFKKEEVKTGSIRIIAG   44 (267)
T ss_pred             HHhhceeccCcccchhhhhheeccceeEecc
Confidence            3356778999999999887666555554443


No 175
>COG4306 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=42.27  E-value=7.2  Score=19.69  Aligned_cols=13  Identities=31%  Similarity=0.506  Sum_probs=9.8

Q ss_pred             eecCCCCcccCCc
Q psy12029         53 YFCPLCPYRAKQK   65 (81)
Q Consensus        53 ~~c~~c~~~f~~~   65 (81)
                      --|..||+.|++-
T Consensus        69 sfchncgs~fpwt   81 (160)
T COG4306          69 SFCHNCGSRFPWT   81 (160)
T ss_pred             chhhcCCCCCCcH
Confidence            6677888888764


No 176
>PF14369 zf-RING_3:  zinc-finger
Probab=41.15  E-value=11  Score=14.33  Aligned_cols=10  Identities=20%  Similarity=0.727  Sum_probs=8.1

Q ss_pred             ecCcchhhcc
Q psy12029         25 SCSGCARVYK   34 (81)
Q Consensus        25 ~C~~c~~~~~   34 (81)
                      .|+.|+..|.
T Consensus        23 ~CP~C~~gFv   32 (35)
T PF14369_consen   23 ACPRCHGGFV   32 (35)
T ss_pred             CCcCCCCcEe
Confidence            5999998774


No 177
>COG5152 Uncharacterized conserved protein, contains RING and CCCH-type Zn-fingers [General function prediction only]
Probab=40.73  E-value=16  Score=20.13  Aligned_cols=17  Identities=12%  Similarity=0.530  Sum_probs=11.6

Q ss_pred             CCCCeecCCCCcccCCc
Q psy12029         49 QEPQYFCPLCPYRAKQK   65 (81)
Q Consensus        49 ~~~~~~c~~c~~~f~~~   65 (81)
                      ++.||.|.+|.+.|.++
T Consensus       193 e~IPF~C~iCKkdy~sp  209 (259)
T COG5152         193 EKIPFLCGICKKDYESP  209 (259)
T ss_pred             CCCceeehhchhhccch
Confidence            33339998888777654


No 178
>PRK08222 hydrogenase 4 subunit H; Validated
Probab=40.72  E-value=22  Score=18.94  Aligned_cols=19  Identities=37%  Similarity=0.756  Sum_probs=12.9

Q ss_pred             CceecCcchhhccCchHHH
Q psy12029         22 RLFSCSGCARVYKNKKSLA   40 (81)
Q Consensus        22 ~~~~C~~c~~~~~~~~~l~   40 (81)
                      ....|..||+.|.....+.
T Consensus       113 ~~~~C~~Cg~~f~~~k~i~  131 (181)
T PRK08222        113 HLQRCSRCERPFAPQKTVA  131 (181)
T ss_pred             ccCcCcccCCccCcHhHHH
Confidence            4667888888887655443


No 179
>PHA02998 RNA polymerase subunit; Provisional
Probab=39.69  E-value=3.7  Score=21.99  Aligned_cols=39  Identities=18%  Similarity=0.306  Sum_probs=21.1

Q ss_pred             ceecCcchhhccCchHHHHHHHhhcCCCCC---eecCCCCcccCCc
Q psy12029         23 LFSCSGCARVYKNKKSLARHQTYECGQEPQ---YFCPLCPYRAKQK   65 (81)
Q Consensus        23 ~~~C~~c~~~~~~~~~l~~h~~~~~~~~~~---~~c~~c~~~f~~~   65 (81)
                      ...|+.|+..-.....  .+.|  ....|+   |.|..||..|.-+
T Consensus       143 ~v~CPkCg~~~A~f~q--lQTR--SADEPmT~FYkC~~CG~~wkpp  184 (195)
T PHA02998        143 NTPCPNCKSKNTTPMM--IQTR--AADEPPLVRHACRDCKKHFKPP  184 (195)
T ss_pred             CCCCCCCCCCceEEEE--Eeec--cCCCCceEEEEcCCCCCccCCc
Confidence            4678888853222222  2223  222232   7899999876543


No 180
>TIGR00627 tfb4 transcription factor tfb4. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=39.63  E-value=28  Score=20.16  Aligned_cols=7  Identities=29%  Similarity=0.932  Sum_probs=3.3

Q ss_pred             ecCCCCc
Q psy12029         54 FCPLCPY   60 (81)
Q Consensus        54 ~c~~c~~   60 (81)
                      .|..|+-
T Consensus       271 ~C~~Cgt  277 (279)
T TIGR00627       271 ICKTCKT  277 (279)
T ss_pred             CCCCCCC
Confidence            4444543


No 181
>smart00731 SprT SprT homologues. Predicted to have roles in transcription elongation. Contains a conserved HExxH motif, indicating a metalloprotease function.
Probab=39.55  E-value=16  Score=18.60  Aligned_cols=32  Identities=22%  Similarity=0.581  Sum_probs=17.6

Q ss_pred             ceecCcchhhccCchHHHHHHHhhcCCCCCeecCCCCccc
Q psy12029         23 LFSCSGCARVYKNKKSLARHQTYECGQEPQYFCPLCPYRA   62 (81)
Q Consensus        23 ~~~C~~c~~~~~~~~~l~~h~~~~~~~~~~~~c~~c~~~f   62 (81)
                      .|.|..|+..+...      .+ +..... |.|..|+..+
T Consensus       112 ~y~C~~C~~~~~~~------rr-~~~~~~-y~C~~C~g~l  143 (146)
T smart00731      112 PYRCTGCGQRYLRV------RR-SNNVSR-YRCGKCGGKL  143 (146)
T ss_pred             EEECCCCCCCCceE------cc-ccCcce-EEcCCCCCEE
Confidence            57788787654321      11 111134 7888887654


No 182
>PF03604 DNA_RNApol_7kD:  DNA directed RNA polymerase, 7 kDa subunit;  InterPro: IPR006591 DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Each class of RNA polymerase is assembled from 9 to 15 different polypeptides. Rbp10 (RNA polymerase CX) is a domain found in RNA polymerase subunit 10; present in RNA polymerase I, II and III.; GO: 0003677 DNA binding, 0003899 DNA-directed RNA polymerase activity, 0006351 transcription, DNA-dependent; PDB: 2PMZ_Z 3HKZ_X 2NVX_L 3S1Q_L 2JA6_L 3S17_L 3HOW_L 3HOV_L 3PO2_L 3HOZ_L ....
Probab=39.36  E-value=20  Score=13.42  Aligned_cols=11  Identities=27%  Similarity=0.766  Sum_probs=5.2

Q ss_pred             eecCCCCcccC
Q psy12029         53 YFCPLCPYRAK   63 (81)
Q Consensus        53 ~~c~~c~~~f~   63 (81)
                      |.|..|+..+.
T Consensus         1 Y~C~~Cg~~~~   11 (32)
T PF03604_consen    1 YICGECGAEVE   11 (32)
T ss_dssp             EBESSSSSSE-
T ss_pred             CCCCcCCCeeE
Confidence            44555655443


No 183
>PRK00762 hypA hydrogenase nickel incorporation protein; Provisional
Probab=39.28  E-value=12  Score=18.68  Aligned_cols=33  Identities=15%  Similarity=0.247  Sum_probs=17.9

Q ss_pred             CCceecCcchhhccCchHHHHHHHhhcCCCCCeecCCCCc
Q psy12029         21 DRLFSCSGCARVYKNKKSLARHQTYECGQEPQYFCPLCPY   60 (81)
Q Consensus        21 ~~~~~C~~c~~~~~~~~~l~~h~~~~~~~~~~~~c~~c~~   60 (81)
                      .-.+.| .|+..|.....-..    + -... +.|+.||.
T Consensus        68 p~~~~C-~Cg~~~~~~~~~~~----~-~~~~-~~CP~Cgs  100 (124)
T PRK00762         68 PVEIEC-ECGYEGVVDEDEID----H-YAAV-IECPVCGN  100 (124)
T ss_pred             CeeEEe-eCcCcccccccchh----c-cccC-CcCcCCCC
Confidence            344789 99977665421000    0 0112 57888874


No 184
>PF11931 DUF3449:  Domain of unknown function (DUF3449);  InterPro: IPR024598 This presumed domain is functionally uncharacterised. It has two conserved sequence motifs: PIP and CEICG and contains a zinc-finger of the C2H2-type.; PDB: 4DGW_A.
Probab=39.20  E-value=10  Score=20.73  Aligned_cols=26  Identities=23%  Similarity=0.480  Sum_probs=0.0

Q ss_pred             cccCCCceecCcchh-hccCchHHHHH
Q psy12029         17 SYFADRLFSCSGCAR-VYKNKKSLARH   42 (81)
Q Consensus        17 ~~~~~~~~~C~~c~~-~~~~~~~l~~h   42 (81)
                      -|.-.+.|.|.+||. +|.-...+.+|
T Consensus        95 LhGL~~ey~CEICGN~~Y~GrkaFekH  121 (196)
T PF11931_consen   95 LHGLGVEYKCEICGNQSYKGRKAFEKH  121 (196)
T ss_dssp             ---------------------------
T ss_pred             HhCCCCeeeeEeCCCcceecHHHHHHh
Confidence            355567789999985 33334444444


No 185
>PF06524 NOA36:  NOA36 protein;  InterPro: IPR010531 This family consists of several NOA36 proteins which contain 29 highly conserved cysteine residues. The function of this protein is unknown.; GO: 0008270 zinc ion binding, 0005634 nucleus
Probab=38.63  E-value=31  Score=19.98  Aligned_cols=16  Identities=31%  Similarity=0.675  Sum_probs=9.8

Q ss_pred             ccCCCceecCcchhhc
Q psy12029         18 YFADRLFSCSGCARVY   33 (81)
Q Consensus        18 ~~~~~~~~C~~c~~~~   33 (81)
                      ..|.+.|.|..|...+
T Consensus       137 ~hGGrif~CsfC~~fl  152 (314)
T PF06524_consen  137 DHGGRIFKCSFCDNFL  152 (314)
T ss_pred             cCCCeEEEeecCCCee
Confidence            4456677777776543


No 186
>KOG2907|consensus
Probab=38.57  E-value=12  Score=18.58  Aligned_cols=41  Identities=22%  Similarity=0.439  Sum_probs=21.7

Q ss_pred             CceecCcchhhccCchHHHHHHHh-hcCCCCCeecCCCCcccCC
Q psy12029         22 RLFSCSGCARVYKNKKSLARHQTY-ECGQEPQYFCPLCPYRAKQ   64 (81)
Q Consensus        22 ~~~~C~~c~~~~~~~~~l~~h~~~-~~~~~~~~~c~~c~~~f~~   64 (81)
                      ....|+.||..--.  .-...+|+ .-|+---|.|..|+..|..
T Consensus        73 I~~kCpkCghe~m~--Y~T~QlRSADEGQTVFYTC~kC~~k~~e  114 (116)
T KOG2907|consen   73 IKHKCPKCGHEEMS--YHTLQLRSADEGQTVFYTCPKCKYKFTE  114 (116)
T ss_pred             hhccCcccCCchhh--hhhhhcccccCCceEEEEcCccceeeec
Confidence            34678888753211  11122332 3343322789999877653


No 187
>cd00065 FYVE FYVE domain; Zinc-binding domain; targets proteins to membrane lipids via interaction with phosphatidylinositol-3-phosphate, PI3P; present in Fab1, YOTB, Vac1, and EEA1;
Probab=38.16  E-value=30  Score=14.18  Aligned_cols=10  Identities=30%  Similarity=1.208  Sum_probs=4.0

Q ss_pred             eecCcchhhc
Q psy12029         24 FSCSGCARVY   33 (81)
Q Consensus        24 ~~C~~c~~~~   33 (81)
                      +.|..||..|
T Consensus        19 ~~Cr~Cg~~~   28 (57)
T cd00065          19 HHCRNCGRIF   28 (57)
T ss_pred             cccCcCcCCc
Confidence            3344444433


No 188
>COG0068 HypF Hydrogenase maturation factor [Posttranslational modification, protein turnover, chaperones]
Probab=37.86  E-value=16  Score=24.10  Aligned_cols=35  Identities=26%  Similarity=0.657  Sum_probs=21.5

Q ss_pred             CCCcee-cCcchhhccCchHHHHHHHhhcCCCCCeecCCCCcc
Q psy12029         20 ADRLFS-CSGCARVYKNKKSLARHQTYECGQEPQYFCPLCPYR   61 (81)
Q Consensus        20 ~~~~~~-C~~c~~~~~~~~~l~~h~~~~~~~~~~~~c~~c~~~   61 (81)
                      .-+.|+ |+.|.+.|.+..+    .|.|.  .| ..|+.||..
T Consensus       147 sM~~F~lC~~C~~EY~dP~n----RRfHA--Qp-~aCp~CGP~  182 (750)
T COG0068         147 SMADFPLCPFCDKEYKDPLN----RRFHA--QP-IACPKCGPH  182 (750)
T ss_pred             ccccCcCCHHHHHHhcCccc----ccccc--cc-ccCcccCCC
Confidence            334444 7778777776654    24443  35 688888863


No 189
>PF03811 Zn_Tnp_IS1:  InsA N-terminal domain;  InterPro: IPR003220 Insertion elements are mobile elements in DNA, usually encoding proteins required for transposition, for example transposases. Protein InsA is absolutely required for transposition of insertion element 1. This entry represents a short zinc binding domain found in IS1 InsA family protein. It is found at the N terminus of the protein and may be a DNA-binding domain.; GO: 0006313 transposition, DNA-mediated
Probab=37.63  E-value=28  Score=13.37  Aligned_cols=11  Identities=36%  Similarity=0.960  Sum_probs=5.7

Q ss_pred             cCCCCCeecCCC
Q psy12029         47 CGQEPQYFCPLC   58 (81)
Q Consensus        47 ~~~~~~~~c~~c   58 (81)
                      .|... |.|..|
T Consensus        25 ~G~qr-yrC~~C   35 (36)
T PF03811_consen   25 SGHQR-YRCKDC   35 (36)
T ss_pred             CCCEe-EecCcC
Confidence            34344 666655


No 190
>PF14787 zf-CCHC_5:  GAG-polyprotein viral zinc-finger; PDB: 1CL4_A 1DSV_A.
Probab=37.62  E-value=14  Score=14.32  Aligned_cols=14  Identities=14%  Similarity=0.529  Sum_probs=7.8

Q ss_pred             ecCcchhhccCchH
Q psy12029         25 SCSGCARVYKNKKS   38 (81)
Q Consensus        25 ~C~~c~~~~~~~~~   38 (81)
                      .|..|++.|.....
T Consensus         4 ~CprC~kg~Hwa~~   17 (36)
T PF14787_consen    4 LCPRCGKGFHWASE   17 (36)
T ss_dssp             C-TTTSSSCS-TTT
T ss_pred             cCcccCCCcchhhh
Confidence            57777777666543


No 191
>PRK12722 transcriptional activator FlhC; Provisional
Probab=37.51  E-value=24  Score=19.21  Aligned_cols=28  Identities=21%  Similarity=0.516  Sum_probs=17.1

Q ss_pred             eecCcchhhccCchHHHHHHHhhcCCCCCeecCCCCc
Q psy12029         24 FSCSGCARVYKNKKSLARHQTYECGQEPQYFCPLCPY   60 (81)
Q Consensus        24 ~~C~~c~~~~~~~~~l~~h~~~~~~~~~~~~c~~c~~   60 (81)
                      ..|..|+..|.....        ..... |.|..|..
T Consensus       135 ~~C~~Cgg~fv~~~~--------e~~~~-f~CplC~~  162 (187)
T PRK12722        135 SSCNCCGGHFVTHAH--------DPVGS-FVCGLCQP  162 (187)
T ss_pred             ccCCCCCCCeecccc--------ccCCC-CcCCCCCC
Confidence            568888887764321        11234 88888853


No 192
>PF14690 zf-ISL3:  zinc-finger of transposase IS204/IS1001/IS1096/IS1165
Probab=37.49  E-value=15  Score=14.46  Aligned_cols=9  Identities=22%  Similarity=0.593  Sum_probs=6.0

Q ss_pred             ceecCcchh
Q psy12029         23 LFSCSGCAR   31 (81)
Q Consensus        23 ~~~C~~c~~   31 (81)
                      |..|+.||.
T Consensus         2 ~~~Cp~Cg~   10 (47)
T PF14690_consen    2 PPRCPHCGS   10 (47)
T ss_pred             CccCCCcCC
Confidence            456777773


No 193
>PRK12860 transcriptional activator FlhC; Provisional
Probab=37.43  E-value=22  Score=19.35  Aligned_cols=28  Identities=21%  Similarity=0.585  Sum_probs=17.0

Q ss_pred             ceecCcchhhccCchHHHHHHHhhcCCCCCeecCCCC
Q psy12029         23 LFSCSGCARVYKNKKSLARHQTYECGQEPQYFCPLCP   59 (81)
Q Consensus        23 ~~~C~~c~~~~~~~~~l~~h~~~~~~~~~~~~c~~c~   59 (81)
                      ...|..|+..|.....        ..... |.|..|.
T Consensus       134 l~~C~~Cgg~fv~~~~--------e~~~~-f~CplC~  161 (189)
T PRK12860        134 LARCCRCGGKFVTHAH--------DLRHN-FVCGLCQ  161 (189)
T ss_pred             eccCCCCCCCeecccc--------ccCCC-CcCCCCC
Confidence            3568888887754321        12234 8888885


No 194
>COG0675 Transposase and inactivated derivatives [DNA replication, recombination, and repair]
Probab=37.05  E-value=21  Score=20.41  Aligned_cols=12  Identities=25%  Similarity=0.913  Sum_probs=8.6

Q ss_pred             eecCCCCcccCC
Q psy12029         53 YFCPLCPYRAKQ   64 (81)
Q Consensus        53 ~~c~~c~~~f~~   64 (81)
                      |.|+.||..+..
T Consensus       323 ~~C~~cg~~~~r  334 (364)
T COG0675         323 FKCPRCGFVHDR  334 (364)
T ss_pred             EECCCCCCeehh
Confidence            888888865443


No 195
>KOG0317|consensus
Probab=37.02  E-value=21  Score=20.77  Aligned_cols=32  Identities=25%  Similarity=0.559  Sum_probs=19.5

Q ss_pred             ecCcchhhccCchHHHHHHHhhcCCCCCeecCCCCcccC
Q psy12029         25 SCSGCARVYKNKKSLARHQTYECGQEPQYFCPLCPYRAK   63 (81)
Q Consensus        25 ~C~~c~~~~~~~~~l~~h~~~~~~~~~~~~c~~c~~~f~   63 (81)
                      .|..||..|.+..-+     ...+++.  +|+.|...|.
T Consensus       253 SaTpCGHiFCWsCI~-----~w~~ek~--eCPlCR~~~~  284 (293)
T KOG0317|consen  253 SATPCGHIFCWSCIL-----EWCSEKA--ECPLCREKFQ  284 (293)
T ss_pred             CcCcCcchHHHHHHH-----HHHcccc--CCCcccccCC
Confidence            355688888776532     3345554  6888875543


No 196
>cd01121 Sms Sms (bacterial radA) DNA repair protein. This protein is not related to archael radA any more than is to other RecA-like NTPases. Sms has a role in recombination and recombinational repair and is responsible for the stabilization or processing of branched DNA molecules.
Probab=36.81  E-value=23  Score=21.31  Aligned_cols=9  Identities=33%  Similarity=0.829  Sum_probs=5.1

Q ss_pred             ceecCcchh
Q psy12029         23 LFSCSGCAR   31 (81)
Q Consensus        23 ~~~C~~c~~   31 (81)
                      -..|+.|+.
T Consensus        14 ~g~cp~c~~   22 (372)
T cd01121          14 LGKCPECGE   22 (372)
T ss_pred             cEECcCCCC
Confidence            345666654


No 197
>KOG1280|consensus
Probab=36.44  E-value=49  Score=20.02  Aligned_cols=43  Identities=19%  Similarity=0.460  Sum_probs=26.7

Q ss_pred             ccCCCceecCcchhhccCchHHHHHHHh-hcCCCCCeecCCCCc
Q psy12029         18 YFADRLFSCSGCARVYKNKKSLARHQTY-ECGQEPQYFCPLCPY   60 (81)
Q Consensus        18 ~~~~~~~~C~~c~~~~~~~~~l~~h~~~-~~~~~~~~~c~~c~~   60 (81)
                      +-...-|.|+.|+..-.....+.-|... |....+...|..|+.
T Consensus        74 ~y~~qSftCPyC~~~Gfte~~f~~Hv~s~Hpda~~~~icp~c~~  117 (381)
T KOG1280|consen   74 HYDPQSFTCPYCGIMGFTERQFGTHVLSQHPEASTSVICPLCAA  117 (381)
T ss_pred             ccccccccCCcccccccchhHHHHHhhhcCcccCcceeeecccc
Confidence            3345578999999866666667666654 333333256777753


No 198
>PF12230 PRP21_like_P:  Pre-mRNA splicing factor PRP21 like protein;  InterPro: IPR022030  This domain family is found in eukaryotes, and is typically between 212 and 238 amino acids in length. The family is found in association with PF01805 from PFAM. There are two completely conserved residues (W and H) that may be functionally important. PRP21 is required for assembly of the prespliceosome and it interacts with U2 snRNP and/or pre-mRNA in the prespliceosome. This family also contains proteins similar to PRP21, such as the mammalian SF3a. SF3a also interacts with U2 snRNP from the prespliceosome, converting it to its active form. ; PDB: 4DGW_B.
Probab=36.13  E-value=12  Score=20.64  Aligned_cols=24  Identities=21%  Similarity=0.369  Sum_probs=0.0

Q ss_pred             eecCCCCcccCCchHHHHHHHhhcC
Q psy12029         53 YFCPLCPYRAKQKTNLMTHMSIKHS   77 (81)
Q Consensus        53 ~~c~~c~~~f~~~~~l~~h~~~~~~   77 (81)
                      ..|++||...+.. .+..|+++.+.
T Consensus       169 ~~cPitGe~IP~~-e~~eHmRi~Ll  192 (229)
T PF12230_consen  169 IICPITGEMIPAD-EMDEHMRIELL  192 (229)
T ss_dssp             -------------------------
T ss_pred             ccccccccccccc-ccccccccccc
Confidence            6788898876544 57888887653


No 199
>PF10071 DUF2310:  Zn-ribbon-containing, possibly nucleic-acid-binding protein (DUF2310);  InterPro: IPR016908 This group represents uncharacterised conserved proteins.
Probab=35.89  E-value=16  Score=20.93  Aligned_cols=32  Identities=22%  Similarity=0.568  Sum_probs=21.1

Q ss_pred             CCCceecCcchhhccCchHHHHHHHhhcCCCCCeecCCCC
Q psy12029         20 ADRLFSCSGCARVYKNKKSLARHQTYECGQEPQYFCPLCP   59 (81)
Q Consensus        20 ~~~~~~C~~c~~~~~~~~~l~~h~~~~~~~~~~~~c~~c~   59 (81)
                      .+..-.|+.||+-......+  |     +--. |+|..|.
T Consensus       217 ~e~~r~CP~Cg~~W~L~~pl--h-----~iFd-FKCD~CR  248 (258)
T PF10071_consen  217 SEQARKCPSCGGDWRLKEPL--H-----DIFD-FKCDPCR  248 (258)
T ss_pred             HhhCCCCCCCCCccccCCch--h-----hcee-ccCCcce
Confidence            34556799999876665544  2     2234 8999885


No 200
>PF10276 zf-CHCC:  Zinc-finger domain;  InterPro: IPR019401 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.   This entry represents a short conserved zinc-finger domain. It contains the sequence motif Cx8Hx14Cx2C. ; PDB: 2JVM_A 2JRR_A 2JZ8_A.
Probab=35.24  E-value=19  Score=14.27  Aligned_cols=12  Identities=25%  Similarity=0.592  Sum_probs=9.0

Q ss_pred             CceecCcchhhc
Q psy12029         22 RLFSCSGCARVY   33 (81)
Q Consensus        22 ~~~~C~~c~~~~   33 (81)
                      ++..|+-|+..|
T Consensus        28 ~~~~CpYCg~~y   39 (40)
T PF10276_consen   28 GPVVCPYCGTRY   39 (40)
T ss_dssp             CEEEETTTTEEE
T ss_pred             CeEECCCCCCEE
Confidence            467888888765


No 201
>cd00974 DSRD Desulforedoxin (DSRD) domain; a small non-heme iron domain present in the desulforedoxin (rubredoxin oxidoreductase) and desulfoferrodoxin proteins of some archeael and bacterial methanogens and sulfate/sulfur reducers. Desulforedoxin is a small, single-domain homodimeric protein; each subunit contains an iron atom bound to four cysteinyl sulfur atoms, Fe(S-Cys)4, in a distorted tetrahedral coordination. Its metal center is similar to that found in rubredoxin type proteins. Desulforedoxin is regarded as a potential redox partner for rubredoxin. Desulfoferrodoxin forms a homodimeric protein, with each protomer comprised of two domains, the N-terminal DSRD domain and C-terminal superoxide reductase-like (SORL) domain. Each domain has a distinct iron center: the DSRD iron center I, Fe(S-Cys)4; and the SORL iron center II, Fe[His4Cys(Glu)].
Probab=35.07  E-value=20  Score=13.27  Aligned_cols=11  Identities=18%  Similarity=0.863  Sum_probs=8.0

Q ss_pred             ceecCcchhhc
Q psy12029         23 LFSCSGCARVY   33 (81)
Q Consensus        23 ~~~C~~c~~~~   33 (81)
                      -|.|..||...
T Consensus         4 ~ykC~~CGniv   14 (34)
T cd00974           4 VYKCEICGNIV   14 (34)
T ss_pred             EEEcCCCCcEE
Confidence            47888888654


No 202
>PF05191 ADK_lid:  Adenylate kinase, active site lid;  InterPro: IPR007862 Adenylate kinases (ADK; 2.7.4.3 from EC) are phosphotransferases that catalyse the Mg-dependent reversible conversion of ATP and AMP to two molecules of ADP, an essential reaction for many processes in living cells. In large variants of adenylate kinase, the AMP and ATP substrates are buried in a domain that undergoes conformational changes from an open to a closed state when bound to substrate; the ligand is then contained within a highly specific environment required for catalysis. Adenylate kinase is a 3-domain protein consisting of a large central CORE domain flanked by a LID domain on one side and the AMP-binding NMPbind domain on the other []. The LID domain binds ATP and covers the phosphates at the active site. The substrates first bind the CORE domain, followed by closure of the active site by the LID and NMPbind domains. Comparisons of adenylate kinases have revealed a particular divergence in the active site lid. In some organisms, particularly the Gram-positive bacteria, residues in the lid domain have been mutated to cysteines and these cysteine residues (two CX(n)C motifs) are responsible for the binding of a zinc ion. The bound zinc ion in the lid domain is clearly structurally homologous to Zinc-finger domains. However, it is unclear whether the adenylate kinase lid is a novel zinc-finger DNA/RNA binding domain, or that the lid bound zinc serves a purely structural function [].; GO: 0004017 adenylate kinase activity; PDB: 3BE4_A 2OSB_B 2ORI_A 2EU8_A 3DL0_A 1P3J_A 2QAJ_A 2OO7_A 2P3S_A 3DKV_A ....
Probab=34.82  E-value=20  Score=13.74  Aligned_cols=11  Identities=27%  Similarity=0.615  Sum_probs=6.0

Q ss_pred             eecCCCCcccC
Q psy12029         53 YFCPLCPYRAK   63 (81)
Q Consensus        53 ~~c~~c~~~f~   63 (81)
                      +.|..||+.|-
T Consensus         2 r~C~~Cg~~Yh   12 (36)
T PF05191_consen    2 RICPKCGRIYH   12 (36)
T ss_dssp             EEETTTTEEEE
T ss_pred             cCcCCCCCccc
Confidence            34666665543


No 203
>COG1779 C4-type Zn-finger protein [General function prediction only]
Probab=34.72  E-value=6.7  Score=21.41  Aligned_cols=39  Identities=23%  Similarity=0.433  Sum_probs=21.1

Q ss_pred             ceecCcchhhccCchHHHHHHHhhcCCC---CCeecCCCCcccCC
Q psy12029         23 LFSCSGCARVYKNKKSLARHQTYECGQE---PQYFCPLCPYRAKQ   64 (81)
Q Consensus        23 ~~~C~~c~~~~~~~~~l~~h~~~~~~~~---~~~~c~~c~~~f~~   64 (81)
                      ...|++|+..+.....+.  --.|-|+.   . +.|..||..+..
T Consensus        14 ~~~CPvCg~~l~~~~~~~--~IPyFG~V~i~t-~~C~~CgYR~~D   55 (201)
T COG1779          14 RIDCPVCGGTLKAHMYLY--DIPYFGEVLIST-GVCERCGYRSTD   55 (201)
T ss_pred             eecCCcccceeeEEEeee--cCCccceEEEEE-EEccccCCcccc
Confidence            356999987554443321  11233432   2 468888866543


No 204
>PF02891 zf-MIZ:  MIZ/SP-RING zinc finger;  InterPro: IPR004181 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents MIZ-type zinc finger domains. Miz1 (Msx-interacting-zinc finger) is a zinc finger-containing protein with homology to the yeast protein, Nfi-1. Miz1 is a sequence specific DNA binding protein that can function as a positive-acting transcription factor. Miz1 binds to the homeobox protein Msx2, enhancing the specific DNA-binding ability of Msx2 []. Other proteins containing this domain include the human pias family (protein inhibitor of activated STAT protein). More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 3I2D_A.
Probab=34.38  E-value=25  Score=14.46  Aligned_cols=23  Identities=22%  Similarity=0.561  Sum_probs=9.0

Q ss_pred             ccCchHHHHHHHhhcCCCCCeecCCCCc
Q psy12029         33 YKNKKSLARHQTYECGQEPQYFCPLCPY   60 (81)
Q Consensus        33 ~~~~~~l~~h~~~~~~~~~~~~c~~c~~   60 (81)
                      |.....|...+.    ... |.|+.|++
T Consensus        27 FDl~~fl~~~~~----~~~-W~CPiC~~   49 (50)
T PF02891_consen   27 FDLESFLESNQR----TPK-WKCPICNK   49 (50)
T ss_dssp             EEHHHHHHHHHH----S----B-TTT--
T ss_pred             ECHHHHHHHhhc----cCC-eECcCCcC
Confidence            544444443332    234 89998874


No 205
>smart00064 FYVE Protein present in Fab1, YOTB, Vac1, and EEA1. The FYVE zinc finger is named after four proteins where it was first found: Fab1, YOTB/ZK632.12, Vac1, and EEA1. The FYVE finger has been shown to bind two Zn2+ ions. The FYVE finger has eight potential zinc coordinating cysteine positions. The FYVE finger is structurally related to the TIGR00319 desulf_FeS4 desulfoferrodoxin FeS4 iron-binding domain. Neelaredoxin, a monomeric blue non-heme iron protein, lacks this domain.
Probab=34.13  E-value=21  Score=13.17  Aligned_cols=12  Identities=17%  Similarity=0.866  Sum_probs=8.9

Q ss_pred             CceecCcchhhc
Q psy12029         22 RLFSCSGCARVY   33 (81)
Q Consensus        22 ~~~~C~~c~~~~   33 (81)
                      +-|.|..|+...
T Consensus         6 ~~ykC~~Cgniv   17 (34)
T TIGR00319         6 QVYKCEVCGNIV   17 (34)
T ss_pred             cEEEcCCCCcEE
Confidence            358899988754


No 207
>smart00440 ZnF_C2C2 C2C2 Zinc finger. Nucleic-acid-binding motif in transcriptional elongation factor TFIIS and RNA polymerases.
Probab=33.71  E-value=29  Score=13.52  Aligned_cols=10  Identities=40%  Similarity=0.873  Sum_probs=7.1

Q ss_pred             eecCCCCccc
Q psy12029         53 YFCPLCPYRA   62 (81)
Q Consensus        53 ~~c~~c~~~f   62 (81)
                      |.|..|+..+
T Consensus        29 y~C~~C~~~w   38 (40)
T smart00440       29 YVCTKCGHRW   38 (40)
T ss_pred             EEeCCCCCEe
Confidence            6787787654


No 208
>PF12907 zf-met2:  Zinc-binding
Probab=33.55  E-value=8.9  Score=15.23  Aligned_cols=8  Identities=25%  Similarity=0.974  Sum_probs=3.5

Q ss_pred             ecCCCCcc
Q psy12029         54 FCPLCPYR   61 (81)
Q Consensus        54 ~c~~c~~~   61 (81)
                      .|.+|..+
T Consensus         3 ~C~iC~qt   10 (40)
T PF12907_consen    3 ICKICRQT   10 (40)
T ss_pred             CcHHhhHH
Confidence            44444433


No 209
>PTZ00448 hypothetical protein; Provisional
Probab=33.31  E-value=37  Score=20.61  Aligned_cols=22  Identities=14%  Similarity=0.386  Sum_probs=16.3

Q ss_pred             eecCCCCcccCCchHHHHHHHh
Q psy12029         53 YFCPLCPYRAKQKTNLMTHMSI   74 (81)
Q Consensus        53 ~~c~~c~~~f~~~~~l~~h~~~   74 (81)
                      |.|..|+-.|........|.++
T Consensus       315 ~tC~~C~v~F~~~~~qR~H~KS  336 (373)
T PTZ00448        315 LLCRKCNIQLMDHNAFKQHYRS  336 (373)
T ss_pred             ccccccccccCCHHHHHHHhhh
Confidence            7799998888776666666653


No 210
>PTZ00064 histone acetyltransferase; Provisional
Probab=33.29  E-value=50  Score=21.12  Aligned_cols=22  Identities=27%  Similarity=0.430  Sum_probs=17.3

Q ss_pred             eecCCCCcccCCchHHHHHHHh
Q psy12029         53 YFCPLCPYRAKQKTNLMTHMSI   74 (81)
Q Consensus        53 ~~c~~c~~~f~~~~~l~~h~~~   74 (81)
                      |.|..|-+.|.....+..|+..
T Consensus       281 YICEfCLkY~~s~~~l~rH~~~  302 (552)
T PTZ00064        281 HFCEYCLDFFCFEDELIRHLSR  302 (552)
T ss_pred             EEccchhhhhCCHHHHHHHHhc
Confidence            7788888888888888888763


No 211
>PF05876 Terminase_GpA:  Phage terminase large subunit (GpA);  InterPro: IPR008866 This entry is represented by Bacteriophage lambda, GpA. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches. This entry consists of several phage terminase large subunit proteins as well as related sequences from several bacterial species. The DNA packaging enzyme of bacteriophage lambda, terminase, is a heteromultimer composed of a small subunit, gpNu1, and a large subunit, gpA, products of the Nu1 and A genes, respectively. Terminase is involved in the site-specific binding and cutting of the DNA in the initial stages of packaging. It is now known that gpA is actively involved in late stages of packaging, including DNA translocation, and that this enzyme contains separate functional domains for its early and late packaging activities [].
Probab=33.25  E-value=11  Score=23.78  Aligned_cols=37  Identities=19%  Similarity=0.498  Sum_probs=21.6

Q ss_pred             eecCcchhhccCchHHHHHHHhhcC----CCCCeecCCCCcccCC
Q psy12029         24 FSCSGCARVYKNKKSLARHQTYECG----QEPQYFCPLCPYRAKQ   64 (81)
Q Consensus        24 ~~C~~c~~~~~~~~~l~~h~~~~~~----~~~~~~c~~c~~~f~~   64 (81)
                      .+|+.||..+.....-   .+...+    .-. |.|..||..+..
T Consensus       201 vpCPhCg~~~~l~~~~---l~w~~~~~~~~a~-y~C~~Cg~~i~e  241 (557)
T PF05876_consen  201 VPCPHCGEEQVLEWEN---LKWDKGEAPETAR-YVCPHCGCEIEE  241 (557)
T ss_pred             ccCCCCCCCccccccc---eeecCCCCccceE-EECCCCcCCCCH
Confidence            5699999876654211   222211    223 899999876543


No 212
>TIGR01384 TFS_arch transcription factor S, archaeal. There has been an apparent duplication event in the Halobacteriaceae lineage (Haloarcula, Haloferax, Haloquadratum, Halobacterium and Natromonas). There appears to be a separate duplication in Methanosphaera stadtmanae.
Probab=33.07  E-value=28  Score=16.55  Aligned_cols=12  Identities=17%  Similarity=0.711  Sum_probs=6.7

Q ss_pred             ceecCcchhhcc
Q psy12029         23 LFSCSGCARVYK   34 (81)
Q Consensus        23 ~~~C~~c~~~~~   34 (81)
                      .+.|+.|+..+.
T Consensus        16 ~~~C~~C~~~~~   27 (104)
T TIGR01384        16 VYVCPSCGYEKE   27 (104)
T ss_pred             eEECcCCCCccc
Confidence            456666665433


No 213
>COG4896 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=32.95  E-value=29  Score=15.25  Aligned_cols=7  Identities=57%  Similarity=1.744  Sum_probs=3.5

Q ss_pred             eecCCCC
Q psy12029         53 YFCPLCP   59 (81)
Q Consensus        53 ~~c~~c~   59 (81)
                      |.|++|.
T Consensus        32 ymC~eC~   38 (68)
T COG4896          32 YMCPECE   38 (68)
T ss_pred             EechhhH
Confidence            4555553


No 214
>TIGR01206 lysW lysine biosynthesis protein LysW. This very small, poorly characterized protein has been shown essential in Thermus thermophilus for an unusual pathway of Lys biosynthesis from aspartate by way of alpha-aminoadipate (AAA) rather than diaminopimelate. It is found also in Deinococcus radiodurans and Pyrococcus horikoshii, which appear to share the AAA pathway.
Probab=32.67  E-value=17  Score=15.42  Aligned_cols=31  Identities=19%  Similarity=0.469  Sum_probs=20.3

Q ss_pred             ceecCcchhhccCchHHHHHHHhhcCCCCCeecCCCCccc
Q psy12029         23 LFSCSGCARVYKNKKSLARHQTYECGQEPQYFCPLCPYRA   62 (81)
Q Consensus        23 ~~~C~~c~~~~~~~~~l~~h~~~~~~~~~~~~c~~c~~~f   62 (81)
                      .+.|+.||..+......       .|+ . ..|..||..+
T Consensus         2 ~~~CP~CG~~iev~~~~-------~Ge-i-V~Cp~CGael   32 (54)
T TIGR01206         2 QFECPDCGAEIELENPE-------LGE-L-VICDECGAEL   32 (54)
T ss_pred             ccCCCCCCCEEecCCCc-------cCC-E-EeCCCCCCEE
Confidence            36899999876543321       233 4 7899998655


No 215
>PLN00104 MYST -like histone acetyltransferase; Provisional
Probab=32.33  E-value=45  Score=20.85  Aligned_cols=22  Identities=41%  Similarity=0.766  Sum_probs=17.3

Q ss_pred             eecCCCCcccCCchHHHHHHHh
Q psy12029         53 YFCPLCPYRAKQKTNLMTHMSI   74 (81)
Q Consensus        53 ~~c~~c~~~f~~~~~l~~h~~~   74 (81)
                      |.|..|-+.|.....+..|+..
T Consensus       199 yiCe~Cl~y~~~~~~~~~H~~~  220 (450)
T PLN00104        199 YFCEFCLKFMKRKEQLQRHMKK  220 (450)
T ss_pred             EEchhhhhhhcCHHHHHHHHhc
Confidence            7788888888888888888763


No 216
>KOG3214|consensus
Probab=31.97  E-value=24  Score=17.17  Aligned_cols=41  Identities=17%  Similarity=0.254  Sum_probs=20.9

Q ss_pred             CCCceecCcchhhccCchHHHHHHHhhcCCCCCeecCCCCcccCCc
Q psy12029         20 ADRLFSCSGCARVYKNKKSLARHQTYECGQEPQYFCPLCPYRAKQK   65 (81)
Q Consensus        20 ~~~~~~C~~c~~~~~~~~~l~~h~~~~~~~~~~~~c~~c~~~f~~~   65 (81)
                      -...|.|..|..--.....+-   +.+. ... ..|.+|+..|...
T Consensus        20 ldt~FnClfcnHek~v~~~~D---k~~~-iG~-~sC~iC~esFqt~   60 (109)
T KOG3214|consen   20 LDTQFNCLFCNHEKSVSCTLD---KKHN-IGK-ASCRICEESFQTT   60 (109)
T ss_pred             hheeeccCccccccceeeeeh---hhcC-cce-eeeeehhhhhccc
Confidence            345677887764332222221   1111 123 5788888777643


No 217
>PF01096 TFIIS_C:  Transcription factor S-II (TFIIS);  InterPro: IPR001222 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents a zinc finger motif found in transcription factor IIs (TFIIS). In eukaryotes the initiation of transcription of protein encoding genes by polymerase II (Pol II) is modulated by general and specific transcription factors. The general transcription factors operate through common promoters elements (such as the TATA box). At least eight different proteins associate to form the general transcription factors: TFIIA, -IIB, -IID, -IIE, -IIF, -IIG, -IIH and -IIS []. During mRNA elongation, Pol II can encounter DNA sequences that cause reverse movement of the enzyme. Such backtracking involves extrusion of the RNA 3'-end into the pore, and can lead to transcriptional arrest. Escape from arrest requires cleavage of the extruded RNA with the help of TFIIS, which induces mRNA cleavage by enhancing the intrinsic nuclease activity of RNA polymerase (Pol) II, past template-encoded pause sites []. TFIIS extends from the polymerase surface via a pore to the internal active site. Two essential and invariant acidic residues in a TFIIS loop complement the Pol II active site and could position a metal ion and a water molecule for hydrolytic RNA cleavage. TFIIS also induces extensive structural changes in Pol II that would realign nucleic acids in the active centre.  TFIIS is a protein of about 300 amino acids. It contains three regions: a variable N-terminal domain not required for TFIIS activity; a conserved central domain required for Pol II binding; and a conserved C-terminal C4-type zinc finger essential for RNA cleavage. The zinc finger folds in a conformation termed a zinc ribbon [] characterised by a three-stranded antiparallel beta-sheet and two beta-hairpins. A backbone model for Pol II-TFIIS complex was obtained from X-ray analysis. It shows that a beta hairpin protrudes from the zinc finger and complements the pol II active site [].  Some viral proteins also contain the TFIIS zinc ribbon C-terminal domain. The Vaccinia virus protein, unlike its eukaryotic homologue, is an integral RNA polymerase subunit rather than a readily separable transcription factor []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003676 nucleic acid binding, 0008270 zinc ion binding, 0006351 transcription, DNA-dependent; PDB: 3M4O_I 3S14_I 2E2J_I 4A3J_I 3HOZ_I 1TWA_I 3S1Q_I 3S1N_I 1TWG_I 3I4M_I ....
Probab=31.80  E-value=25  Score=13.61  Aligned_cols=10  Identities=40%  Similarity=0.736  Sum_probs=6.0

Q ss_pred             eecCCCCccc
Q psy12029         53 YFCPLCPYRA   62 (81)
Q Consensus        53 ~~c~~c~~~f   62 (81)
                      |.|..|+..|
T Consensus        29 y~C~~C~~~w   38 (39)
T PF01096_consen   29 YVCCNCGHRW   38 (39)
T ss_dssp             EEESSSTEEE
T ss_pred             EEeCCCCCee
Confidence            5666666543


No 218
>cd01413 SIR2_Af2 SIR2_Af2: Archaeal and prokaryotic group which includes Archaeoglobus fulgidus Sir2-Af2, Sulfolobus solfataricus ssSir2, and several bacterial homologs; and are members of the SIR2 family of proteins, silent information regulator 2 (Sir2) enzymes which catalyze NAD+-dependent protein/histone deacetylation. Sir2 proteins have been shown to regulate gene silencing, DNA repair, metabolic enzymes, and life span. The Sir2 homolog from the archaea Sulfolobus solftaricus deacetylates the non-specific DNA protein Alba to mediate transcription repression.
Probab=31.79  E-value=62  Score=17.87  Aligned_cols=37  Identities=19%  Similarity=0.294  Sum_probs=20.1

Q ss_pred             ccCCCceecCcchhhccCchHHHHHHHhhcCCCCCeecCCCCc
Q psy12029         18 YFADRLFSCSGCARVYKNKKSLARHQTYECGQEPQYFCPLCPY   60 (81)
Q Consensus        18 ~~~~~~~~C~~c~~~~~~~~~l~~h~~~~~~~~~~~~c~~c~~   60 (81)
                      |..-....|..|+..+..... .   .......|  .|+.|+.
T Consensus       108 HG~l~~~~C~~C~~~~~~~~~-~---~~~~~~~p--~C~~Cgg  144 (222)
T cd01413         108 HGTLQTAYCVNCGSKYDLEEV-K---YAKKHEVP--RCPKCGG  144 (222)
T ss_pred             cCCcCcceECCCCCCcchhHH-H---HhccCCCC--cCCCCCC
Confidence            444455778889877654432 1   11112233  6888864


No 219
>PF01780 Ribosomal_L37ae:  Ribosomal L37ae protein family;  InterPro: IPR002674 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms. The codons of the mRNA are exposed on the ribosome to allow tRNA binding. This leads to the incorporation of amino acids into the growing polypeptide chain in accordance with the genetic information. Incoming amino acid monomers enter the ribosomal A site in the form of aminoacyl-tRNAs complexed with elongation factor Tu (EF-Tu) and GTP. The growing polypeptide chain, situated in the P site as peptidyl-tRNA, is then transferred to aminoacyl-tRNA and the new peptidyl-tRNA, extended by one residue, is translocated to the P site with the aid the elongation factor G (EF-G) and GTP as the deacylated tRNA is released from the ribosome through one or more exit sites [, ]. About 2/3 of the mass of the ribosome consists of RNA and 1/3 of protein. The proteins are named in accordance with the subunit of the ribosome which they belong to - the small (S1 to S31) and the large (L1 to L44). Usually they decorate the rRNA cores of the subunits.  Many ribosomal proteins, particularly those of the large subunit, are composed of a globular, surfaced-exposed domain with long finger-like projections that extend into the rRNA core to stabilise its structure. Most of the proteins interact with multiple RNA elements, often from different domains. In the large subunit, about 1/3 of the 23S rRNA nucleotides are at least in van der Waal's contact with protein, and L22 interacts with all six domains of the 23S rRNA. Proteins S4 and S7, which initiate assembly of the 16S rRNA, are located at junctions of five and four RNA helices, respectively. In this way proteins serve to organise and stabilise the rRNA tertiary structure. While the crucial activities of decoding and peptide transfer are RNA based, proteins play an active role in functions that may have evolved to streamline the process of protein synthesis. In addition to their function in the ribosome, many ribosomal proteins have some function 'outside' the ribosome [, ]. This ribosomal protein is found in archaebacteria and eukaryotes []. Ribosomal protein L37 has a single zinc finger-like motif of the C2-C2 type [].; GO: 0003735 structural constituent of ribosome, 0006412 translation, 0005622 intracellular, 0005840 ribosome; PDB: 4A1E_Y 4A17_Y 4A1C_Y 4A1A_Y 3O58_g 3IZS_m 3O5H_g 1S1I_9 3IZR_m 1YSH_D ....
Probab=30.60  E-value=24  Score=16.76  Aligned_cols=31  Identities=13%  Similarity=0.380  Sum_probs=19.1

Q ss_pred             CceecCcchhhccCchHHHHHHHhhcCCCCCeecCCCCcccC
Q psy12029         22 RLFSCSGCARVYKNKKSLARHQTYECGQEPQYFCPLCPYRAK   63 (81)
Q Consensus        22 ~~~~C~~c~~~~~~~~~l~~h~~~~~~~~~~~~c~~c~~~f~   63 (81)
                      ..|.|+.|++.--.        +.-  .-. |.|..|++.|.
T Consensus        34 ~ky~Cp~Cgk~~vk--------R~a--~GI-W~C~~C~~~~A   64 (90)
T PF01780_consen   34 AKYTCPFCGKTSVK--------RVA--TGI-WKCKKCGKKFA   64 (90)
T ss_dssp             S-BEESSSSSSEEE--------EEE--TTE-EEETTTTEEEE
T ss_pred             CCCcCCCCCCceeE--------Eee--eEE-eecCCCCCEEe
Confidence            45889998865211        122  225 99999988764


No 220
>PLN02925 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase
Probab=29.71  E-value=70  Score=21.44  Aligned_cols=29  Identities=24%  Similarity=0.400  Sum_probs=19.4

Q ss_pred             eecCCCCcccCCchHHHHHHHhhcCCCCC
Q psy12029         53 YFCPLCPYRAKQKTNLMTHMSIKHSHYQG   81 (81)
Q Consensus        53 ~~c~~c~~~f~~~~~l~~h~~~~~~~~~~   81 (81)
                      ..|+-||++....-.+...++..++..+|
T Consensus       635 isCPgCGRT~~dlq~~~~~I~~~~~hl~G  663 (733)
T PLN02925        635 VSCPSCGRTLFDLQEVSAEIREKTSHLPG  663 (733)
T ss_pred             EECCCCCCccccHHHHHHHHHHHhhcCCC
Confidence            46888998877665666666666655544


No 221
>COG2879 Uncharacterized small protein [Function unknown]
Probab=29.69  E-value=62  Score=14.32  Aligned_cols=17  Identities=29%  Similarity=0.389  Sum_probs=11.9

Q ss_pred             CchHHHHHHHhhcCCCC
Q psy12029         64 QKTNLMTHMSIKHSHYQ   80 (81)
Q Consensus        64 ~~~~l~~h~~~~~~~~~   80 (81)
                      .-+++-.|++.+|.++|
T Consensus        24 dYdnYVehmr~~hPd~p   40 (65)
T COG2879          24 DYDNYVEHMRKKHPDKP   40 (65)
T ss_pred             cHHHHHHHHHHhCcCCC
Confidence            44567778888777665


No 222
>PF11789 zf-Nse:  Zinc-finger of the MIZ type in Nse subunit; PDB: 2YU4_A 3HTK_C.
Probab=29.63  E-value=44  Score=14.20  Aligned_cols=17  Identities=6%  Similarity=0.391  Sum_probs=8.6

Q ss_pred             CCceecCcchhhccCch
Q psy12029         21 DRLFSCSGCARVYKNKK   37 (81)
Q Consensus        21 ~~~~~C~~c~~~~~~~~   37 (81)
                      +.|.....|+..|....
T Consensus        22 ~~PV~s~~C~H~fek~a   38 (57)
T PF11789_consen   22 EDPVKSKKCGHTFEKEA   38 (57)
T ss_dssp             SSEEEESSS--EEEHHH
T ss_pred             hCCcCcCCCCCeecHHH
Confidence            34566666766665544


No 223
>PLN02748 tRNA dimethylallyltransferase
Probab=29.61  E-value=51  Score=20.70  Aligned_cols=21  Identities=19%  Similarity=0.430  Sum_probs=16.3

Q ss_pred             eecCCCCc-ccCCchHHHHHHH
Q psy12029         53 YFCPLCPY-RAKQKTNLMTHMS   73 (81)
Q Consensus        53 ~~c~~c~~-~f~~~~~l~~h~~   73 (81)
                      |.|..|++ .+.-...+..|++
T Consensus       419 ~~Ce~C~~~~~~G~~eW~~Hlk  440 (468)
T PLN02748        419 YVCEACGNKVLRGAHEWEQHKQ  440 (468)
T ss_pred             ccccCCCCcccCCHHHHHHHhc
Confidence            78999997 6777777777765


No 224
>PF03884 DUF329:  Domain of unknown function (DUF329);  InterPro: IPR005584 The biological function of these short proteins is unknown, but they contain four conserved cysteines, suggesting that they all bind zinc. YacG (Q5X8H6 from SWISSPROT) from Escherichia coli has been shown to bind zinc and contains the structural motifs typical of zinc-binding proteins []. The conserved four cysteine motif in these proteins (-C-X(2)-C-X(15)-C-X(3)-C-) is not found in other zinc-binding proteins with known structures.; GO: 0008270 zinc ion binding; PDB: 1LV3_A.
Probab=29.45  E-value=25  Score=15.15  Aligned_cols=12  Identities=17%  Similarity=0.473  Sum_probs=5.2

Q ss_pred             eecCcchhhccC
Q psy12029         24 FSCSGCARVYKN   35 (81)
Q Consensus        24 ~~C~~c~~~~~~   35 (81)
                      ..|++|++....
T Consensus         3 v~CP~C~k~~~~   14 (57)
T PF03884_consen    3 VKCPICGKPVEW   14 (57)
T ss_dssp             EE-TTT--EEE-
T ss_pred             ccCCCCCCeecc
Confidence            468888776544


No 225
>PF08273 Prim_Zn_Ribbon:  Zinc-binding domain of primase-helicase;  InterPro: IPR013237 This entry is represented by bacteriophage T7 Gp4. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches. This entry represents a zinc binding domain found in the N-terminal region of the bacteriophage T7 Gp4 and P4 alpha protein. P4 is a multifunctional protein with origin recognition, helicase and primase activities [, , ].; GO: 0003896 DNA primase activity, 0004386 helicase activity, 0008270 zinc ion binding; PDB: 1NUI_B.
Probab=28.34  E-value=24  Score=13.93  Aligned_cols=10  Identities=20%  Similarity=0.481  Sum_probs=4.9

Q ss_pred             CceecCcchh
Q psy12029         22 RLFSCSGCAR   31 (81)
Q Consensus        22 ~~~~C~~c~~   31 (81)
                      +..+|+.|+.
T Consensus         2 ~h~pCP~CGG   11 (40)
T PF08273_consen    2 KHGPCPICGG   11 (40)
T ss_dssp             EEE--TTTT-
T ss_pred             CCCCCCCCcC
Confidence            3457888885


No 226
>TIGR03829 YokU_near_AblA uncharacterized protein, YokU family. Members of this protein family occur in various species of the genus Bacillus, always next to the gene (kamA or ablA) for lysine 2,3-aminomutase. Members have a pair of CXXC motifs, and share homology to the amino-terminal region of a family of putative transcription factors for which the C-terminal is modeled by pfam01381, a helix-turn-helix domain model. This family, however, is shorter and lacks the helix-turn-helix region. The function of this protein family is unknown, but a regulatory role in compatible solute biosynthesis is suggested by local genome context.
Probab=27.44  E-value=61  Score=15.42  Aligned_cols=18  Identities=22%  Similarity=0.519  Sum_probs=10.9

Q ss_pred             CCCeecCCCCcccCCchH
Q psy12029         50 EPQYFCPLCPYRAKQKTN   67 (81)
Q Consensus        50 ~~~~~c~~c~~~f~~~~~   67 (81)
                      .|...|..||-.+.....
T Consensus        33 VPa~~C~~CGe~y~~dev   50 (89)
T TIGR03829        33 TPSISCSHCGMEYQDDTT   50 (89)
T ss_pred             CCcccccCCCcEeecHHH
Confidence            344677777776655443


No 227
>PRK06260 threonine synthase; Validated
Probab=27.18  E-value=36  Score=20.53  Aligned_cols=14  Identities=14%  Similarity=0.719  Sum_probs=7.4

Q ss_pred             ceecCcchhhccCc
Q psy12029         23 LFSCSGCARVYKNK   36 (81)
Q Consensus        23 ~~~C~~c~~~~~~~   36 (81)
                      .+.|+.|+..+...
T Consensus        19 ~~~Cp~cg~~l~~~   32 (397)
T PRK06260         19 IYTCPECGGLLEVI   32 (397)
T ss_pred             cccCCCCCCeEEEE
Confidence            35566666544433


No 228
>PF11672 DUF3268:  Protein of unknown function (DUF3268);  InterPro: IPR021686 This entry is represented by Listeria phage P100, Gp150. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches.
Probab=26.43  E-value=24  Score=17.18  Aligned_cols=9  Identities=22%  Similarity=0.586  Sum_probs=5.5

Q ss_pred             ceecCcchh
Q psy12029         23 LFSCSGCAR   31 (81)
Q Consensus        23 ~~~C~~c~~   31 (81)
                      |-.|+-||.
T Consensus         2 p~~CpYCg~   10 (102)
T PF11672_consen    2 PIICPYCGG   10 (102)
T ss_pred             CcccCCCCC
Confidence            455666665


No 229
>KOG0227|consensus
Probab=26.39  E-value=51  Score=18.18  Aligned_cols=27  Identities=19%  Similarity=0.378  Sum_probs=18.3

Q ss_pred             cccccCCCceecCcchhhccCchHHHHHH
Q psy12029         15 ESSYFADRLFSCSGCARVYKNKKSLARHQ   43 (81)
Q Consensus        15 ~~~~~~~~~~~C~~c~~~~~~~~~l~~h~   43 (81)
                      ++.|.|  .|.|..|.....+..++..|.
T Consensus        47 mkNh~G--~yeCkLClT~H~ne~Syl~Ht   73 (222)
T KOG0227|consen   47 MKNHLG--KYECKLCLTLHNNEGSYLAHT   73 (222)
T ss_pred             hhccCc--ceeehhhhhhhcchhhhhhhh
Confidence            455666  488888887777766666554


No 230
>KOG0782|consensus
Probab=26.32  E-value=11  Score=24.30  Aligned_cols=27  Identities=15%  Similarity=0.200  Sum_probs=16.1

Q ss_pred             hhcccccccCCCceecCcchhhccCch
Q psy12029         11 FQITESSYFADRLFSCSGCARVYKNKK   37 (81)
Q Consensus        11 l~~~~~~~~~~~~~~C~~c~~~~~~~~   37 (81)
                      +..|-=.|.....-.|..|++.|.++-
T Consensus       241 fvrHHWVHrrRqeGkC~~CgKgFQQKf  267 (1004)
T KOG0782|consen  241 FVRHHWVHRRRQEGKCNTCGKGFQQKF  267 (1004)
T ss_pred             chHHhHhhHhhhccccchhhhhhhhhe
Confidence            344444455555567888887775544


No 231
>PRK01343 zinc-binding protein; Provisional
Probab=26.20  E-value=52  Score=14.22  Aligned_cols=12  Identities=17%  Similarity=0.504  Sum_probs=8.5

Q ss_pred             ceecCcchhhcc
Q psy12029         23 LFSCSGCARVYK   34 (81)
Q Consensus        23 ~~~C~~c~~~~~   34 (81)
                      ...|++|++.+.
T Consensus         9 ~~~CP~C~k~~~   20 (57)
T PRK01343          9 TRPCPECGKPST   20 (57)
T ss_pred             CCcCCCCCCcCc
Confidence            356888888754


No 232
>KOG0562|consensus
Probab=26.11  E-value=80  Score=17.06  Aligned_cols=21  Identities=19%  Similarity=0.322  Sum_probs=8.4

Q ss_pred             eecCcchhhccCchHHHHHHH
Q psy12029         24 FSCSGCARVYKNKKSLARHQT   44 (81)
Q Consensus        24 ~~C~~c~~~~~~~~~l~~h~~   44 (81)
                      .+|..|+.....-..|..|.+
T Consensus       154 LrC~~Cq~~~~~~~kLK~Hl~  174 (184)
T KOG0562|consen  154 LRCWRCQTFGPHFPKLKAHLR  174 (184)
T ss_pred             eeehhhhhcccccHHHHHHHH
Confidence            444444432222334444444


No 233
>KOG3014|consensus
Probab=26.06  E-value=55  Score=18.81  Aligned_cols=31  Identities=19%  Similarity=0.386  Sum_probs=22.0

Q ss_pred             cccCCCce---ecCcchhhccCc--hHHHHHHHhhc
Q psy12029         17 SYFADRLF---SCSGCARVYKNK--KSLARHQTYEC   47 (81)
Q Consensus        17 ~~~~~~~~---~C~~c~~~~~~~--~~l~~h~~~~~   47 (81)
                      ...|.+.+   .|..|+..+...  .+...|+..|.
T Consensus        28 ld~Gqk~fg~~~C~~Cgm~Yt~~s~EDe~~H~~fH~   63 (257)
T KOG3014|consen   28 LDAGQKDFGAVKCKECGMKYTVTSPEDEALHEKFHN   63 (257)
T ss_pred             eecCccccCceehhhcCceecCCCHHHHHHHHHHHH
Confidence            34455544   699999877664  46778988887


No 234
>COG1379 PHP family phosphoesterase with a Zn ribbon [General function prediction only]
Probab=26.01  E-value=27  Score=20.98  Aligned_cols=10  Identities=30%  Similarity=0.856  Sum_probs=5.8

Q ss_pred             eecCCCCccc
Q psy12029         53 YFCPLCPYRA   62 (81)
Q Consensus        53 ~~c~~c~~~f   62 (81)
                      |.|+.||..+
T Consensus       266 wrCpkCGg~i  275 (403)
T COG1379         266 WRCPKCGGKI  275 (403)
T ss_pred             ccCcccccch
Confidence            5666666533


No 235
>PRK05580 primosome assembly protein PriA; Validated
Probab=25.98  E-value=15  Score=23.91  Aligned_cols=9  Identities=33%  Similarity=0.729  Sum_probs=6.0

Q ss_pred             eecCCCCcc
Q psy12029         53 YFCPLCPYR   61 (81)
Q Consensus        53 ~~c~~c~~~   61 (81)
                      ..|+.|+..
T Consensus       422 ~~Cp~Cg~~  430 (679)
T PRK05580        422 KACPECGST  430 (679)
T ss_pred             CCCCCCcCC
Confidence            677777643


No 236
>PF02146 SIR2:  Sir2 family;  InterPro: IPR003000 These sequences represent the Sirtuin (Sir2-related) family of NAD+-dependent deacetylases. This family of enzymes is broadly conserved from bacteria to humans. In yeast, Sir2 proteins form complexes with other proteins to silence chromatin by accessing histones and deacetylating them. Sir2 proteins have been proposed to play a role in silencing, chromosome stability and ageing []. The bacterial enzyme CobB, an homologue of Sir2, is a phosphoribosyltransferase []. An in vitro ADP ribosyltransferase activity has also been associated with human members of this family []. Sir2-like enzymes employ NAD+ as a cosubstrate in deacetylation reactions [] and catalyse a reaction in which the cleavage of NAD(+)and histone and/or protein deacetylation are coupled to the formation of O-acetyl-ADP-ribose, a novel metabolite. The dependence of the reaction on both NAD(+) and the generation of this potential second messenger offers new clues to understanding the function and regulation of nuclear, cytoplasmic and mitochondrial Sir2-like enzymes []. Silent Information Regulator protein of Saccharomyces cerevisiae (Sir2) is one of several factors critical for silencing at least three loci. Among them, it is unique because it silences the rDNA as well as the mating type loci and telomeres []. Sir2 interacts in a complex with itself and with Sir3 and Sir4, two proteins that are able to interact with nucleosomes. In addition Sir2 also interacts with ubiquitination factors and/or complexes [].  Homologues of Sir2 share a core domain including the GAG and NID motifs and a putative C4 Zinc finger. The regions containing these three conserved motifs are individually essential for Sir2 silencing function, as are the four cysteins []. In addition, the conserved residues HG next to the putative Zn finger have been shown to be essential for the ADP ribosyltransferase activity []. ; GO: 0008270 zinc ion binding, 0070403 NAD+ binding, 0006476 protein deacetylation; PDB: 1S5P_A 3PKI_E 3PKJ_F 3K35_A 1ICI_A 1M2K_A 1M2G_A 1M2N_B 1M2H_A 1M2J_A ....
Probab=25.94  E-value=52  Score=17.29  Aligned_cols=39  Identities=23%  Similarity=0.401  Sum_probs=22.5

Q ss_pred             ccCCCceecCcchhhccCchHHHHHHHhhcCCCCCeecCCCCcc
Q psy12029         18 YFADRLFSCSGCARVYKNKKSLARHQTYECGQEPQYFCPLCPYR   61 (81)
Q Consensus        18 ~~~~~~~~C~~c~~~~~~~~~l~~h~~~~~~~~~~~~c~~c~~~   61 (81)
                      |..-....|..|+..+.......   ..... .. -.|..|+..
T Consensus       100 HG~l~~~~C~~C~~~~~~~~~~~---~~~~~-~~-~~C~~C~~~  138 (178)
T PF02146_consen  100 HGSLFRLRCSKCGKEYDREDIVD---SIDEE-EP-PRCPKCGGL  138 (178)
T ss_dssp             TEEEEEEEETTTSBEEEGHHHHH---HHHTT-SS-CBCTTTSCB
T ss_pred             HhhhceeeecCCCccccchhhcc---ccccc-cc-ccccccCcc
Confidence            44445578999998876543221   12222 23 478888763


No 237
>PF12773 DZR:  Double zinc ribbon
Probab=25.93  E-value=43  Score=13.35  Aligned_cols=9  Identities=33%  Similarity=0.855  Sum_probs=6.1

Q ss_pred             eecCCCCcc
Q psy12029         53 YFCPLCPYR   61 (81)
Q Consensus        53 ~~c~~c~~~   61 (81)
                      ..|..|+..
T Consensus        30 ~~C~~Cg~~   38 (50)
T PF12773_consen   30 KICPNCGAE   38 (50)
T ss_pred             CCCcCCcCC
Confidence            567777764


No 238
>PF05766 NinG:  Bacteriophage Lambda NinG protein;  InterPro: IPR008713 The ninR region of phage lambda contains two recombination genes, ninB (also known as orf) and ninG (also known as rap). These genes are involved in the RecF and RecBCD recombination pathways of Escherichia coli that operate on phage lambda [, ]. NinB and NinG participate in Red recombination, the primary pathway operating when wild-type lambda grows lytically in rec+ cells [].
Probab=25.80  E-value=20  Score=19.53  Aligned_cols=13  Identities=15%  Similarity=0.393  Sum_probs=7.4

Q ss_pred             ceecCcchhhccC
Q psy12029         23 LFSCSGCARVYKN   35 (81)
Q Consensus        23 ~~~C~~c~~~~~~   35 (81)
                      +-.|.+|+..|..
T Consensus         6 ~rKCKvCg~~F~P   18 (189)
T PF05766_consen    6 RRKCKVCGEWFVP   18 (189)
T ss_pred             CCcCcccCCcccc
Confidence            3456666666554


No 239
>PF14446 Prok-RING_1:  Prokaryotic RING finger family 1
Probab=25.17  E-value=29  Score=14.80  Aligned_cols=13  Identities=23%  Similarity=0.777  Sum_probs=9.2

Q ss_pred             eecCcchhhccCc
Q psy12029         24 FSCSGCARVYKNK   36 (81)
Q Consensus        24 ~~C~~c~~~~~~~   36 (81)
                      ..|..|+..|...
T Consensus         6 ~~C~~Cg~~~~~~   18 (54)
T PF14446_consen    6 CKCPVCGKKFKDG   18 (54)
T ss_pred             ccChhhCCcccCC
Confidence            4688888877543


No 240
>COG4888 Uncharacterized Zn ribbon-containing protein [General function prediction only]
Probab=25.04  E-value=38  Score=16.50  Aligned_cols=39  Identities=13%  Similarity=0.306  Sum_probs=21.2

Q ss_pred             CCCceecCcchhhccCchHHHHHHHhhcCCCCCeecCCCCcccC
Q psy12029         20 ADRLFSCSGCARVYKNKKSLARHQTYECGQEPQYFCPLCPYRAK   63 (81)
Q Consensus        20 ~~~~~~C~~c~~~~~~~~~l~~h~~~~~~~~~~~~c~~c~~~f~   63 (81)
                      -.+.|.|+.|+..-.....+..     ........|..||..|.
T Consensus        19 L~k~FtCp~Cghe~vs~ctvkk-----~~~~g~~~Cg~CGls~e   57 (104)
T COG4888          19 LPKTFTCPRCGHEKVSSCTVKK-----TVNIGTAVCGNCGLSFE   57 (104)
T ss_pred             CCceEecCccCCeeeeEEEEEe-----cCceeEEEcccCcceEE
Confidence            3567999999975443322211     11111156778876553


No 241
>COG5188 PRP9 Splicing factor 3a, subunit 3 [RNA processing and modification]
Probab=24.96  E-value=50  Score=20.12  Aligned_cols=24  Identities=21%  Similarity=0.386  Sum_probs=19.8

Q ss_pred             CceecCcchhhccCchHHHHHHHh
Q psy12029         22 RLFSCSGCARVYKNKKSLARHQTY   45 (81)
Q Consensus        22 ~~~~C~~c~~~~~~~~~l~~h~~~   45 (81)
                      ..+-|..|++.|.....+..|...
T Consensus       237 ~~~YC~~C~r~f~~~~VFe~Hl~g  260 (470)
T COG5188         237 PKVYCVKCGREFSRSKVFEYHLEG  260 (470)
T ss_pred             cceeeHhhhhHhhhhHHHHHHHhh
Confidence            447799999999998888888763


No 242
>PLN03239 histone acetyltransferase; Provisional
Probab=24.94  E-value=60  Score=19.64  Aligned_cols=24  Identities=17%  Similarity=0.206  Sum_probs=20.0

Q ss_pred             CCCeecCCCCcccCCchHHHHHHHh
Q psy12029         50 EPQYFCPLCPYRAKQKTNLMTHMSI   74 (81)
Q Consensus        50 ~~~~~c~~c~~~f~~~~~l~~h~~~   74 (81)
                      .. |.|..|-+-|.+...+..|+..
T Consensus       105 ~l-YiCE~Clky~~~~~~l~~H~~~  128 (351)
T PLN03239        105 VL-YVCEFSFGFFARKSELLRFQAK  128 (351)
T ss_pred             eE-EEeccchhhhcCHHHHHHHHHh
Confidence            45 8999999999999999888753


No 243
>TIGR01385 TFSII transcription elongation factor S-II. This model represents eukaryotic transcription elongation factor S-II. This protein allows stalled RNA transcription complexes to perform a cleavage of the nascent RNA and restart at the newly generated 3-prime end.
Probab=24.89  E-value=9.9  Score=22.12  Aligned_cols=39  Identities=21%  Similarity=0.286  Sum_probs=19.7

Q ss_pred             CceecCcchhhccCchHHHHHHHhh-cC-CCCCeecCCCCcccC
Q psy12029         22 RLFSCSGCARVYKNKKSLARHQTYE-CG-QEPQYFCPLCPYRAK   63 (81)
Q Consensus        22 ~~~~C~~c~~~~~~~~~l~~h~~~~-~~-~~~~~~c~~c~~~f~   63 (81)
                      ..+.|+.|+..=...  ++.+.+.- .+ ..- |.|..||..|.
T Consensus       257 ~~~~C~~C~~~~~~~--~q~QtrsaDEpmT~f-~~C~~Cg~~w~  297 (299)
T TIGR01385       257 DLFTCGKCKQKKCTY--YQLQTRSADEPMTTF-VTCEECGNRWK  297 (299)
T ss_pred             ccccCCCCCCccceE--EEecccCCCCCCeEE-EEcCCCCCeee
Confidence            358899998532211  11222221 11 122 68988987654


No 244
>KOG0801|consensus
Probab=24.88  E-value=32  Score=18.38  Aligned_cols=19  Identities=16%  Similarity=0.415  Sum_probs=10.7

Q ss_pred             hhcccccccCCCceecCcchhh
Q psy12029         11 FQITESSYFADRLFSCSGCARV   32 (81)
Q Consensus        11 l~~~~~~~~~~~~~~C~~c~~~   32 (81)
                      |..|...|.+   +.|++|.+.
T Consensus       129 lP~hi~~~~g---~KCPvC~K~  147 (205)
T KOG0801|consen  129 LPVHIMDHSG---MKCPVCHKV  147 (205)
T ss_pred             cceeeeccCC---ccCCccccc
Confidence            4444444544   567777654


No 245
>PF04438 zf-HIT:  HIT zinc finger;  InterPro: IPR007529 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents the HIT-type zinc finger, which contains 7 conserved cysteines and one histidine that can potentially coordinate two zinc atoms. It has been named after the first protein that originally defined the domain: the yeast HIT1 protein (P46973 from SWISSPROT) []. The HIT-type zinc finger displays some sequence similarities to the MYND-type zinc finger. The function of this domain is unknown but it is mainly found in nuclear proteins involved in gene regulation and chromatin remodeling. This domain is also found in the thyroid receptor interacting protein 3 (TRIP-3) Q15649 from SWISSPROT, that specifically interacts with the ligand binding domain of the thyroid receptor. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 2YQP_A 2YQQ_A 1X4S_A.
Probab=24.71  E-value=45  Score=12.15  Aligned_cols=12  Identities=25%  Similarity=0.780  Sum_probs=5.3

Q ss_pred             ceecCcchhhcc
Q psy12029         23 LFSCSGCARVYK   34 (81)
Q Consensus        23 ~~~C~~c~~~~~   34 (81)
                      .|.|+.|+..+-
T Consensus        13 kY~Cp~C~~~~C   24 (30)
T PF04438_consen   13 KYRCPRCGARYC   24 (30)
T ss_dssp             SEE-TTT--EES
T ss_pred             EEECCCcCCcee
Confidence            466777765543


No 246
>PF05180 zf-DNL:  DNL zinc finger;  InterPro: IPR007853 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The DNL-type zinc finger is found in Tim15, a zinc finger protein essential for protein import into mitochondria. Mitochondrial functions rely on the correct transport of resident proteins synthesized in the cytosol to mitochondria. Protein import into mitochondria is mediated by membrane protein complexes, protein translocators, in the outer and inner mitochondrial membranes, in cooperation with their assistant proteins in the cytosol, intermembrane space and matrix. Proteins destined to the mitochondrial matrix cross the outer membrane with the aid of the outer membrane translocator, the tOM40 complex, and then the inner membrane with the aid of the inner membrane translocator, the TIM23 complex, and mitochondrial motor and chaperone (MMC) proteins including mitochondrial heat- shock protein 70 (mtHsp70), and translocase in the inner mitochondrial membrane (Tim)15. Tim15 is also known as zinc finger motif (Zim)17 or mtHsp70 escort protein (Hep)1. Tim15 contains a zinc-finger motif (CXXC and CXXC) of ~100 residues, which has been named DNL after a short C-terminal motif of D(N/H)L [, , ]. The DNL-type zinc finger is an L-shaped molecule. The two CXXC motifs are located at the end of the L, and are sandwiched by two- stranded antiparallel beta-sheets. Two short alpha-helices constitute another leg of the L. The outer (convex) face of the L has a large acidic groove, which is lined with five acidic residues, whereas the inner (concave) face of the L has two positively charged residues, next to the CXXC motifs []. This entry represents the DNL-type zinc finger.; GO: 0008270 zinc ion binding; PDB: 2E2Z_A.
Probab=24.51  E-value=5.2  Score=17.77  Aligned_cols=34  Identities=26%  Similarity=0.565  Sum_probs=17.8

Q ss_pred             ceecCcchhhccCchHHHHHHHhhcCCCCCeecCCCCc
Q psy12029         23 LFSCSGCARVYKNKKSLARHQTYECGQEPQYFCPLCPY   60 (81)
Q Consensus        23 ~~~C~~c~~~~~~~~~l~~h~~~~~~~~~~~~c~~c~~   60 (81)
                      .|.|..|+..-..  .+ ..+..+.|... .+|+-|..
T Consensus         4 ~FTC~~C~~Rs~~--~~-sk~aY~~GvVi-v~C~gC~~   37 (66)
T PF05180_consen    4 TFTCNKCGTRSAK--MF-SKQAYHKGVVI-VQCPGCKN   37 (66)
T ss_dssp             EEEETTTTEEEEE--EE-EHHHHHTSEEE-EE-TTS--
T ss_pred             EEEcCCCCCccce--ee-CHHHHhCCeEE-EECCCCcc
Confidence            4778888743221  11 12345667666 78887753


No 247
>KOG2747|consensus
Probab=24.50  E-value=54  Score=20.17  Aligned_cols=23  Identities=30%  Similarity=0.619  Sum_probs=16.2

Q ss_pred             eecCCCCcccCCchHHHHHHHhh
Q psy12029         53 YFCPLCPYRAKQKTNLMTHMSIK   75 (81)
Q Consensus        53 ~~c~~c~~~f~~~~~l~~h~~~~   75 (81)
                      |.|..|-+.+.+...|..|+...
T Consensus       159 YiCEfCLkY~~s~~~l~rH~~kC  181 (396)
T KOG2747|consen  159 YICEFCLKYMKSRTSLQRHLKKC  181 (396)
T ss_pred             EEehHHHhHhchHHHHHHHHHhc
Confidence            67777777777777777776643


No 248
>PF08271 TF_Zn_Ribbon:  TFIIB zinc-binding;  InterPro: IPR013137 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents a zinc finger motif found in transcription factor IIB (TFIIB). In eukaryotes the initiation of transcription of protein encoding genes by the polymerase II complexe (Pol II) is modulated by general and specific transcription factors. The general transcription factors operate through common promoters elements (such as the TATA box). At least seven different proteins associate to form the general transcription factors: TFIIA, -IIB, -IID, -IIE, -IIF, -IIG, and -IIH [].  TFIIB and TFIID are responsible for promoter recognition and interaction with pol II; together with Pol II, they form a minimal initiation complex capable of transcription under certain conditions. The TATA box of a Pol II promoter is bound in the initiation complex by the TBP subunit of TFIID, which bends the DNA around the C-terminal domain of TFIIB whereas the N-terminal zinc finger of TFIIB interacts with Pol II [, ]. The TFIIB zinc finger adopts a zinc ribbon fold characterised by two beta-hairpins forming two structurally similar zinc-binding sub-sites []. The zinc finger contacts the rbp1 subunit of Pol II through its dock domain, a conserved region of about 70 amino acids located close to the polymerase active site []. In the Pol II complex this surface is located near the RNA exit groove. Interestingly this sequence is best conserved in the three polymerases that utilise a TFIIB-like general transcription factor (Pol II, Pol III, and archaeal RNA polymerase) but not in Pol I [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0006355 regulation of transcription, DNA-dependent; PDB: 1VD4_A 1PFT_A 3K1F_M 3K7A_M 1RO4_A 1RLY_A 1DL6_A.
Probab=24.43  E-value=49  Score=12.92  Aligned_cols=7  Identities=43%  Similarity=0.989  Sum_probs=3.5

Q ss_pred             ecCCCCc
Q psy12029         54 FCPLCPY   60 (81)
Q Consensus        54 ~c~~c~~   60 (81)
                      .|+.|+.
T Consensus         2 ~Cp~Cg~    8 (43)
T PF08271_consen    2 KCPNCGS    8 (43)
T ss_dssp             SBTTTSS
T ss_pred             CCcCCcC
Confidence            4555553


No 249
>PF14311 DUF4379:  Domain of unknown function (DUF4379)
Probab=24.12  E-value=46  Score=13.76  Aligned_cols=13  Identities=31%  Similarity=0.651  Sum_probs=9.1

Q ss_pred             eecCCCCcccCCc
Q psy12029         53 YFCPLCPYRAKQK   65 (81)
Q Consensus        53 ~~c~~c~~~f~~~   65 (81)
                      ++|..|+..|...
T Consensus        29 W~C~~Cgh~w~~~   41 (55)
T PF14311_consen   29 WKCPKCGHEWKAS   41 (55)
T ss_pred             EECCCCCCeeEcc
Confidence            7888887665544


No 250
>smart00132 LIM Zinc-binding domain present in Lin-11, Isl-1, Mec-3. Zinc-binding domain family. Some LIM domains bind protein partners via tyrosine-containing motifs. LIM domains are found in many key regulators of developmental pathways.
Probab=23.64  E-value=33  Score=12.32  Aligned_cols=11  Identities=36%  Similarity=0.942  Sum_probs=7.4

Q ss_pred             ceecCcchhhc
Q psy12029         23 LFSCSGCARVY   33 (81)
Q Consensus        23 ~~~C~~c~~~~   33 (81)
                      -|.|..|+..+
T Consensus        27 Cf~C~~C~~~L   37 (39)
T smart00132       27 CFKCSKCGKPL   37 (39)
T ss_pred             CCCCcccCCcC
Confidence            46777777654


No 251
>PF06170 DUF983:  Protein of unknown function (DUF983);  InterPro: IPR009325 This family consists of several bacterial proteins of unknown function.
Probab=23.41  E-value=35  Score=15.98  Aligned_cols=11  Identities=27%  Similarity=0.797  Sum_probs=7.8

Q ss_pred             ecCcchhhccC
Q psy12029         25 SCSGCARVYKN   35 (81)
Q Consensus        25 ~C~~c~~~~~~   35 (81)
                      .|+.||..|..
T Consensus        10 ~C~~CG~d~~~   20 (86)
T PF06170_consen   10 RCPHCGLDYSH   20 (86)
T ss_pred             cccccCCcccc
Confidence            68888876644


No 252
>PRK12387 formate hydrogenlyase complex iron-sulfur subunit; Provisional
Probab=23.41  E-value=45  Score=17.67  Aligned_cols=18  Identities=28%  Similarity=0.678  Sum_probs=13.8

Q ss_pred             CceecCcchhhccCchHH
Q psy12029         22 RLFSCSGCARVYKNKKSL   39 (81)
Q Consensus        22 ~~~~C~~c~~~~~~~~~l   39 (81)
                      ..+.|..||+.|.....+
T Consensus       113 ~~~~C~~CG~~f~~~~~i  130 (180)
T PRK12387        113 ALCNCRVCGRPFAVQKEI  130 (180)
T ss_pred             CcccchhhCCccccHHHH
Confidence            467899999999766543


No 253
>PRK00481 NAD-dependent deacetylase; Provisional
Probab=23.27  E-value=92  Score=17.42  Aligned_cols=35  Identities=23%  Similarity=0.375  Sum_probs=20.2

Q ss_pred             cccCCCceecCcchhhccCchHHHHHHHhhcCCCCCeecCCCCc
Q psy12029         17 SYFADRLFSCSGCARVYKNKKSLARHQTYECGQEPQYFCPLCPY   60 (81)
Q Consensus        17 ~~~~~~~~~C~~c~~~~~~~~~l~~h~~~~~~~~~~~~c~~c~~   60 (81)
                      .|..-....|..|+..+.....+       ....|  .|+.|+.
T Consensus       116 lHG~~~~~~C~~C~~~~~~~~~~-------~~~~p--~C~~Cgg  150 (242)
T PRK00481        116 LHGSLLRARCTKCGQTYDLDEYL-------KPEPP--RCPKCGG  150 (242)
T ss_pred             ccCCcCceeeCCCCCCcChhhhc-------cCCCC--CCCCCCC
Confidence            35555567799998776543321       11233  4888864


No 254
>PF05741 zf-nanos:  Nanos RNA binding domain;  InterPro: IPR024161 Nanos is a highly conserved RNA-binding protein in higher eukaryotes and functions as a key regulatory protein in translational control using a 3' untranslated region during the development and maintenance of germ cells. Nanos comprises a non-conserved amino-terminus and highly conserved carboxy- terminal regions. The C-terminal region has two conserved Cys-Cys-His-Cys (CCHC)-type zinc-finger motifs that are indispensable for nanos function [, , ]. The structure of the nanos-type zinc finger is composed of two independent zinc-finger (ZF) lobes, the N-terminal ZF1 and the C-terminal ZF2, which are connected by a linker helix []. These lobes create a large cleft. Zinc ions in ZF1 and ZF2 are bound to the CCHC motif by tetrahedral coordination.; PDB: 3ALR_B.
Probab=23.05  E-value=36  Score=14.58  Aligned_cols=11  Identities=27%  Similarity=0.773  Sum_probs=3.4

Q ss_pred             CceecCcchhh
Q psy12029         22 RLFSCSGCARV   32 (81)
Q Consensus        22 ~~~~C~~c~~~   32 (81)
                      +.|.|+.||..
T Consensus        32 r~y~Cp~CgAt   42 (55)
T PF05741_consen   32 RKYVCPICGAT   42 (55)
T ss_dssp             GG---TTT---
T ss_pred             hcCcCCCCcCc
Confidence            45778888754


No 255
>KOG2857|consensus
Probab=23.00  E-value=38  Score=17.64  Aligned_cols=23  Identities=17%  Similarity=0.462  Sum_probs=19.3

Q ss_pred             CceecCcchhhccCchHHHHHHH
Q psy12029         22 RLFSCSGCARVYKNKKSLARHQT   44 (81)
Q Consensus        22 ~~~~C~~c~~~~~~~~~l~~h~~   44 (81)
                      ..|.|+.|.-.|.....+..|+.
T Consensus        16 ~KYKCpkC~vPYCSl~CfKiHk~   38 (157)
T KOG2857|consen   16 IKYKCPKCSVPYCSLPCFKIHKS   38 (157)
T ss_pred             hhccCCCCCCccccchhhhhccC
Confidence            36899999988888888888876


No 256
>PRK14892 putative transcription elongation factor Elf1; Provisional
Probab=22.95  E-value=36  Score=16.47  Aligned_cols=36  Identities=17%  Similarity=0.420  Sum_probs=19.7

Q ss_pred             CCceecCcchhhccCchHHHHHHHhhcCCCCCeecCCCCcccCC
Q psy12029         21 DRLFSCSGCARVYKNKKSLARHQTYECGQEPQYFCPLCPYRAKQ   64 (81)
Q Consensus        21 ~~~~~C~~c~~~~~~~~~l~~h~~~~~~~~~~~~c~~c~~~f~~   64 (81)
                      ...|.|+.|+.. ...-.+      ..+.-- ..|..||..+..
T Consensus        19 pt~f~CP~Cge~-~v~v~~------~k~~~h-~~C~~CG~y~~~   54 (99)
T PRK14892         19 PKIFECPRCGKV-SISVKI------KKNIAI-ITCGNCGLYTEF   54 (99)
T ss_pred             CcEeECCCCCCe-Eeeeec------CCCcce-EECCCCCCccCE
Confidence            356889999842 221111      112223 678889865543


No 257
>TIGR03831 YgiT_finger YgiT-type zinc finger domain. This domain model describes a small domain with two copies of a putative zinc-binding motif CXXC (usually CXXCG). Most member proteins consist largely of this domain or else carry an additional C-terminal helix-turn-helix domain, resembling that of the phage protein Cro and modeled by pfam01381.
Probab=22.69  E-value=45  Score=12.81  Aligned_cols=9  Identities=33%  Similarity=0.933  Sum_probs=4.7

Q ss_pred             eecCCCCcc
Q psy12029         53 YFCPLCPYR   61 (81)
Q Consensus        53 ~~c~~c~~~   61 (81)
                      +.|..||..
T Consensus        33 ~~C~~CGE~   41 (46)
T TIGR03831        33 LVCPQCGEE   41 (46)
T ss_pred             cccccCCCE
Confidence            455555543


No 258
>PF04810 zf-Sec23_Sec24:  Sec23/Sec24 zinc finger;  InterPro: IPR006895 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  COPII (coat protein complex II)-coated vesicles carry proteins from the endoplasmic reticulum (ER) to the Golgi complex []. COPII-coated vesicles form on the ER by the stepwise recruitment of three cytosolic components: Sar1-GTP to initiate coat formation, Sec23/24 heterodimer to select SNARE and cargo molecules, and Sec13/31 to induce coat polymerisation and membrane deformation [].  Sec23 p and Sec24p are structurally related, folding into five distinct domains: a beta-barrel, a zinc-finger, an alpha/beta trunk domain (IPR006896 from INTERPRO), an all-helical region (IPR006900 from INTERPRO), and a C-terminal gelsolin-like domain (IPR007123 from INTERPRO). This entry describes an approximately 55-residue Sec23/24 zinc-binding domain, which lies against the beta-barrel at the periphery of the complex. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0006886 intracellular protein transport, 0006888 ER to Golgi vesicle-mediated transport, 0030127 COPII vesicle coat; PDB: 3EFO_B 3EG9_B 3EGD_A 2YRC_A 2NUP_A 2YRD_A 3EGX_A 2NUT_A 3EH1_A 1PD0_A ....
Probab=22.67  E-value=67  Score=12.42  Aligned_cols=31  Identities=16%  Similarity=0.518  Sum_probs=11.8

Q ss_pred             ceecCcchhhccCchHHHHHHHhhcCCCCCeecCCCCc
Q psy12029         23 LFSCSGCARVYKNKKSLARHQTYECGQEPQYFCPLCPY   60 (81)
Q Consensus        23 ~~~C~~c~~~~~~~~~l~~h~~~~~~~~~~~~c~~c~~   60 (81)
                      |.+|..|+..+..-.      ....+.+. |.|..|+.
T Consensus         2 p~rC~~C~aylNp~~------~~~~~~~~-w~C~~C~~   32 (40)
T PF04810_consen    2 PVRCRRCRAYLNPFC------QFDDGGKT-WICNFCGT   32 (40)
T ss_dssp             S-B-TTT--BS-TTS------EEETTTTE-EEETTT--
T ss_pred             ccccCCCCCEECCcc------eEcCCCCE-EECcCCCC
Confidence            345666654332221      12223345 77777764


No 259
>PF09943 DUF2175:  Uncharacterized protein conserved in archaea (DUF2175);  InterPro: IPR018686  This family of various hypothetical archaeal proteins has no known function. 
Probab=22.67  E-value=33  Score=16.71  Aligned_cols=9  Identities=22%  Similarity=0.700  Sum_probs=6.7

Q ss_pred             eecCCCCcc
Q psy12029         53 YFCPLCPYR   61 (81)
Q Consensus        53 ~~c~~c~~~   61 (81)
                      |+|..||+.
T Consensus         3 WkC~iCg~~   11 (101)
T PF09943_consen    3 WKCYICGKP   11 (101)
T ss_pred             eEEEecCCe
Confidence            788888763


No 260
>COG4847 Uncharacterized protein conserved in archaea [Function unknown]
Probab=22.62  E-value=31  Score=16.62  Aligned_cols=11  Identities=18%  Similarity=0.634  Sum_probs=8.3

Q ss_pred             CceecCcchhh
Q psy12029         22 RLFSCSGCARV   32 (81)
Q Consensus        22 ~~~~C~~c~~~   32 (81)
                      +.|.|.+|+..
T Consensus         5 kewkC~VCg~~   15 (103)
T COG4847           5 KEWKCYVCGGT   15 (103)
T ss_pred             ceeeEeeeCCE
Confidence            56888888864


No 261
>PF11023 DUF2614:  Protein of unknown function (DUF2614);  InterPro: IPR020912 This entry describes proteins of unknown function, which are thought to be membrane proteins.; GO: 0005887 integral to plasma membrane
Probab=22.61  E-value=83  Score=15.72  Aligned_cols=11  Identities=18%  Similarity=0.673  Sum_probs=7.8

Q ss_pred             CceecCcchhh
Q psy12029         22 RLFSCSGCARV   32 (81)
Q Consensus        22 ~~~~C~~c~~~   32 (81)
                      ....|+.|++.
T Consensus        68 v~V~CP~C~K~   78 (114)
T PF11023_consen   68 VQVECPNCGKQ   78 (114)
T ss_pred             eeeECCCCCCh
Confidence            45678888865


No 262
>COG3024 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=22.57  E-value=36  Score=15.10  Aligned_cols=13  Identities=15%  Similarity=0.424  Sum_probs=9.0

Q ss_pred             ceecCcchhhccC
Q psy12029         23 LFSCSGCARVYKN   35 (81)
Q Consensus        23 ~~~C~~c~~~~~~   35 (81)
                      ...|++||+.-..
T Consensus         7 ~v~CP~Cgkpv~w   19 (65)
T COG3024           7 TVPCPTCGKPVVW   19 (65)
T ss_pred             cccCCCCCCcccc
Confidence            3579999976443


No 263
>cd01407 SIR2-fam SIR2 family of proteins includes silent information regulator 2 (Sir2) enzymes which catalyze NAD+-dependent protein/histone deacetylation, where the acetyl group from the lysine epsilon-amino group is transferred to the ADP-ribose moiety of NAD+, producing nicotinamide and the novel metabolite O-acetyl-ADP-ribose. Sir2 proteins, also known as sirtuins, are found in all eukaryotes and many archaea and prokaryotes and have been shown to regulate gene silencing, DNA repair, metabolic enzymes, and life span. The most-studied function, gene silencing, involves the inactivation of chromosome domains containing key regulatory genes by packaging them into a specialized chromatin structure that is inaccessible to DNA-binding proteins. The oligomerization state of Sir2 appears to be organism-dependent, sometimes occurring as a monomer and sometimes as a multimer.
Probab=22.47  E-value=1.2e+02  Score=16.63  Aligned_cols=39  Identities=21%  Similarity=0.392  Sum_probs=20.4

Q ss_pred             cccCCCceecCcchhhccCchHHHHHHHhhcCCCCCeecCCCCc
Q psy12029         17 SYFADRLFSCSGCARVYKNKKSLARHQTYECGQEPQYFCPLCPY   60 (81)
Q Consensus        17 ~~~~~~~~~C~~c~~~~~~~~~l~~h~~~~~~~~~~~~c~~c~~   60 (81)
                      .|..-....|..|+..+.... +.  ........|  .|+.|+.
T Consensus       103 lHG~~~~~~C~~C~~~~~~~~-~~--~~~~~~~~p--~C~~Cg~  141 (218)
T cd01407         103 LHGSLFRVRCTKCGKEYPRDE-LQ--ADIDREEVP--RCPKCGG  141 (218)
T ss_pred             CcCCcCcceeCCCcCCCcHHH-Hh--HhhccCCCC--cCCCCCC
Confidence            344445577888987765432 11  111122233  6888864


No 264
>smart00661 RPOL9 RNA polymerase subunit 9.
Probab=22.44  E-value=42  Score=13.45  Aligned_cols=14  Identities=21%  Similarity=0.415  Sum_probs=10.4

Q ss_pred             ceecCcchhhccCc
Q psy12029         23 LFSCSGCARVYKNK   36 (81)
Q Consensus        23 ~~~C~~c~~~~~~~   36 (81)
                      .+.|+.||..+...
T Consensus        20 ~~vC~~Cg~~~~~~   33 (52)
T smart00661       20 RFVCRKCGYEEPIE   33 (52)
T ss_pred             EEECCcCCCeEECC
Confidence            68899999765443


No 265
>PF03107 C1_2:  C1 domain;  InterPro: IPR004146 This short domain is rich in cysteines and histidines. The pattern of conservation is similar to that found in DAG_PE-bind (IPR002219 from INTERPRO), therefore we have termed this domain DC1 for divergent C1 domain. This domain probably also binds to two zinc ions. The function of proteins with this domain is uncertain, however this domain may bind to molecules such as diacylglycerol. This family are found in plant proteins.
Probab=22.43  E-value=55  Score=11.67  Aligned_cols=7  Identities=29%  Similarity=1.189  Sum_probs=3.3

Q ss_pred             ecCCCCc
Q psy12029         54 FCPLCPY   60 (81)
Q Consensus        54 ~c~~c~~   60 (81)
                      .|..|++
T Consensus         2 ~C~~C~~    8 (30)
T PF03107_consen    2 WCDVCRR    8 (30)
T ss_pred             CCCCCCC
Confidence            3455544


No 266
>PF02148 zf-UBP:  Zn-finger in ubiquitin-hydrolases and other protein;  InterPro: IPR001607 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents UBP-type zinc finger domains, which display some similarity with the Zn-binding domain of the insulinase family. The UBP-type zinc finger domain is found only in a small subfamily of ubiquitin C-terminal hydrolases (deubiquitinases or UBP) [, ], All members of this subfamily are isopeptidase-T, which are known to cleave isopeptide bonds between ubiquitin moieties. Some of the proteins containing an UBP zinc finger include:    Homo sapiens (Human) deubiquitinating enzyme 13 (UBPD) Human deubiquitinating enzyme 5 (UBP5)  Dictyostelium discoideum (Slime mold) deubiquitinating enzyme A (UBPA)  Saccharomyces cerevisiae (Baker's yeast) deubiquitinating enzyme 8 (UBP8) Yeast deubiquitinating enzyme 14 (UBP14)   More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 3GV4_A 3PHD_B 3C5K_A 2UZG_A 3IHP_B 2G43_B 2G45_D 2I50_A 3MHH_A 3MHS_A ....
Probab=22.37  E-value=37  Score=14.56  Aligned_cols=16  Identities=25%  Similarity=0.511  Sum_probs=10.9

Q ss_pred             CCceecCcchhhccCc
Q psy12029         21 DRLFSCSGCARVYKNK   36 (81)
Q Consensus        21 ~~~~~C~~c~~~~~~~   36 (81)
                      ...+.|-.|+..+...
T Consensus         9 ~~lw~CL~Cg~~~C~~   24 (63)
T PF02148_consen    9 SNLWLCLTCGYVGCGR   24 (63)
T ss_dssp             SSEEEETTTS-EEETT
T ss_pred             CceEEeCCCCcccccC
Confidence            4578888888776664


No 267
>COG1998 RPS31 Ribosomal protein S27AE [Translation, ribosomal structure and biogenesis]
Probab=22.19  E-value=66  Score=13.52  Aligned_cols=9  Identities=33%  Similarity=1.003  Sum_probs=6.9

Q ss_pred             eecCCCCcc
Q psy12029         53 YFCPLCPYR   61 (81)
Q Consensus        53 ~~c~~c~~~   61 (81)
                      |.|..||.+
T Consensus        38 ~~CGkCgyT   46 (51)
T COG1998          38 WACGKCGYT   46 (51)
T ss_pred             eEeccccce
Confidence            788888764


No 268
>COG1675 TFA1 Transcription initiation factor IIE, alpha subunit [Transcription]
Probab=22.07  E-value=22  Score=19.09  Aligned_cols=34  Identities=21%  Similarity=0.561  Sum_probs=19.5

Q ss_pred             cCCCceecCcchhhccCchHHHHHHHhhcCCCCCeecCCCCccc
Q psy12029         19 FADRLFSCSGCARVYKNKKSLARHQTYECGQEPQYFCPLCPYRA   62 (81)
Q Consensus        19 ~~~~~~~C~~c~~~~~~~~~l~~h~~~~~~~~~~~~c~~c~~~f   62 (81)
                      ....-|.|+.|.-.++.-..      ...   . |.|+.||...
T Consensus       109 ~~~~~y~C~~~~~r~sfdeA------~~~---~-F~Cp~Cg~~L  142 (176)
T COG1675         109 TENNYYVCPNCHVKYSFDEA------MEL---G-FTCPKCGEDL  142 (176)
T ss_pred             ccCCceeCCCCCCcccHHHH------HHh---C-CCCCCCCchh
Confidence            34455888777655544322      211   2 8888888543


No 269
>TIGR00244 transcriptional regulator NrdR. Members of this almost entirely bacterial family contain an ATP cone domain (PFAM:PF03477). There is never more than one member per genome. Common gene symbols given include nrdR, ybaD, ribX and ytcG. The member from Streptomyces coelicolor is found upstream in the operon of the class II oxygen-independent ribonucleotide reductase gene nrdJ and was shown to repress nrdJ expression. Many members of this family are found near genes for riboflavin biosynthesis in Gram-negative bacteria, suggesting a role in that pathway. However, a phylogenetic profiling study associates members of this family with the presence of a palindromic signal with consensus acaCwAtATaTwGtgt, termed the NrdR-box, an upstream element for most operons for ribonucleotide reductase of all three classes in bacterial genomes.
Probab=22.06  E-value=44  Score=17.48  Aligned_cols=12  Identities=25%  Similarity=0.304  Sum_probs=9.6

Q ss_pred             eecCCCCcccCC
Q psy12029         53 YFCPLCPYRAKQ   64 (81)
Q Consensus        53 ~~c~~c~~~f~~   64 (81)
                      -.|..|++.|..
T Consensus        29 ReC~~C~~RFTT   40 (147)
T TIGR00244        29 RECLECHERFTT   40 (147)
T ss_pred             ccCCccCCccce
Confidence            478899988865


No 270
>PF10164 DUF2367:  Uncharacterized conserved protein (DUF2367);  InterPro: IPR019317  This is a highly conserved set of proteins which contains three pairs of cysteine residues within a length of 42 amino acids and is rich in proline residues towards the N terminus. It includes a membrane protein that has been found to be highly expressed in the mouse brain and consequently, several members have been assigned as brain protein i3 (Bri3). Their function is unknown.
Probab=21.97  E-value=41  Score=16.26  Aligned_cols=10  Identities=30%  Similarity=0.644  Sum_probs=4.8

Q ss_pred             ceecCcchhh
Q psy12029         23 LFSCSGCARV   32 (81)
Q Consensus        23 ~~~C~~c~~~   32 (81)
                      ..+|..||..
T Consensus        88 ~~rC~nCG~~   97 (98)
T PF10164_consen   88 ERRCSNCGAT   97 (98)
T ss_pred             ccccCCCCcc
Confidence            3445555543


No 271
>PRK11032 hypothetical protein; Provisional
Probab=21.93  E-value=68  Score=17.04  Aligned_cols=28  Identities=25%  Similarity=0.562  Sum_probs=16.6

Q ss_pred             CceecCcchhhccCchHHHHHHHhhcCCCCCeecCCCCc
Q psy12029         22 RLFSCSGCARVYKNKKSLARHQTYECGQEPQYFCPLCPY   60 (81)
Q Consensus        22 ~~~~C~~c~~~~~~~~~l~~h~~~~~~~~~~~~c~~c~~   60 (81)
                      ....|..||.....         .+++..|  .|+.|+.
T Consensus       123 G~LvC~~Cg~~~~~---------~~p~~i~--pCp~C~~  150 (160)
T PRK11032        123 GNLVCEKCHHHLAF---------YTPEVLP--LCPKCGH  150 (160)
T ss_pred             ceEEecCCCCEEEe---------cCCCcCC--CCCCCCC
Confidence            34678888765311         3344444  6888874


No 272
>PF09855 DUF2082:  Nucleic-acid-binding protein containing Zn-ribbon domain (DUF2082);  InterPro: IPR018652  This family of proteins contains various hypothetical prokaryotic proteins as well as some Zn-ribbon nucleic-acid-binding proteins.
Probab=21.62  E-value=45  Score=14.71  Aligned_cols=7  Identities=57%  Similarity=1.492  Sum_probs=3.6

Q ss_pred             eecCCCC
Q psy12029         53 YFCPLCP   59 (81)
Q Consensus        53 ~~c~~c~   59 (81)
                      |.|+.|+
T Consensus         1 y~C~KCg    7 (64)
T PF09855_consen    1 YKCPKCG    7 (64)
T ss_pred             CCCCCCC
Confidence            3455554


No 273
>PF08792 A2L_zn_ribbon:  A2L zinc ribbon domain;  InterPro: IPR014900 This zinc ribbon protein is found associated with some viral A2L transcription factors []. 
Probab=21.55  E-value=53  Score=12.29  Aligned_cols=10  Identities=20%  Similarity=0.461  Sum_probs=6.1

Q ss_pred             eecCCCCccc
Q psy12029         53 YFCPLCPYRA   62 (81)
Q Consensus        53 ~~c~~c~~~f   62 (81)
                      +.|..|+..|
T Consensus        22 ~~C~~Cg~~~   31 (33)
T PF08792_consen   22 EVCIFCGSSF   31 (33)
T ss_pred             EEcccCCcEe
Confidence            5666676554


No 274
>cd04476 RPA1_DBD_C RPA1_DBD_C: A subfamily of OB folds corresponding to the C-terminal OB fold, the ssDNA-binding domain (DBD)-C, of human RPA1 (also called RPA70). RPA1 is the large subunit of Replication protein A (RPA). RPA is a nuclear ssDNA-binding protein (SSB) which appears to be involved in all aspects of DNA metabolism including replication, recombination, and repair. RPA also mediates specific interactions of various nuclear proteins. In animals, plants, and fungi, RPA is a heterotrimer with subunits of 70KDa (RPA1), 32kDa (RPA2), and 14 KDa (RPA3). In addition to DBD-C, RPA1 contains three other OB folds: DBD-A, DBD-B, and RPA1N. The major DNA binding activity of RPA is associated with RPA1 DBD-A and DBD-B. RPA1 DBD-C is involved in DNA binding and trimerization. It contains two structural insertions not found to date in other OB-folds: a zinc ribbon and a three-helix bundle. RPA1 DBD-C also contains a Cys4-type zinc-binding motif, which plays a role in the ssDNA binding fun
Probab=21.32  E-value=61  Score=16.80  Aligned_cols=10  Identities=30%  Similarity=0.730  Sum_probs=7.3

Q ss_pred             eecCCCCccc
Q psy12029         53 YFCPLCPYRA   62 (81)
Q Consensus        53 ~~c~~c~~~f   62 (81)
                      |.|..|+..+
T Consensus        52 ~~C~~C~~~~   61 (166)
T cd04476          52 YRCEKCNKSV   61 (166)
T ss_pred             EECCCCCCcC
Confidence            7888887654


No 275
>KOG0954|consensus
Probab=20.71  E-value=47  Score=22.36  Aligned_cols=31  Identities=16%  Similarity=0.285  Sum_probs=21.9

Q ss_pred             ccccccccchhccccccc----CCCceecCcchhh
Q psy12029          2 ELQLLVPFYFQITESSYF----ADRLFSCSGCARV   32 (81)
Q Consensus         2 ~~~f~~~~~l~~~~~~~~----~~~~~~C~~c~~~   32 (81)
                      |..|....+...|+..+.    .+.|+.|..|...
T Consensus       287 eMVfCd~Cn~cVHqaCyGIle~p~gpWlCr~Calg  321 (893)
T KOG0954|consen  287 EMVFCDKCNICVHQACYGILEVPEGPWLCRTCALG  321 (893)
T ss_pred             eeEEeccchhHHHHhhhceeecCCCCeeehhcccc
Confidence            467778888888887754    4577888777543


No 276
>PF03966 Trm112p:  Trm112p-like protein;  InterPro: IPR005651 This family of short proteins have no known function. The bacterial members are about 60-70 amino acids in length and the eukaryotic examples are about 120 amino acids in length. The C terminus contains the strongest conservation. The function of this family is uncertain. The bacterial members are about 60-70 amino acids in length and the eukaryotic examples are about 120 amino acids in length. The C terminus contains the strongest conservation. The entry contains 2 families:  Trm112, which is required for tRNA methylation in Saccharomyces cerevisiae (Baker's yeast) and is found in complexes with 2 tRNA methylases (TRM9 and TRM11) also with putative methyltransferase YDR140W []. The zinc-finger protein Ynr046w is plurifunctional and a component of the eRF1 methyltransferase in yeast []. The crystal structure of Ynr046w has been determined to 1.7 A resolution. It comprises a zinc-binding domain built from both the N- and C-terminal sequences and an inserted domain, absent from bacterial and archaeal orthologs of the protein, composed of three alpha-helices []. UPF0434, which are proteins that are functionally uncharacterised.  ; PDB: 3Q87_A 2KPI_A 2K5R_A 2HF1_A 2JS4_A 2J6A_A 2JR6_A 2PK7_A 2JNY_A.
Probab=20.59  E-value=53  Score=14.32  Aligned_cols=17  Identities=24%  Similarity=0.600  Sum_probs=10.1

Q ss_pred             ccCCCceecCcchhhcc
Q psy12029         18 YFADRLFSCSGCARVYK   34 (81)
Q Consensus        18 ~~~~~~~~C~~c~~~~~   34 (81)
                      +..+....|+.|+..|.
T Consensus        48 ~i~eg~L~Cp~c~r~YP   64 (68)
T PF03966_consen   48 EIVEGELICPECGREYP   64 (68)
T ss_dssp             ETTTTEEEETTTTEEEE
T ss_pred             cccCCEEEcCCCCCEEe
Confidence            34445566777776664


No 277
>PF10083 DUF2321:  Uncharacterized protein conserved in bacteria (DUF2321);  InterPro: IPR016891 This entry is represented by Bacteriophage 'Lactobacillus prophage Lj928', Orf-Ljo1454. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches. There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function.
Probab=20.46  E-value=47  Score=17.58  Aligned_cols=19  Identities=16%  Similarity=0.427  Sum_probs=14.4

Q ss_pred             CCceecCcchhhccCchHH
Q psy12029         21 DRLFSCSGCARVYKNKKSL   39 (81)
Q Consensus        21 ~~~~~C~~c~~~~~~~~~l   39 (81)
                      +.|.-|..||+.|.+....
T Consensus        66 ~~PsYC~~CGkpyPWt~~~   84 (158)
T PF10083_consen   66 EAPSYCHNCGKPYPWTENA   84 (158)
T ss_pred             CCChhHHhCCCCCchHHHH
Confidence            4677788899988886543


No 278
>KOG4118|consensus
Probab=20.31  E-value=61  Score=14.47  Aligned_cols=22  Identities=14%  Similarity=0.344  Sum_probs=11.3

Q ss_pred             eecCCCCcccCCchHHHHHHHh
Q psy12029         53 YFCPLCPYRAKQKTNLMTHMSI   74 (81)
Q Consensus        53 ~~c~~c~~~f~~~~~l~~h~~~   74 (81)
                      +.|.+|.........+..|...
T Consensus        39 ~kCtVC~~~mpdpktfkqhfe~   60 (74)
T KOG4118|consen   39 HKCTVCMVQMPDPKTFKQHFEN   60 (74)
T ss_pred             hhhHhhHhhCCCCchHHHHHhh
Confidence            5566665444554445555443


No 279
>PF05207 zf-CSL:  CSL zinc finger;  InterPro: IPR007872 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents a probable zinc binding motif that contains four cysteines and may chelate zinc, known as the DPH-type after the diphthamide (DPH) biosynthesis protein in which it was first characterised, including the proteins DPH3 and DPH4. This domain is also found associated with N-terminal domain of heat shock protein DnaJ IPR001623 from INTERPRO domain.  Diphthamide is a unique post-translationally modified histidine residue found only in translation elongation factor 2 (eEF-2). It is conserved from archaea to humans and serves as the target for diphteria toxin and Pseudomonas exotoxin A. These two toxins catalyse the transfer of ADP-ribose to diphtamide on eEF-2, thus inactivating eEF-2, halting cellular protein synthesis, and causing cell death []. The biosynthesis of diphtamide is dependent on at least five proteins, DPH1 to -5, and a still unidentified amidating enzyme. DPH3 and DPH4 share a conserved region, which encode a putative zinc finger, the DPH-type or CSL-type (after the conserved motif of the final cysteine) zinc finger [, ]. The function of this motif is unknown. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 2L6L_A 1WGE_A 2JR7_A 1YOP_A 1YWS_A.
Probab=20.01  E-value=39  Score=14.26  Aligned_cols=30  Identities=20%  Similarity=0.491  Sum_probs=17.0

Q ss_pred             ceecCcchhhccCchHHHHHHHhhcCCCCCeecCCCC
Q psy12029         23 LFSCSGCARVYKNKKSLARHQTYECGQEPQYFCPLCP   59 (81)
Q Consensus        23 ~~~C~~c~~~~~~~~~l~~h~~~~~~~~~~~~c~~c~   59 (81)
                      .+.| .||..|.....-.     ..+... ..|..|.
T Consensus        18 ~y~C-RCG~~f~i~e~~l-----~~~~~i-v~C~sCS   47 (55)
T PF05207_consen   18 SYPC-RCGGEFEISEEDL-----EEGEVI-VQCDSCS   47 (55)
T ss_dssp             EEEE-TTSSEEEEEHHHH-----HCT--E-EEETTTT
T ss_pred             EEcC-CCCCEEEEcchhc-----cCcCEE-EECCCCc
Confidence            4778 8998877665321     122344 6777664


Done!