Diaphorina citri psyllid: psy12029


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80-
MELQLLVPFYFQITESSYFADRLFSCSGCARVYKNKKSLARHQTYECGQEPQYFCPLCPYRAKQKTNLMTHMSIKHSHYQG
ccEEEcccccEEEEcccccccccEEccccccccccccHHHHHHHHcccccccccccccccccccccHHHHHHHHHcccccc
**LQLLVPFYFQITESSYFADRLFSCSGCARVYKNKKSLARHQTYECGQEPQYFCPLCPYRAKQKTNLMTH***K******
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MELQLLVPFYFQITESSYFADRLFSCSGCARVYKNKKSLARHQTYECGQEPQYFCPLCPYRAKQKTNLMTHMSIKHSHYQG

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Longitudinals lacking protein, isoforms A/B/D/L Putative transcription factor required for axon growth and guidance in the central and peripheral nervous systems. Repels CNS axons away from the midline by promoting the expression of the midline repellent sli and its receptor robo.confidentQ7KQZ4

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0044212 [MF]transcription regulatory region DNA bindingprobableGO:0097159, GO:0000975, GO:0001067, GO:0003674, GO:0005488, GO:0003676, GO:0003677, GO:1901363
GO:0010558 [BP]negative regulation of macromolecule biosynthetic processprobableGO:0009892, GO:0019222, GO:0009890, GO:0060255, GO:0009889, GO:0008150, GO:0010556, GO:0065007, GO:0048519, GO:0010605, GO:0050789
GO:0044763 [BP]single-organism cellular processprobableGO:0009987, GO:0008150, GO:0044699
GO:0005737 [CC]cytoplasmprobableGO:0044424, GO:0005575, GO:0044464, GO:0005623, GO:0005622
GO:0003700 [MF]sequence-specific DNA binding transcription factor activityprobableGO:0003674, GO:0001071
GO:0044237 [BP]cellular metabolic processprobableGO:0009987, GO:0008150, GO:0008152
GO:0006355 [BP]regulation of transcription, DNA-dependentprobableGO:0009889, GO:0080090, GO:0019222, GO:0060255, GO:0031326, GO:0031323, GO:0051252, GO:2000112, GO:0050794, GO:0050789, GO:0019219, GO:0010556, GO:0065007, GO:0051171, GO:2001141, GO:0008150, GO:0010468
GO:0005730 [CC]nucleolusprobableGO:0005575, GO:0043232, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0051253 [BP]negative regulation of RNA metabolic processprobableGO:0051252, GO:0010605, GO:0045934, GO:0019222, GO:0060255, GO:0031324, GO:0031323, GO:0050794, GO:0008150, GO:0019219, GO:0065007, GO:0051171, GO:0051172, GO:0048519, GO:0009892, GO:0050789, GO:0048523, GO:0080090
GO:0044238 [BP]primary metabolic processprobableGO:0008150, GO:0008152
GO:0031327 [BP]negative regulation of cellular biosynthetic processprobableGO:0009889, GO:0019222, GO:0009890, GO:0031326, GO:0031324, GO:0031323, GO:0050794, GO:0008150, GO:0065007, GO:0048519, GO:0009892, GO:0050789, GO:0048523
GO:0032991 [CC]macromolecular complexprobableGO:0005575

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1X5W, chain A
Confidence level:very confident
Coverage over the Query: 17-81
View the alignment between query and template
View the model in PyMOL