Query         psy12030
Match_columns 245
No_of_seqs    223 out of 1850
Neff          10.4
Searched_HMMs 46136
Date          Fri Aug 16 16:51:56 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy12030.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/12030hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG2462|consensus              100.0 4.7E-32   1E-36  204.5   5.9  124  120-244   129-254 (279)
  2 KOG2462|consensus              100.0   6E-29 1.3E-33  187.7   7.0  136   67-227   128-265 (279)
  3 KOG1074|consensus               99.9   1E-27 2.2E-32  203.8   2.4   79  122-201   606-693 (958)
  4 KOG3623|consensus               99.9 1.6E-26 3.5E-31  193.7   2.2  100   70-170   211-329 (1007)
  5 KOG3608|consensus               99.9 1.2E-25 2.5E-30  174.5   3.2  224    7-230   130-377 (467)
  6 KOG3608|consensus               99.9 1.9E-24 4.2E-29  167.8   2.5  170   70-245   178-364 (467)
  7 KOG1074|consensus               99.8 7.2E-22 1.6E-26  168.5   3.7   59  177-236   880-938 (958)
  8 KOG3576|consensus               99.7   2E-18 4.4E-23  124.8   2.4  110   67-201   115-237 (267)
  9 KOG3576|consensus               99.7 7.2E-18 1.6E-22  121.9   2.0  112  121-233   117-240 (267)
 10 KOG3623|consensus               99.6 4.2E-17 9.2E-22  137.8   1.5  105  122-227   211-331 (1007)
 11 PLN03086 PRLI-interacting fact  99.5 1.5E-13 3.3E-18  116.6   8.1  129   99-244   408-552 (567)
 12 PLN03086 PRLI-interacting fact  99.3   5E-12 1.1E-16  107.5   8.9  145   69-230   407-565 (567)
 13 PHA00733 hypothetical protein   99.3 6.8E-12 1.5E-16   87.6   4.7   80  148-230    38-124 (128)
 14 PHA00733 hypothetical protein   99.2 4.9E-11 1.1E-15   83.3   4.7   78  122-201    41-124 (128)
 15 PHA02768 hypothetical protein;  99.1 6.3E-11 1.4E-15   68.4   2.7   42  177-221     6-47  (55)
 16 PHA02768 hypothetical protein;  99.0 9.8E-11 2.1E-15   67.6   1.7   37  206-244     6-42  (55)
 17 KOG3993|consensus               98.9 2.2E-10 4.7E-15   92.1   0.1  160   69-230   267-483 (500)
 18 PF13465 zf-H2C2_2:  Zinc-finge  98.9 8.4E-10 1.8E-14   54.5   1.3   24  221-244     2-25  (26)
 19 PHA00616 hypothetical protein   98.9   1E-09 2.2E-14   60.2   1.6   34  205-238     1-34  (44)
 20 PF13465 zf-H2C2_2:  Zinc-finge  98.8 2.7E-09 5.8E-14   52.7   2.0   26  191-217     1-26  (26)
 21 KOG3993|consensus               98.8 4.5E-10 9.7E-15   90.4  -1.9  146   98-243   267-468 (500)
 22 PHA00732 hypothetical protein   98.6 4.1E-08 8.9E-13   62.3   2.7   44  177-226     2-45  (79)
 23 PHA00616 hypothetical protein   98.5 3.2E-08 6.9E-13   54.4   1.1   39  176-215     1-39  (44)
 24 PHA00732 hypothetical protein   98.5 9.8E-08 2.1E-12   60.5   3.4   38  205-244     1-38  (79)
 25 PF05605 zf-Di19:  Drought indu  98.5 3.2E-07 6.9E-12   54.1   4.4   51  177-230     3-54  (54)
 26 PF00096 zf-C2H2:  Zinc finger,  98.2 1.2E-06 2.5E-11   41.9   1.7   22  206-227     1-22  (23)
 27 PF13894 zf-C2H2_4:  C2H2-type   98.0 3.4E-06 7.5E-11   40.6   2.0   24  206-229     1-24  (24)
 28 PF00096 zf-C2H2:  Zinc finger,  98.0 3.6E-06 7.8E-11   40.2   2.0   23  177-199     1-23  (23)
 29 PF05605 zf-Di19:  Drought indu  98.0 7.4E-06 1.6E-10   48.2   3.4   37  122-159     3-40  (54)
 30 PF09237 GAGA:  GAGA factor;  I  98.0   4E-06 8.6E-11   47.1   1.7   41  193-233    12-52  (54)
 31 PF13912 zf-C2H2_6:  C2H2-type   97.9 5.2E-06 1.1E-10   41.3   1.7   26  205-230     1-26  (27)
 32 PF12756 zf-C2H2_2:  C2H2 type   97.8 1.1E-05 2.3E-10   54.1   2.4   71  124-199     2-73  (100)
 33 PF13894 zf-C2H2_4:  C2H2-type   97.8 1.9E-05 4.1E-10   37.9   2.4   24  177-200     1-24  (24)
 34 PF12756 zf-C2H2_2:  C2H2 type   97.8 1.7E-05 3.8E-10   53.1   2.5   69   71-144     1-73  (100)
 35 PF13912 zf-C2H2_6:  C2H2-type   97.6 3.6E-05 7.9E-10   38.2   1.5   26   69-94      1-26  (27)
 36 COG5189 SFP1 Putative transcri  97.6 3.1E-05 6.7E-10   60.8   1.6   43  203-245   347-410 (423)
 37 KOG2231|consensus               97.4 0.00032   7E-09   61.4   6.0  121  100-228   117-262 (669)
 38 PF13909 zf-H2C2_5:  C2H2-type   97.4 8.9E-05 1.9E-09   35.6   1.5   23  206-229     1-23  (24)
 39 smart00355 ZnF_C2H2 zinc finge  97.4 0.00022 4.7E-09   34.7   2.5   23  206-228     1-23  (26)
 40 PRK04860 hypothetical protein;  97.3 0.00014   3E-09   52.8   1.8   35  177-216   120-154 (160)
 41 COG5189 SFP1 Putative transcri  97.2 8.9E-05 1.9E-09   58.3   0.5   25  202-226   395-419 (423)
 42 PF12874 zf-met:  Zinc-finger o  97.1 0.00029 6.3E-09   34.1   1.5   23  206-228     1-23  (25)
 43 smart00355 ZnF_C2H2 zinc finge  97.0 0.00052 1.1E-08   33.2   2.0   24  177-200     1-24  (26)
 44 PF13909 zf-H2C2_5:  C2H2-type   97.0 0.00089 1.9E-08   32.0   2.5   24  177-201     1-24  (24)
 45 PF12171 zf-C2H2_jaz:  Zinc-fin  96.7 0.00079 1.7E-08   33.3   1.3   22  206-227     2-23  (27)
 46 KOG2231|consensus               96.7  0.0028 6.1E-08   55.7   5.2  115   99-229   100-236 (669)
 47 PF09237 GAGA:  GAGA factor;  I  96.7  0.0018 3.9E-08   36.5   2.5   29  176-205    24-52  (54)
 48 PF12874 zf-met:  Zinc-finger o  96.7  0.0012 2.7E-08   31.8   1.6   23  177-199     1-23  (25)
 49 PRK04860 hypothetical protein;  96.6  0.0018 3.9E-08   47.1   2.8   37  204-244   118-154 (160)
 50 PF12171 zf-C2H2_jaz:  Zinc-fin  96.5  0.0019 4.1E-08   31.9   1.8   22   70-91      2-23  (27)
 51 COG5236 Uncharacterized conser  96.3  0.0059 1.3E-07   48.9   4.0  122   70-201   152-306 (493)
 52 PF13913 zf-C2HC_2:  zinc-finge  95.5   0.013 2.8E-07   28.3   2.0   20  206-226     3-22  (25)
 53 smart00451 ZnF_U1 U1-like zinc  95.5   0.012 2.7E-07   30.8   2.0   23  205-227     3-25  (35)
 54 KOG1146|consensus               95.4  0.0057 1.2E-07   57.3   1.0  103  127-229   442-613 (1406)
 55 TIGR00622 ssl1 transcription f  95.4   0.046   1E-06   36.9   4.8   21  177-197    82-102 (112)
 56 PF13913 zf-C2HC_2:  zinc-finge  94.7   0.028 6.1E-07   27.1   1.9   19  178-197     4-22  (25)
 57 smart00451 ZnF_U1 U1-like zinc  94.5    0.04 8.6E-07   28.8   2.3   24  175-198     2-25  (35)
 58 cd00350 rubredoxin_like Rubred  94.3   0.026 5.7E-07   29.2   1.3   11  177-187     2-12  (33)
 59 KOG2482|consensus               94.1   0.065 1.4E-06   43.1   3.7   24   69-92    195-218 (423)
 60 COG5236 Uncharacterized conser  93.9    0.06 1.3E-06   43.4   3.1   74  152-230   222-306 (493)
 61 COG5048 FOG: Zn-finger [Genera  93.8   0.019 4.1E-07   48.8   0.2  119  121-241   289-454 (467)
 62 PF12013 DUF3505:  Protein of u  93.7    0.18   4E-06   34.2   4.9   25  206-230    81-109 (109)
 63 KOG1146|consensus               93.2  0.0068 1.5E-07   56.8  -3.6   29  203-232  1327-1355(1406)
 64 KOG2785|consensus               93.0    0.26 5.7E-06   40.4   5.4   52  177-228   167-243 (390)
 65 COG4049 Uncharacterized protei  92.8   0.044 9.5E-07   31.5   0.6   27  203-229    15-41  (65)
 66 PF10571 UPF0547:  Uncharacteri  92.7     0.1 2.2E-06   25.4   1.8   12  234-245    15-26  (26)
 67 COG5048 FOG: Zn-finger [Genera  92.7   0.029 6.2E-07   47.7  -0.3   62  176-238   289-356 (467)
 68 TIGR00622 ssl1 transcription f  92.6    0.17 3.7E-06   34.2   3.3   79  148-229    13-105 (112)
 69 KOG2893|consensus               92.4   0.037   8E-07   42.2  -0.1   41  100-140    12-53  (341)
 70 cd00729 rubredoxin_SM Rubredox  91.0    0.14 2.9E-06   26.7   1.2   10  204-213    17-26  (34)
 71 COG2888 Predicted Zn-ribbon RN  91.0    0.19 4.2E-06   29.4   1.9    8  205-212    50-57  (61)
 72 COG2888 Predicted Zn-ribbon RN  90.9    0.24 5.1E-06   29.1   2.2    9   99-107    28-36  (61)
 73 TIGR02098 MJ0042_CXXC MJ0042 f  90.7    0.16 3.5E-06   27.1   1.4   12   71-82      4-15  (38)
 74 COG4049 Uncharacterized protei  90.7   0.079 1.7E-06   30.5   0.2   31   64-94     12-42  (65)
 75 KOG2893|consensus               90.6   0.062 1.3E-06   41.0  -0.5   47  179-230    13-59  (341)
 76 KOG4173|consensus               90.5   0.096 2.1E-06   39.1   0.5   46  121-170    79-126 (253)
 77 PF13717 zinc_ribbon_4:  zinc-r  90.3     0.2 4.4E-06   26.5   1.5    8  122-129    26-33  (36)
 78 PHA00626 hypothetical protein   90.1    0.21 4.6E-06   28.8   1.6   14  175-188    22-35  (59)
 79 PF13719 zinc_ribbon_5:  zinc-r  90.1    0.23 4.9E-06   26.5   1.6    9  122-130    26-34  (37)
 80 COG1592 Rubrerythrin [Energy p  89.2    0.32 6.9E-06   35.5   2.3   22  177-212   135-156 (166)
 81 smart00659 RPOLCX RNA polymera  89.1    0.22 4.7E-06   27.7   1.1   26  177-214     3-28  (44)
 82 smart00531 TFIIE Transcription  88.4    0.34 7.4E-06   34.9   2.0   35   97-131    98-133 (147)
 83 KOG2482|consensus               88.1    0.68 1.5E-05   37.5   3.6   24  206-229   280-303 (423)
 84 PRK14890 putative Zn-ribbon RN  87.9    0.41 8.9E-06   28.2   1.7    8  205-212    48-55  (59)
 85 KOG2186|consensus               87.7    0.28   6E-06   37.9   1.2   47  122-172     4-50  (276)
 86 smart00834 CxxC_CXXC_SSSS Puta  87.3    0.16 3.4E-06   27.6  -0.2   11  177-187     6-16  (41)
 87 COG1997 RPL43A Ribosomal prote  87.2    0.51 1.1E-05   30.1   2.0   33  149-189    34-66  (89)
 88 TIGR02605 CxxC_CxxC_SSSS putat  86.9    0.18 3.8E-06   29.1  -0.2   29  177-213     6-34  (52)
 89 PRK14890 putative Zn-ribbon RN  86.2     0.6 1.3E-05   27.5   1.8   10   98-107    25-34  (59)
 90 PF09986 DUF2225:  Uncharacteri  86.2    0.23   5E-06   38.2   0.1   13  177-189    49-61  (214)
 91 KOG2186|consensus               85.9    0.48   1E-05   36.7   1.6   45  151-197     4-49  (276)
 92 PF09538 FYDLN_acid:  Protein o  85.9    0.68 1.5E-05   31.3   2.2   15  149-163    25-39  (108)
 93 COG5151 SSL1 RNA polymerase II  85.6    0.73 1.6E-05   36.8   2.5   79  121-199   322-411 (421)
 94 KOG4173|consensus               85.3     0.3 6.5E-06   36.5   0.3   75   69-170    79-166 (253)
 95 PF02892 zf-BED:  BED zinc fing  85.2    0.79 1.7E-05   25.3   2.0   26  203-228    14-43  (45)
 96 PF03604 DNA_RNApol_7kD:  DNA d  84.4     0.7 1.5E-05   23.7   1.3   10  205-214    17-26  (32)
 97 TIGR00373 conserved hypothetic  84.2     1.2 2.7E-05   32.4   3.1   16  177-192   110-125 (158)
 98 PRK06266 transcription initiat  84.2     0.6 1.3E-05   34.8   1.5   28  177-214   118-145 (178)
 99 COG1592 Rubrerythrin [Energy p  83.6    0.83 1.8E-05   33.4   1.9   23  205-240   134-156 (166)
100 KOG2807|consensus               83.0     2.1 4.6E-05   34.6   4.1   23  177-199   346-368 (378)
101 COG1198 PriA Primosomal protei  82.7       1 2.3E-05   41.0   2.7   24  203-241   460-483 (730)
102 PF09538 FYDLN_acid:  Protein o  82.1       1 2.3E-05   30.4   1.9   30  177-218    10-39  (108)
103 PF06524 NOA36:  NOA36 protein;  82.0    0.91   2E-05   35.4   1.7   26  148-173   207-232 (314)
104 smart00614 ZnF_BED BED zinc fi  81.6     1.3 2.9E-05   25.2   1.9   21  206-226    19-44  (50)
105 PRK09678 DNA-binding transcrip  81.6    0.39 8.5E-06   29.8  -0.3   41  177-220     2-44  (72)
106 smart00531 TFIIE Transcription  81.5    0.94   2E-05   32.6   1.6   34  177-215   100-133 (147)
107 PRK04023 DNA polymerase II lar  80.0     2.5 5.3E-05   39.7   4.0    9  151-159   627-635 (1121)
108 PF09986 DUF2225:  Uncharacteri  78.9     2.6 5.6E-05   32.5   3.4   57   13-82      5-61  (214)
109 COG1996 RPC10 DNA-directed RNA  78.9    0.98 2.1E-05   25.6   0.8   27  177-214     7-33  (49)
110 smart00734 ZnF_Rad18 Rad18-lik  78.6     2.1 4.5E-05   20.7   1.8   20  206-226     2-21  (26)
111 PF09723 Zn-ribbon_8:  Zinc rib  78.1    0.54 1.2E-05   25.8  -0.4   12   70-81      6-17  (42)
112 TIGR00373 conserved hypothetic  78.0     1.3 2.9E-05   32.3   1.4   32   96-131   107-138 (158)
113 PF13240 zinc_ribbon_2:  zinc-r  77.1       1 2.2E-05   21.1   0.4    6  236-241    16-21  (23)
114 PRK00464 nrdR transcriptional   76.2    0.82 1.8E-05   33.1  -0.0   13  122-134    29-41  (154)
115 PRK06266 transcription initiat  75.8     1.6 3.5E-05   32.5   1.4   31   97-131   116-146 (178)
116 PRK00398 rpoP DNA-directed RNA  75.8    0.91   2E-05   25.4   0.1   10   70-79      4-13  (46)
117 TIGR02300 FYDLN_acid conserved  75.1     2.4 5.2E-05   29.3   1.9   13  149-161    25-37  (129)
118 PF04959 ARS2:  Arsenite-resist  74.6     1.2 2.7E-05   34.1   0.5   24  177-200    78-101 (214)
119 PF06524 NOA36:  NOA36 protein;  74.2     1.6 3.4E-05   34.1   1.0   26  203-228   207-232 (314)
120 cd00730 rubredoxin Rubredoxin;  73.5     1.6 3.6E-05   24.9   0.7    7  177-183    35-41  (50)
121 PF12013 DUF3505:  Protein of u  71.9     3.5 7.6E-05   27.9   2.2   25  177-201    81-109 (109)
122 PF15269 zf-C2H2_7:  Zinc-finge  70.4     4.8  0.0001   22.2   2.0   21  206-226    21-41  (54)
123 smart00440 ZnF_C2C2 C2C2 Zinc   70.3    0.34 7.3E-06   26.3  -2.5   11  234-244    29-39  (40)
124 PF13878 zf-C2H2_3:  zinc-finge  69.6     5.1 0.00011   21.8   2.1   23  206-228    14-38  (41)
125 TIGR00280 L37a ribosomal prote  69.0     2.7 5.9E-05   27.3   1.1   33  149-189    34-66  (91)
126 PF00301 Rubredoxin:  Rubredoxi  68.3     3.4 7.4E-05   23.3   1.3   13   70-82      2-14  (47)
127 COG1773 Rubredoxin [Energy pro  68.2       2 4.4E-05   25.0   0.4   11  151-161     4-14  (55)
128 PF05443 ROS_MUCR:  ROS/MUCR tr  68.1     2.9 6.2E-05   29.4   1.1   22  206-230    73-94  (132)
129 PTZ00255 60S ribosomal protein  68.1     3.5 7.5E-05   26.8   1.4   34  148-189    34-67  (90)
130 PF09845 DUF2072:  Zn-ribbon co  68.0     3.9 8.5E-05   28.5   1.8   13  122-134     2-14  (131)
131 COG3357 Predicted transcriptio  67.6       4 8.6E-05   26.4   1.6   13  205-217    58-70  (97)
132 PF08274 PhnA_Zn_Ribbon:  PhnA   67.2     1.6 3.4E-05   22.0  -0.2    9  204-212    18-26  (30)
133 PF07754 DUF1610:  Domain of un  67.2     2.3   5E-05   20.1   0.4    8  205-212    16-23  (24)
134 PF01780 Ribosomal_L37ae:  Ribo  67.2     1.7 3.7E-05   28.2  -0.1   32  149-188    34-65  (90)
135 PF12907 zf-met2:  Zinc-binding  66.8     3.1 6.8E-05   22.5   0.9   27  206-232     2-31  (40)
136 cd00924 Cyt_c_Oxidase_Vb Cytoc  66.6     2.9 6.2E-05   27.7   0.9   12  204-215    78-89  (97)
137 PF14353 CpXC:  CpXC protein     64.3     1.5 3.3E-05   30.6  -0.8   24  149-172    37-60  (128)
138 PF01096 TFIIS_C:  Transcriptio  63.3    0.11 2.3E-06   28.1  -5.3   11  234-244    29-39  (39)
139 COG3091 SprT Zn-dependent meta  63.1     2.9 6.2E-05   29.9   0.4   32  176-213   117-148 (156)
140 PRK14714 DNA polymerase II lar  63.0      11 0.00024   36.6   4.2    8  151-158   668-675 (1337)
141 PRK03824 hypA hydrogenase nick  62.9       3 6.5E-05   29.5   0.5   13  177-189    71-83  (135)
142 PRK03976 rpl37ae 50S ribosomal  62.5     4.2 9.1E-05   26.4   1.0   32  149-188    35-66  (90)
143 KOG4167|consensus               62.4     1.6 3.5E-05   39.2  -1.2   27   68-94    791-817 (907)
144 KOG2593|consensus               60.7     6.6 0.00014   33.2   2.1   36   96-131   126-163 (436)
145 COG1571 Predicted DNA-binding   59.7     6.1 0.00013   33.5   1.8   12  205-216   367-378 (421)
146 KOG2785|consensus               59.4     8.6 0.00019   31.9   2.5   70   69-143   166-242 (390)
147 PRK00432 30S ribosomal protein  58.9       9 0.00019   21.9   1.9   11  175-185    36-46  (50)
148 KOG2907|consensus               58.5     4.1 8.9E-05   27.5   0.5   11  206-216   103-113 (116)
149 PRK04023 DNA polymerase II lar  58.5      11 0.00024   35.7   3.3    9  177-185   664-672 (1121)
150 PRK12380 hydrogenase nickel in  58.1     4.9 0.00011   27.5   0.8   11  177-187    71-81  (113)
151 COG3364 Zn-ribbon containing p  58.1     7.6 0.00016   25.7   1.6   12  151-162     3-14  (112)
152 TIGR00595 priA primosomal prot  57.3     6.9 0.00015   34.4   1.8   10  152-161   215-224 (505)
153 PLN02294 cytochrome c oxidase   57.0     5.7 0.00012   29.1   1.0   13  203-215   139-151 (174)
154 COG1594 RPB9 DNA-directed RNA   55.5     8.2 0.00018   26.4   1.6   10   69-78     72-81  (113)
155 COG4888 Uncharacterized Zn rib  55.1     1.8 3.9E-05   28.5  -1.6   35  177-216    23-57  (104)
156 COG3677 Transposase and inacti  55.0      10 0.00022   26.6   2.0   13  205-217    53-65  (129)
157 PF13451 zf-trcl:  Probable zin  55.0     6.7 0.00015   22.3   0.9   15  204-218     3-17  (49)
158 PF05290 Baculo_IE-1:  Baculovi  53.6     5.4 0.00012   27.9   0.5   24  135-164   112-135 (140)
159 TIGR00100 hypA hydrogenase nic  53.3     5.8 0.00013   27.2   0.6   11  177-187    71-81  (115)
160 PF08271 TF_Zn_Ribbon:  TFIIB z  53.2     3.7   8E-05   22.5  -0.3    9  122-130    20-28  (43)
161 PF13824 zf-Mss51:  Zinc-finger  53.1      14 0.00031   21.6   2.0   16  203-218    12-27  (55)
162 PRK14873 primosome assembly pr  53.1     9.3  0.0002   34.9   2.0   49   98-185   383-431 (665)
163 PF14446 Prok-RING_1:  Prokaryo  53.0     6.4 0.00014   22.9   0.6    8  206-213    22-29  (54)
164 KOG3214|consensus               52.9     2.8   6E-05   27.5  -1.0   12  206-217    48-59  (109)
165 KOG4167|consensus               52.7     2.8   6E-05   37.8  -1.3   24  206-229   793-816 (907)
166 PF12760 Zn_Tnp_IS1595:  Transp  52.5      10 0.00022   21.1   1.4    8  151-158    19-26  (46)
167 PF07295 DUF1451:  Protein of u  51.8     5.4 0.00012   28.6   0.2   27  205-241   112-138 (146)
168 PF04959 ARS2:  Arsenite-resist  50.5      13 0.00029   28.5   2.2   25  148-172    75-99  (214)
169 COG1998 RPS31 Ribosomal protei  49.8      14  0.0003   21.0   1.6   10  176-185    37-46  (51)
170 TIGR00595 priA primosomal prot  49.7      10 0.00022   33.4   1.6   39   98-161   213-251 (505)
171 PRK05978 hypothetical protein;  49.7     6.1 0.00013   28.4   0.3   10  207-216    54-63  (148)
172 PF02176 zf-TRAF:  TRAF-type zi  48.9     9.4  0.0002   22.3   1.0   39  177-216    10-53  (60)
173 COG1198 PriA Primosomal protei  48.7     6.2 0.00013   36.2   0.2   19   98-130   435-453 (730)
174 PRK00564 hypA hydrogenase nick  48.3      11 0.00024   25.9   1.3   10  177-186    72-81  (117)
175 COG4530 Uncharacterized protei  47.7      11 0.00025   25.2   1.3   14  148-161    24-37  (129)
176 PF07649 C1_3:  C1-like domain;  47.0     8.9 0.00019   19.0   0.6    7  177-183    16-22  (30)
177 cd00065 FYVE FYVE domain; Zinc  46.6      17 0.00036   21.0   1.8   28  178-218     4-31  (57)
178 smart00154 ZnF_AN1 AN1-like Zi  46.3      10 0.00022   20.3   0.8   14  205-218    12-25  (39)
179 PF03811 Zn_Tnp_IS1:  InsA N-te  45.6     4.4 9.4E-05   21.4  -0.8   30  206-239     6-35  (36)
180 COG2331 Uncharacterized protei  45.5      13 0.00029   23.1   1.2   30  177-214    13-42  (82)
181 COG4957 Predicted transcriptio  45.3      15 0.00032   25.8   1.5   22  206-230    77-98  (148)
182 COG1675 TFA1 Transcription ini  45.1      34 0.00073   25.5   3.5   11  177-187   114-124 (176)
183 PRK03681 hypA hydrogenase nick  44.7      12 0.00026   25.6   1.1    9  177-185    71-79  (114)
184 PF01363 FYVE:  FYVE zinc finge  44.5      13 0.00029   22.5   1.2   11   70-80     10-20  (69)
185 PF08792 A2L_zn_ribbon:  A2L zi  44.4     9.5 0.00021   19.6   0.4   11  233-243    21-31  (33)
186 KOG2593|consensus               44.0      19 0.00042   30.5   2.3   33  205-240   128-160 (436)
187 PHA02998 RNA polymerase subuni  44.0     3.3 7.1E-05   30.4  -1.8   11  206-216   172-182 (195)
188 smart00661 RPOL9 RNA polymeras  43.1      10 0.00022   21.4   0.5   13  205-217    20-32  (52)
189 smart00064 FYVE Protein presen  43.0      16 0.00035   22.1   1.4   28  177-217    11-38  (68)
190 PF03107 C1_2:  C1 domain;  Int  42.9      18 0.00038   18.0   1.3    7  177-183    16-22  (30)
191 KOG1280|consensus               42.9      22 0.00047   29.3   2.4   36  177-213    80-117 (381)
192 PF14311 DUF4379:  Domain of un  42.7      20 0.00044   20.7   1.7   15  177-191    29-43  (55)
193 PF07282 OrfB_Zn_ribbon:  Putat  42.4      15 0.00033   22.3   1.2   28  178-216    30-57  (69)
194 PF05191 ADK_lid:  Adenylate ki  41.5      20 0.00044   18.8   1.4   11   70-80      2-12  (36)
195 KOG3408|consensus               41.2      13 0.00028   25.5   0.8   23  205-227    57-79  (129)
196 COG0068 HypF Hydrogenase matur  40.3      18 0.00038   33.0   1.7   40   16-55    126-165 (750)
197 KOG4377|consensus               39.6      23 0.00049   29.9   2.1  101  122-229   272-427 (480)
198 KOG3352|consensus               39.5      15 0.00033   26.3   1.0   12  204-215   132-143 (153)
199 KOG4124|consensus               39.3     9.4  0.0002   31.3  -0.1   42  203-244   347-409 (442)
200 COG1655 Uncharacterized protei  38.8     8.4 0.00018   29.7  -0.4    9  177-185    63-71  (267)
201 PF03833 PolC_DP2:  DNA polymer  37.9      11 0.00023   35.0   0.0   12  203-214   678-689 (900)
202 PRK05580 primosome assembly pr  37.8      20 0.00044   32.9   1.7   20   98-131   381-400 (679)
203 TIGR01206 lysW lysine biosynth  37.0      16 0.00034   21.3   0.6   10   70-79      3-12  (54)
204 PF10013 DUF2256:  Uncharacteri  36.6      30 0.00066   18.9   1.6   12  178-189    10-21  (42)
205 PF01215 COX5B:  Cytochrome c o  36.6     6.3 0.00014   27.8  -1.3   13  203-215   110-122 (136)
206 PF06220 zf-U1:  U1 zinc finger  36.5      33 0.00071   18.2   1.7   21  205-225     3-25  (38)
207 PF01155 HypA:  Hydrogenase exp  36.3      11 0.00025   25.6  -0.1   12  177-188    71-82  (113)
208 PF13453 zf-TFIIB:  Transcripti  36.2      18  0.0004   19.4   0.8   14   99-112    20-33  (41)
209 KOG0978|consensus               35.7      22 0.00048   32.4   1.6   20  205-224   678-697 (698)
210 KOG0782|consensus               35.5     4.1 8.8E-05   35.7  -2.8   51   84-135   240-290 (1004)
211 PF01927 Mut7-C:  Mut7-C RNAse   35.3      41 0.00089   24.1   2.7   17  177-193   125-141 (147)
212 TIGR01384 TFS_arch transcripti  35.0     4.3 9.4E-05   27.1  -2.3   11  234-244    91-101 (104)
213 PF08790 zf-LYAR:  LYAR-type C2  34.6     7.8 0.00017   19.1  -0.8    9  178-186     2-10  (28)
214 PF07975 C1_4:  TFIIH C1-like d  34.5      23 0.00049   20.4   1.0   22  151-172    22-43  (51)
215 PF04216 FdhE:  Protein involve  34.2     4.4 9.5E-05   32.8  -2.8    8  177-184   239-246 (290)
216 PF04780 DUF629:  Protein of un  34.1      29 0.00063   30.1   2.0   26  205-230    57-82  (466)
217 KOG3408|consensus               33.9      21 0.00045   24.6   0.8   27   66-92     54-80  (129)
218 PF14445 Prok-RING_2:  Prokaryo  33.8      14 0.00029   21.0  -0.0   10  206-215     8-17  (57)
219 COG1779 C4-type Zn-finger prot  33.8      16 0.00035   27.5   0.4   12  177-188    44-55  (201)
220 KOG0717|consensus               33.5      24 0.00052   30.4   1.3   22  206-227   293-314 (508)
221 COG1656 Uncharacterized conser  33.1      53  0.0011   24.1   2.9   16  177-192   131-146 (165)
222 KOG1280|consensus               32.9      38 0.00083   27.9   2.3   37  148-184    77-117 (381)
223 PF01428 zf-AN1:  AN1-like Zinc  32.7      13 0.00027   20.4  -0.3   15  204-218    12-26  (43)
224 KOG0782|consensus               32.1     4.7  0.0001   35.3  -3.0   54   53-112   237-290 (1004)
225 KOG2636|consensus               31.7      31 0.00068   29.5   1.7   29  197-226   394-423 (497)
226 KOG1842|consensus               31.6      20 0.00043   30.6   0.6   29   68-96     14-42  (505)
227 PF14205 Cys_rich_KTR:  Cystein  31.5      17 0.00037   21.1   0.1    8  233-240    28-35  (55)
228 PF05129 Elf1:  Transcription e  31.3     5.1 0.00011   25.5  -2.2   10   67-76     20-29  (81)
229 KOG2272|consensus               31.3      48   0.001   26.1   2.5   19   70-88    100-118 (332)
230 PTZ00448 hypothetical protein;  31.2      36 0.00078   28.4   2.0   24  205-228   314-337 (373)
231 KOG3507|consensus               31.1      17 0.00037   21.4   0.1   31  176-218    20-50  (62)
232 PTZ00043 cytochrome c oxidase   30.1      29 0.00063   26.7   1.2   13  203-215   179-191 (268)
233 PRK00420 hypothetical protein;  29.9      51  0.0011   22.5   2.2   11  176-186    40-50  (112)
234 KOG0402|consensus               29.2      22 0.00048   22.6   0.4   31  150-188    36-66  (92)
235 COG4896 Uncharacterized protei  29.1      26 0.00057   20.8   0.7    7   71-77      4-10  (68)
236 KOG2071|consensus               29.1      39 0.00084   30.1   1.9   27  203-229   416-442 (579)
237 CHL00174 accD acetyl-CoA carbo  29.0      43 0.00093   27.2   2.0   33  177-219    39-71  (296)
238 COG0068 HypF Hydrogenase matur  28.8      13 0.00029   33.7  -0.9   78   69-160   101-183 (750)
239 PF10263 SprT-like:  SprT-like   28.7      24 0.00053   25.3   0.6   10  177-186   124-133 (157)
240 COG2879 Uncharacterized small   28.6      72  0.0016   19.2   2.4   18  216-233    23-40  (65)
241 smart00731 SprT SprT homologue  27.4      41 0.00089   24.0   1.6   11  177-187   113-123 (146)
242 PF15135 UPF0515:  Uncharacteri  27.1      39 0.00084   26.5   1.4   14   66-79    109-122 (278)
243 KOG3362|consensus               26.9      21 0.00046   25.3  -0.0   21  177-197   130-150 (156)
244 PF10276 zf-CHCC:  Zinc-finger   26.2      22 0.00049   19.2   0.0   11  205-215    29-39  (40)
245 COG1326 Uncharacterized archae  26.0      62  0.0013   24.4   2.2   13  203-215    28-40  (201)
246 KOG4118|consensus               25.7      40 0.00087   20.3   1.0   30  206-235    39-68  (74)
247 KOG0227|consensus               25.7      39 0.00086   25.3   1.2   27  170-196    47-73  (222)
248 COG4306 Uncharacterized protei  25.5      42 0.00092   23.2   1.2   44   70-113    40-83  (160)
249 PF04423 Rad50_zn_hook:  Rad50   25.4      28 0.00061   20.0   0.3   13   71-83     22-34  (54)
250 KOG0717|consensus               25.3      44 0.00095   28.9   1.5   22  177-198   293-314 (508)
251 KOG1701|consensus               24.9     6.1 0.00013   33.3  -3.4   37  151-187   395-438 (468)
252 PRK12496 hypothetical protein;  24.8      56  0.0012   24.0   1.9   26  177-215   128-153 (164)
253 PF05495 zf-CHY:  CHY zinc fing  24.8      22 0.00048   21.9  -0.2   11   98-108    41-51  (71)
254 TIGR00310 ZPR1_znf ZPR1 zinc f  24.8      24 0.00053   26.6   0.0    9  177-185    31-39  (192)
255 PRK14892 putative transcriptio  24.5      21 0.00045   23.8  -0.4   33  177-217    22-54  (99)
256 PRK11032 hypothetical protein;  24.4      32 0.00069   25.2   0.5   13  228-240   137-149 (160)
257 PF06397 Desulfoferrod_N:  Desu  24.1      32 0.00069   18.1   0.4   10  205-214     6-15  (36)
258 PF14787 zf-CCHC_5:  GAG-polypr  23.9      44 0.00095   17.6   0.8   10  234-243     3-12  (36)
259 COG5216 Uncharacterized conser  23.7      44 0.00094   19.7   0.9   10   70-80     23-32  (67)
260 PF11781 RRN7:  RNA polymerase   23.6      62  0.0013   16.9   1.4    9  151-159     9-17  (36)
261 PF11789 zf-Nse:  Zinc-finger o  23.4      31 0.00067   20.2   0.3   12  176-187    24-35  (57)
262 PF04780 DUF629:  Protein of un  23.3      69  0.0015   27.9   2.4   25  177-201    58-82  (466)
263 KOG1842|consensus               23.0      46   0.001   28.5   1.3   20  151-170    16-35  (505)
264 KOG1994|consensus               22.5      48   0.001   25.6   1.1   23   67-89    237-259 (268)
265 PF09963 DUF2197:  Uncharacteri  22.4      26 0.00057   20.5  -0.2    9   71-79      4-12  (56)
266 PF03145 Sina:  Seven in absent  22.1      59  0.0013   24.5   1.6   46  182-231    24-73  (198)
267 PRK00762 hypA hydrogenase nick  22.1      43 0.00093   23.3   0.8   15   67-82     68-82  (124)
268 KOG2636|consensus               21.7      61  0.0013   27.8   1.7   22  148-169   399-421 (497)
269 PF12773 DZR:  Double zinc ribb  21.5      65  0.0014   17.9   1.4   25  178-214    14-38  (50)
270 KOG2923|consensus               21.5      71  0.0015   19.2   1.5   10   70-80     23-32  (67)
271 PRK04351 hypothetical protein;  21.1      48   0.001   23.9   0.9   32  121-161   112-143 (149)
272 PF01286 XPA_N:  XPA protein N-  21.1      35 0.00075   17.7   0.1   14  206-219     4-17  (34)
273 COG4391 Uncharacterized protei  21.1      50  0.0011   19.7   0.8   43   61-108    16-58  (62)
274 PF11672 DUF3268:  Protein of u  21.0      38 0.00083   22.7   0.3    7  206-212    32-38  (102)
275 COG0846 SIR2 NAD-dependent pro  20.2      70  0.0015   25.3   1.7   12  177-188   123-134 (250)
276 TIGR03830 CxxCG_CxxCG_HTH puta  20.1      73  0.0016   21.8   1.6   16  177-192    32-47  (127)

No 1  
>KOG2462|consensus
Probab=99.97  E-value=4.7e-32  Score=204.48  Aligned_cols=124  Identities=25%  Similarity=0.463  Sum_probs=117.6

Q ss_pred             CccccCcCCCccCchhHHHhHHhhhcC--CCCCccCCCCCCcCCChHHHHhhhcCCCCceeCCCCCCccCChhHHHHHHh
Q psy12030        120 GMFACDVCGKEYKYKRGLYRHKKFECG--QEPKYQCPHCPHRAKHKANLKTHIAPQLGVFACNVCGKGYRYKTGLYRHKR  197 (245)
Q Consensus       120 ~~~~C~~C~~~f~~~~~l~~H~~~h~~--~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~C~~C~~~f~~~~~l~~H~~  197 (245)
                      ..|+|..||+.+.+..+|.+|+++|..  ..+.+.|++|++.|.+-..|+.|+++|+-+.+|.+||+.|....-|+.|+|
T Consensus       129 ~r~~c~eCgk~ysT~snLsrHkQ~H~~~~s~ka~~C~~C~K~YvSmpALkMHirTH~l~c~C~iCGKaFSRPWLLQGHiR  208 (279)
T KOG2462|consen  129 PRYKCPECGKSYSTSSNLSRHKQTHRSLDSKKAFSCKYCGKVYVSMPALKMHIRTHTLPCECGICGKAFSRPWLLQGHIR  208 (279)
T ss_pred             CceeccccccccccccccchhhcccccccccccccCCCCCceeeehHHHhhHhhccCCCcccccccccccchHHhhcccc
Confidence            469999999999999999999999854  267899999999999999999999999999999999999999999999999


Q ss_pred             HHhCCCCCcccCCCcccCCChHHHHHhHhhhCCCCCCCCCCCCcccc
Q psy12030        198 EECGQEPKYQCPHCPHKAKHKANLKTHIAIKHSDRILPPQEGRVWTR  244 (245)
Q Consensus       198 ~h~~~~~~~~C~~C~~~f~~~~~l~~H~~~~~~~~~~~C~~C~~~f~  244 (245)
                      +|+| ||||.|+.|++.|+++++|+.||++|.+.|+|.|..|+|.|-
T Consensus       209 THTG-EKPF~C~hC~kAFADRSNLRAHmQTHS~~K~~qC~~C~KsFs  254 (279)
T KOG2462|consen  209 THTG-EKPFSCPHCGKAFADRSNLRAHMQTHSDVKKHQCPRCGKSFA  254 (279)
T ss_pred             cccC-CCCccCCcccchhcchHHHHHHHHhhcCCccccCcchhhHHH
Confidence            9999 999999999999999999999999999999999999999983


No 2  
>KOG2462|consensus
Probab=99.95  E-value=6e-29  Score=187.70  Aligned_cols=136  Identities=29%  Similarity=0.544  Sum_probs=120.9

Q ss_pred             CCceecccccccccChhHHhcchhcccCCCCCccCCCCcccccChHHHHHhcCCccccCcCCCccCchhHHHhHHhhhcC
Q psy12030         67 SKGFECQVCGKRYKYKRGLHRHKQDECGQEPKYQCPQCKDSFFSWSAFHKNLSGMFACDVCGKEYKYKRGLYRHKKFECG  146 (245)
Q Consensus        67 ~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~~C~~C~~~f~~~~~l~~h~~~~~~C~~C~~~f~~~~~l~~H~~~h~~  146 (245)
                      ...|.|..||+.+.+.+.|.+|.++|...+.                     .+.+.|.+||++|.+...|..|+++|  
T Consensus       128 ~~r~~c~eCgk~ysT~snLsrHkQ~H~~~~s---------------------~ka~~C~~C~K~YvSmpALkMHirTH--  184 (279)
T KOG2462|consen  128 HPRYKCPECGKSYSTSSNLSRHKQTHRSLDS---------------------KKAFSCKYCGKVYVSMPALKMHIRTH--  184 (279)
T ss_pred             CCceeccccccccccccccchhhcccccccc---------------------cccccCCCCCceeeehHHHhhHhhcc--
Confidence            3458999999999999999999988865322                     23478999999999999999999999  


Q ss_pred             CCCCccCCCCCCcCCChHHHHhhhcCCCCc--eeCCCCCCccCChhHHHHHHhHHhCCCCCcccCCCcccCCChHHHHHh
Q psy12030        147 QEPKYQCPHCPHRAKHKANLKTHIAPQLGV--FACNVCGKGYRYKTGLYRHKREECGQEPKYQCPHCPHKAKHKANLKTH  224 (245)
Q Consensus       147 ~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~--~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~~C~~C~~~f~~~~~l~~H  224 (245)
                       .-+++|.+|||.|...+.|+-|+++|+|+  |.|..|+++|..+++|+.|+++|.+ .|+|+|..|+|.|+..+.|.+|
T Consensus       185 -~l~c~C~iCGKaFSRPWLLQGHiRTHTGEKPF~C~hC~kAFADRSNLRAHmQTHS~-~K~~qC~~C~KsFsl~SyLnKH  262 (279)
T KOG2462|consen  185 -TLPCECGICGKAFSRPWLLQGHIRTHTGEKPFSCPHCGKAFADRSNLRAHMQTHSD-VKKHQCPRCGKSFALKSYLNKH  262 (279)
T ss_pred             -CCCcccccccccccchHHhhcccccccCCCCccCCcccchhcchHHHHHHHHhhcC-CccccCcchhhHHHHHHHHHHh
Confidence             45799999999999999999999999985  9999999999999999999999988 8899999999999999999999


Q ss_pred             Hhh
Q psy12030        225 IAI  227 (245)
Q Consensus       225 ~~~  227 (245)
                      ...
T Consensus       263 ~ES  265 (279)
T KOG2462|consen  263 SES  265 (279)
T ss_pred             hhh
Confidence            863


No 3  
>KOG1074|consensus
Probab=99.94  E-value=1e-27  Score=203.80  Aligned_cols=79  Identities=27%  Similarity=0.516  Sum_probs=73.9

Q ss_pred             cccCcCCCccCchhHHHhHHhhhcCCCCCccCCCCCCcCCChHHHHhhhcCCCCc------eeCC---CCCCccCChhHH
Q psy12030        122 FACDVCGKEYKYKRGLYRHKKFECGQEPKYQCPHCPHRAKHKANLKTHIAPQLGV------FACN---VCGKGYRYKTGL  192 (245)
Q Consensus       122 ~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~------~~C~---~C~~~f~~~~~l  192 (245)
                      ..|.+|.+++.-...|+.|+|+|+| |+||+|.+||+.|.++.+|+.|+..|...      +.|+   +|-+.|.+...|
T Consensus       606 NqCiiC~rVlSC~saLqmHyrtHtG-ERPFkCKiCgRAFtTkGNLkaH~~vHka~p~~R~q~ScP~~~ic~~kftn~V~l  684 (958)
T KOG1074|consen  606 NQCIICLRVLSCPSALQMHYRTHTG-ERPFKCKICGRAFTTKGNLKAHMSVHKAKPPARVQFSCPSTFICQKKFTNAVTL  684 (958)
T ss_pred             cceeeeeecccchhhhhhhhhcccC-cCccccccccchhccccchhhcccccccCccccccccCCchhhhcccccccccc
Confidence            3499999999999999999999999 99999999999999999999999988752      8999   999999999999


Q ss_pred             HHHHhHHhC
Q psy12030        193 YRHKREECG  201 (245)
Q Consensus       193 ~~H~~~h~~  201 (245)
                      ..|+++|.+
T Consensus       685 pQhIriH~~  693 (958)
T KOG1074|consen  685 PQHIRIHLG  693 (958)
T ss_pred             cceEEeecC
Confidence            999999874


No 4  
>KOG3623|consensus
Probab=99.92  E-value=1.6e-26  Score=193.75  Aligned_cols=100  Identities=28%  Similarity=0.711  Sum_probs=92.0

Q ss_pred             eecccccccccChhHHhcchhc-ccCCCCCccCCCCcccccChHHHHHhcC------------------CccccCcCCCc
Q psy12030         70 FECQVCGKRYKYKRGLHRHKQD-ECGQEPKYQCPQCKDSFFSWSAFHKNLS------------------GMFACDVCGKE  130 (245)
Q Consensus        70 ~~C~~C~~~f~~~~~l~~H~~~-h~~~~~~~~C~~C~~~f~~~~~l~~h~~------------------~~~~C~~C~~~  130 (245)
                      .+|++|.+.+....+|+.|++- |-.++..|.|.+|.++|..+..|.+|+.                  +.|+|.+||+.
T Consensus       211 ltcpycdrgykrltslkeHikyrhekne~nfsC~lCsytFAyRtQLErhm~~hkpg~dqa~sltqsa~lRKFKCtECgKA  290 (1007)
T KOG3623|consen  211 LTCPYCDRGYKRLTSLKEHIKYRHEKNEPNFSCMLCSYTFAYRTQLERHMQLHKPGGDQAISLTQSALLRKFKCTECGKA  290 (1007)
T ss_pred             hcchhHHHHHHHHHHHHHHHHHHHhhCCCCCcchhhhhhhhhHHHHHHHHHhhcCCCcccccccchhhhccccccccchh
Confidence            6899999999999999999875 4445778999999999999999988872                  36999999999


Q ss_pred             cCchhHHHhHHhhhcCCCCCccCCCCCCcCCChHHHHhhh
Q psy12030        131 YKYKRGLYRHKKFECGQEPKYQCPHCPHRAKHKANLKTHI  170 (245)
Q Consensus       131 f~~~~~l~~H~~~h~~~~~~~~C~~C~~~f~~~~~l~~H~  170 (245)
                      |..+..|..|+|+|.| ++||.|+.|+|.|.....+..|+
T Consensus       291 FKfKHHLKEHlRIHSG-EKPfeCpnCkKRFSHSGSySSHm  329 (1007)
T KOG3623|consen  291 FKFKHHLKEHLRIHSG-EKPFECPNCKKRFSHSGSYSSHM  329 (1007)
T ss_pred             hhhHHHHHhhheeecC-CCCcCCcccccccccCCcccccc
Confidence            9999999999999999 99999999999999999999996


No 5  
>KOG3608|consensus
Probab=99.91  E-value=1.2e-25  Score=174.50  Aligned_cols=224  Identities=18%  Similarity=0.344  Sum_probs=185.7

Q ss_pred             cccccccccccccceeeeeecccCcceeeeecc------CCCCCC---------cccccccccCCCCCccccccCCCcee
Q psy12030          7 STGQQYNKIMPVCLYAMFVEKSTNTKMEFIAIR------NSNVDK---------SLNTNVLNAHGFNIWPLVQQYSKGFE   71 (245)
Q Consensus         7 ~~~~~~~~~~~~c~~~~~~~~~~~~~~~~~~~~------~~~~~~---------~~~~~~~~~~~~~~~~~~~~~~~~~~   71 (245)
                      ..++.+.+.=..|+..|.+.....+|......-      ....++         .+...+.+...|+.|.+.|+++|...
T Consensus       130 ~~g~~f~C~WedCe~~F~s~~ef~dHV~~H~l~ceyd~~~~~~D~~pv~~C~W~~Ct~~~~~k~~LreH~r~Hs~eKvvA  209 (467)
T KOG3608|consen  130 ALGQNFRCGWEDCEREFVSIVEFQDHVVKHALFCEYDIQKTPEDERPVTMCNWAMCTKHMGNKYRLREHIRTHSNEKVVA  209 (467)
T ss_pred             cchhhhccChhhcCCcccCHHHHHHHHHHhhhhhhhhhhhCCCCCCceeeccchhhhhhhccHHHHHHHHHhcCCCeEEe
Confidence            445666666677888888766666665532221      111111         24444666778889999999999999


Q ss_pred             cccccccccChhHHhcchhcccC-CCCCccCCCCcccccChHHHHHhcCC---ccccCcCCCccCchhHHHhHHhhhcCC
Q psy12030         72 CQVCGKRYKYKRGLHRHKQDECG-QEPKYQCPQCKDSFFSWSAFHKNLSG---MFACDVCGKEYKYKRGLYRHKKFECGQ  147 (245)
Q Consensus        72 C~~C~~~f~~~~~l~~H~~~h~~-~~~~~~C~~C~~~f~~~~~l~~h~~~---~~~C~~C~~~f~~~~~l~~H~~~h~~~  147 (245)
                      |+.||..|.++..|..|++..+. +..+|.|..|.+.|.....|..|+.+   -|+|+.|+.+....++|..|++..+..
T Consensus       210 Cp~Cg~~F~~~tkl~DH~rRqt~l~~n~fqC~~C~KrFaTeklL~~Hv~rHvn~ykCplCdmtc~~~ssL~~H~r~rHs~  289 (467)
T KOG3608|consen  210 CPHCGELFRTKTKLFDHLRRQTELNTNSFQCAQCFKRFATEKLLKSHVVRHVNCYKCPLCDMTCSSASSLTTHIRYRHSK  289 (467)
T ss_pred             cchHHHHhccccHHHHHHHhhhhhcCCchHHHHHHHHHhHHHHHHHHHHHhhhcccccccccCCCChHHHHHHHHhhhcc
Confidence            99999999999999999886543 25689999999999999999999854   699999999999999999999988888


Q ss_pred             CCCccCCCCCCcCCChHHHHhhhcCCCCc-eeCCC--CCCccCChhHHHHHHhHHhC--CCCCcccCCCcccCCChHHHH
Q psy12030        148 EPKYQCPHCPHRAKHKANLKTHIAPQLGV-FACNV--CGKGYRYKTGLYRHKREECG--QEPKYQCPHCPHKAKHKANLK  222 (245)
Q Consensus       148 ~~~~~C~~C~~~f~~~~~l~~H~~~h~~~-~~C~~--C~~~f~~~~~l~~H~~~h~~--~~~~~~C~~C~~~f~~~~~l~  222 (245)
                      ++||+|+.|.+.|.+.+.|..|+..|..+ |.|+.  |...|.+...+.+|++.++.  ++.+|.|-.|++.|++..+|.
T Consensus       290 dkpfKCd~Cd~~c~~esdL~kH~~~HS~~~y~C~h~~C~~s~r~~~q~~~H~~evhEg~np~~Y~CH~Cdr~ft~G~~L~  369 (467)
T KOG3608|consen  290 DKPFKCDECDTRCVRESDLAKHVQVHSKTVYQCEHPDCHYSVRTYTQMRRHFLEVHEGNNPILYACHCCDRFFTSGKSLS  369 (467)
T ss_pred             CCCccccchhhhhccHHHHHHHHHhccccceecCCCCCcHHHHHHHHHHHHHHHhccCCCCCceeeecchhhhccchhHH
Confidence            99999999999999999999999999987 99988  99999999999999998883  356799999999999999999


Q ss_pred             HhHhhhCC
Q psy12030        223 THIAIKHS  230 (245)
Q Consensus       223 ~H~~~~~~  230 (245)
                      .|++..|+
T Consensus       370 ~HL~kkH~  377 (467)
T KOG3608|consen  370 AHLMKKHG  377 (467)
T ss_pred             HHHHHhhc
Confidence            99988876


No 6  
>KOG3608|consensus
Probab=99.89  E-value=1.9e-24  Score=167.78  Aligned_cols=170  Identities=22%  Similarity=0.446  Sum_probs=153.7

Q ss_pred             eeccc--ccccccChhHHhcchhcccCCCCCccCCCCcccccChHHHHHhcC-------CccccCcCCCccCchhHHHhH
Q psy12030         70 FECQV--CGKRYKYKRGLHRHKQDECGQEPKYQCPQCKDSFFSWSAFHKNLS-------GMFACDVCGKEYKYKRGLYRH  140 (245)
Q Consensus        70 ~~C~~--C~~~f~~~~~l~~H~~~h~~~~~~~~C~~C~~~f~~~~~l~~h~~-------~~~~C~~C~~~f~~~~~l~~H  140 (245)
                      +.|.+  |-+.|.++..|.+|++.|.+ ++..-|+.||..|..+..|-.|++       .+|.|..|.+.|.++..|..|
T Consensus       178 ~~C~W~~Ct~~~~~k~~LreH~r~Hs~-eKvvACp~Cg~~F~~~tkl~DH~rRqt~l~~n~fqC~~C~KrFaTeklL~~H  256 (467)
T KOG3608|consen  178 TMCNWAMCTKHMGNKYRLREHIRTHSN-EKVVACPHCGELFRTKTKLFDHLRRQTELNTNSFQCAQCFKRFATEKLLKSH  256 (467)
T ss_pred             eeccchhhhhhhccHHHHHHHHHhcCC-CeEEecchHHHHhccccHHHHHHHhhhhhcCCchHHHHHHHHHhHHHHHHHH
Confidence            55654  99999999999999999988 999999999999999999988873       489999999999999999999


Q ss_pred             HhhhcCCCCCccCCCCCCcCCChHHHHhhhcCCC---CceeCCCCCCccCChhHHHHHHhHHhCCCCCcccCC--CcccC
Q psy12030        141 KKFECGQEPKYQCPHCPHRAKHKANLKTHIAPQL---GVFACNVCGKGYRYKTGLYRHKREECGQEPKYQCPH--CPHKA  215 (245)
Q Consensus       141 ~~~h~~~~~~~~C~~C~~~f~~~~~l~~H~~~h~---~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~~C~~--C~~~f  215 (245)
                      +..|   ...|+|+.|.......+.|.+|++..+   +||+|+.|.+.|.+.++|.+|..+| + +..|+|..  |..+|
T Consensus       257 v~rH---vn~ykCplCdmtc~~~ssL~~H~r~rHs~dkpfKCd~Cd~~c~~esdL~kH~~~H-S-~~~y~C~h~~C~~s~  331 (467)
T KOG3608|consen  257 VVRH---VNCYKCPLCDMTCSSASSLTTHIRYRHSKDKPFKCDECDTRCVRESDLAKHVQVH-S-KTVYQCEHPDCHYSV  331 (467)
T ss_pred             HHHh---hhcccccccccCCCChHHHHHHHHhhhccCCCccccchhhhhccHHHHHHHHHhc-c-ccceecCCCCCcHHH
Confidence            9999   567999999999999999999987533   4699999999999999999999987 4 78899988  99999


Q ss_pred             CChHHHHHhHhhhC-CCC--CCCCCCCCccccC
Q psy12030        216 KHKANLKTHIAIKH-SDR--ILPPQEGRVWTRA  245 (245)
Q Consensus       216 ~~~~~l~~H~~~~~-~~~--~~~C~~C~~~f~~  245 (245)
                      ....+|++|++.+| |..  +|.|-.|.+-|++
T Consensus       332 r~~~q~~~H~~evhEg~np~~Y~CH~Cdr~ft~  364 (467)
T KOG3608|consen  332 RTYTQMRRHFLEVHEGNNPILYACHCCDRFFTS  364 (467)
T ss_pred             HHHHHHHHHHHHhccCCCCCceeeecchhhhcc
Confidence            99999999999888 555  4999999998864


No 7  
>KOG1074|consensus
Probab=99.84  E-value=7.2e-22  Score=168.49  Aligned_cols=59  Identities=27%  Similarity=0.505  Sum_probs=53.9

Q ss_pred             eeCCCCCCccCChhHHHHHHhHHhCCCCCcccCCCcccCCChHHHHHhHhhhCCCCCCCC
Q psy12030        177 FACNVCGKGYRYKTGLYRHKREECGQEPKYQCPHCPHKAKHKANLKTHIAIKHSDRILPP  236 (245)
Q Consensus       177 ~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~~C~~C~~~f~~~~~l~~H~~~~~~~~~~~C  236 (245)
                      ..|.+||+.|...+.|+.|+++|++ +|||.|.+|++.|..+.+|+.||.+|+...++.-
T Consensus       880 h~C~vCgk~FsSSsALqiH~rTHtg-~KPF~C~fC~~aFttrgnLKvHMgtH~w~q~~sr  938 (958)
T KOG1074|consen  880 HVCNVCGKQFSSSAALEIHMRTHTG-PKPFFCHFCEEAFTTRGNLKVHMGTHMWVQPPSR  938 (958)
T ss_pred             hhhccchhcccchHHHHHhhhcCCC-CCCccchhhhhhhhhhhhhhhhhccccccCCCcc
Confidence            4599999999999999999999999 9999999999999999999999999998776543


No 8  
>KOG3576|consensus
Probab=99.72  E-value=2e-18  Score=124.75  Aligned_cols=110  Identities=26%  Similarity=0.594  Sum_probs=89.1

Q ss_pred             CCceecccccccccChhHHhcchhcccCCCCCccCCCCcccccChHHHHHhcCCccccCcCCCccCchhHHHhHHhhhcC
Q psy12030         67 SKGFECQVCGKRYKYKRGLHRHKQDECGQEPKYQCPQCKDSFFSWSAFHKNLSGMFACDVCGKEYKYKRGLYRHKKFECG  146 (245)
Q Consensus        67 ~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~~C~~C~~~f~~~~~l~~h~~~~~~C~~C~~~f~~~~~l~~H~~~h~~  146 (245)
                      ...|.|.+|++.|.-+..|.+|++-|....+                        |.|..||+.|.....|.+|+++|+|
T Consensus       115 ~d~ftCrvCgK~F~lQRmlnrh~kch~~vkr------------------------~lct~cgkgfndtfdlkrh~rthtg  170 (267)
T KOG3576|consen  115 QDSFTCRVCGKKFGLQRMLNRHLKCHSDVKR------------------------HLCTFCGKGFNDTFDLKRHTRTHTG  170 (267)
T ss_pred             CCeeeeehhhhhhhHHHHHHHHhhhccHHHH------------------------HHHhhccCcccchhhhhhhhccccC
Confidence            4458899999999888888888888866222                        7788888888999999999999999


Q ss_pred             CCCCccCCCCCCcCCChHHHHhhhcCCCC-------------ceeCCCCCCccCChhHHHHHHhHHhC
Q psy12030        147 QEPKYQCPHCPHRAKHKANLKTHIAPQLG-------------VFACNVCGKGYRYKTGLYRHKREECG  201 (245)
Q Consensus       147 ~~~~~~C~~C~~~f~~~~~l~~H~~~h~~-------------~~~C~~C~~~f~~~~~l~~H~~~h~~  201 (245)
                       .+||+|..|++.|..+..|..|++.-++             .|.|+.||.+-.....+..|+..|+.
T Consensus       171 -vrpykc~~c~kaftqrcsleshl~kvhgv~~~yaykerr~kl~vcedcg~t~~~~e~~~~h~~~~hp  237 (267)
T KOG3576|consen  171 -VRPYKCSLCEKAFTQRCSLESHLKKVHGVQHQYAYKERRAKLYVCEDCGYTSERPEVYYLHLKLHHP  237 (267)
T ss_pred             -ccccchhhhhHHHHhhccHHHHHHHHcCchHHHHHHHhhhheeeecccCCCCCChhHHHHHHHhcCC
Confidence             8899999999999999999998754333             17788888887777788888887766


No 9  
>KOG3576|consensus
Probab=99.69  E-value=7.2e-18  Score=121.93  Aligned_cols=112  Identities=25%  Similarity=0.538  Sum_probs=102.2

Q ss_pred             ccccCcCCCccCchhHHHhHHhhhcCCCCCccCCCCCCcCCChHHHHhhhcCCCC--ceeCCCCCCccCChhHHHHHHhH
Q psy12030        121 MFACDVCGKEYKYKRGLYRHKKFECGQEPKYQCPHCPHRAKHKANLKTHIAPQLG--VFACNVCGKGYRYKTGLYRHKRE  198 (245)
Q Consensus       121 ~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~--~~~C~~C~~~f~~~~~l~~H~~~  198 (245)
                      .|.|..|++.|.-...|.+|++-|.. .+.+.|..||+.|.....|++|+++|+|  ||+|..|+++|+..-.|..|.+.
T Consensus       117 ~ftCrvCgK~F~lQRmlnrh~kch~~-vkr~lct~cgkgfndtfdlkrh~rthtgvrpykc~~c~kaftqrcsleshl~k  195 (267)
T KOG3576|consen  117 SFTCRVCGKKFGLQRMLNRHLKCHSD-VKRHLCTFCGKGFNDTFDLKRHTRTHTGVRPYKCSLCEKAFTQRCSLESHLKK  195 (267)
T ss_pred             eeeeehhhhhhhHHHHHHHHhhhccH-HHHHHHhhccCcccchhhhhhhhccccCccccchhhhhHHHHhhccHHHHHHH
Confidence            58999999999999999999999987 8889999999999999999999999998  59999999999999999999988


Q ss_pred             HhC----------CCCCcccCCCcccCCChHHHHHhHhhhCCCCC
Q psy12030        199 ECG----------QEPKYQCPHCPHKAKHKANLKTHIAIKHSDRI  233 (245)
Q Consensus       199 h~~----------~~~~~~C~~C~~~f~~~~~l~~H~~~~~~~~~  233 (245)
                      -||          .++.|.|..||.+-.....+..|++.||..-|
T Consensus       196 vhgv~~~yaykerr~kl~vcedcg~t~~~~e~~~~h~~~~hp~Sp  240 (267)
T KOG3576|consen  196 VHGVQHQYAYKERRAKLYVCEDCGYTSERPEVYYLHLKLHHPFSP  240 (267)
T ss_pred             HcCchHHHHHHHhhhheeeecccCCCCCChhHHHHHHHhcCCCCH
Confidence            776          26779999999999999999999999987543


No 10 
>KOG3623|consensus
Probab=99.64  E-value=4.2e-17  Score=137.78  Aligned_cols=105  Identities=28%  Similarity=0.676  Sum_probs=95.0

Q ss_pred             cccCcCCCccCchhHHHhHHhhhc-CCCCCccCCCCCCcCCChHHHHhhhcCCCC---------------ceeCCCCCCc
Q psy12030        122 FACDVCGKEYKYKRGLYRHKKFEC-GQEPKYQCPHCPHRAKHKANLKTHIAPQLG---------------VFACNVCGKG  185 (245)
Q Consensus       122 ~~C~~C~~~f~~~~~l~~H~~~h~-~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~---------------~~~C~~C~~~  185 (245)
                      .+|++|++.+.....|..|++..+ ..+..|.|..|.++|.++..|.+|+..|..               .|+|.+||++
T Consensus       211 ltcpycdrgykrltslkeHikyrhekne~nfsC~lCsytFAyRtQLErhm~~hkpg~dqa~sltqsa~lRKFKCtECgKA  290 (1007)
T KOG3623|consen  211 LTCPYCDRGYKRLTSLKEHIKYRHEKNEPNFSCMLCSYTFAYRTQLERHMQLHKPGGDQAISLTQSALLRKFKCTECGKA  290 (1007)
T ss_pred             hcchhHHHHHHHHHHHHHHHHHHHhhCCCCCcchhhhhhhhhHHHHHHHHHhhcCCCcccccccchhhhccccccccchh
Confidence            579999999999999999987554 346679999999999999999999977653               1999999999


Q ss_pred             cCChhHHHHHHhHHhCCCCCcccCCCcccCCChHHHHHhHhh
Q psy12030        186 YRYKTGLYRHKREECGQEPKYQCPHCPHKAKHKANLKTHIAI  227 (245)
Q Consensus       186 f~~~~~l~~H~~~h~~~~~~~~C~~C~~~f~~~~~l~~H~~~  227 (245)
                      |+.+..|..|+|+|.| ||||.|+.|+|+|+.+.++..||-.
T Consensus       291 FKfKHHLKEHlRIHSG-EKPfeCpnCkKRFSHSGSySSHmSS  331 (1007)
T KOG3623|consen  291 FKFKHHLKEHLRIHSG-EKPFECPNCKKRFSHSGSYSSHMSS  331 (1007)
T ss_pred             hhhHHHHHhhheeecC-CCCcCCcccccccccCCcccccccc
Confidence            9999999999999999 9999999999999999999999864


No 11 
>PLN03086 PRLI-interacting factor K; Provisional
Probab=99.46  E-value=1.5e-13  Score=116.56  Aligned_cols=129  Identities=17%  Similarity=0.356  Sum_probs=91.7

Q ss_pred             ccCCCCcccccChHHHHHhc----CCccccCc--CCCccCchhHHHhHHhhhcCCCCCccCCCCCCcCCChHHHHhhhcC
Q psy12030         99 YQCPQCKDSFFSWSAFHKNL----SGMFACDV--CGKEYKYKRGLYRHKKFECGQEPKYQCPHCPHRAKHKANLKTHIAP  172 (245)
Q Consensus        99 ~~C~~C~~~f~~~~~l~~h~----~~~~~C~~--C~~~f~~~~~l~~H~~~h~~~~~~~~C~~C~~~f~~~~~l~~H~~~  172 (245)
                      ..|+.|....... .|..|.    ...-.|+.  |+..|.... +          ++.+.|+.|++.|. ...|..|+..
T Consensus       408 V~C~NC~~~i~l~-~l~lHe~~C~r~~V~Cp~~~Cg~v~~r~e-l----------~~H~~C~~Cgk~f~-~s~LekH~~~  474 (567)
T PLN03086        408 VECRNCKHYIPSR-SIALHEAYCSRHNVVCPHDGCGIVLRVEE-A----------KNHVHCEKCGQAFQ-QGEMEKHMKV  474 (567)
T ss_pred             EECCCCCCccchh-HHHHHHhhCCCcceeCCcccccceeeccc-c----------ccCccCCCCCCccc-hHHHHHHHHh
Confidence            4677777665433 333444    23445764  887773222 2          34467888888885 5778888888


Q ss_pred             CCCceeCCCCCCccCChhHHHHHHhHHhCCCCCcccCCCcccCC----------ChHHHHHhHhhhCCCCCCCCCCCCcc
Q psy12030        173 QLGVFACNVCGKGYRYKTGLYRHKREECGQEPKYQCPHCPHKAK----------HKANLKTHIAIKHSDRILPPQEGRVW  242 (245)
Q Consensus       173 h~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~~C~~C~~~f~----------~~~~l~~H~~~~~~~~~~~C~~C~~~  242 (245)
                      ++.++.|+ ||+.+ ....|..|+.+|.+ ++++.|+.|++.|.          ..+.|..|..+ .|.+++.|..||+.
T Consensus       475 ~Hkpv~Cp-Cg~~~-~R~~L~~H~~thCp-~Kpi~C~fC~~~v~~g~~~~d~~d~~s~Lt~HE~~-CG~rt~~C~~Cgk~  550 (567)
T PLN03086        475 FHEPLQCP-CGVVL-EKEQMVQHQASTCP-LRLITCRFCGDMVQAGGSAMDVRDRLRGMSEHESI-CGSRTAPCDSCGRS  550 (567)
T ss_pred             cCCCccCC-CCCCc-chhHHHhhhhccCC-CCceeCCCCCCccccCccccchhhhhhhHHHHHHh-cCCcceEccccCCe
Confidence            77788888 88654 66888888888877 88888888888884          23578888877 48888888888887


Q ss_pred             cc
Q psy12030        243 TR  244 (245)
Q Consensus       243 f~  244 (245)
                      |+
T Consensus       551 Vr  552 (567)
T PLN03086        551 VM  552 (567)
T ss_pred             ee
Confidence            75


No 12 
>PLN03086 PRLI-interacting factor K; Provisional
Probab=99.33  E-value=5e-12  Score=107.48  Aligned_cols=145  Identities=21%  Similarity=0.450  Sum_probs=113.4

Q ss_pred             ceecccccccccChhHHhcchhcccCCCCCccCCC--CcccccChHHHHHhcCCccccCcCCCccCchhHHHhHHhhhcC
Q psy12030         69 GFECQVCGKRYKYKRGLHRHKQDECGQEPKYQCPQ--CKDSFFSWSAFHKNLSGMFACDVCGKEYKYKRGLYRHKKFECG  146 (245)
Q Consensus        69 ~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~~C~~--C~~~f~~~~~l~~h~~~~~~C~~C~~~f~~~~~l~~H~~~h~~  146 (245)
                      .-.|..|....... .|..|.....  .....|+.  ||..| .+..+..|    +.|..|++.|. ...|..|++.++ 
T Consensus       407 ~V~C~NC~~~i~l~-~l~lHe~~C~--r~~V~Cp~~~Cg~v~-~r~el~~H----~~C~~Cgk~f~-~s~LekH~~~~H-  476 (567)
T PLN03086        407 TVECRNCKHYIPSR-SIALHEAYCS--RHNVVCPHDGCGIVL-RVEEAKNH----VHCEKCGQAFQ-QGEMEKHMKVFH-  476 (567)
T ss_pred             eEECCCCCCccchh-HHHHHHhhCC--CcceeCCccccccee-eccccccC----ccCCCCCCccc-hHHHHHHHHhcC-
Confidence            35799998876654 4558875442  34567885  99988 34444555    68999999996 678999999984 


Q ss_pred             CCCCccCCCCCCcCCChHHHHhhhcCCCC--ceeCCCCCCccCC----------hhHHHHHHhHHhCCCCCcccCCCccc
Q psy12030        147 QEPKYQCPHCPHRAKHKANLKTHIAPQLG--VFACNVCGKGYRY----------KTGLYRHKREECGQEPKYQCPHCPHK  214 (245)
Q Consensus       147 ~~~~~~C~~C~~~f~~~~~l~~H~~~h~~--~~~C~~C~~~f~~----------~~~l~~H~~~h~~~~~~~~C~~C~~~  214 (245)
                        .++.|+ |++.+ .+..|..|+.+|-+  ++.|..|++.|..          .+.|..|.... | .+++.|..||+.
T Consensus       477 --kpv~Cp-Cg~~~-~R~~L~~H~~thCp~Kpi~C~fC~~~v~~g~~~~d~~d~~s~Lt~HE~~C-G-~rt~~C~~Cgk~  550 (567)
T PLN03086        477 --EPLQCP-CGVVL-EKEQMVQHQASTCPLRLITCRFCGDMVQAGGSAMDVRDRLRGMSEHESIC-G-SRTAPCDSCGRS  550 (567)
T ss_pred             --CCccCC-CCCCc-chhHHHhhhhccCCCCceeCCCCCCccccCccccchhhhhhhHHHHHHhc-C-CcceEccccCCe
Confidence              689999 99755 67999999887764  5999999999852          45899999986 7 999999999988


Q ss_pred             CCChHHHHHhHhhhCC
Q psy12030        215 AKHKANLKTHIAIKHS  230 (245)
Q Consensus       215 f~~~~~l~~H~~~~~~  230 (245)
                      +..+ .|..|+...|.
T Consensus       551 Vrlr-dm~~H~~~~h~  565 (567)
T PLN03086        551 VMLK-EMDIHQIAVHQ  565 (567)
T ss_pred             eeeh-hHHHHHHHhhc
Confidence            8766 67888877765


No 13 
>PHA00733 hypothetical protein
Probab=99.26  E-value=6.8e-12  Score=87.58  Aligned_cols=80  Identities=16%  Similarity=0.314  Sum_probs=57.3

Q ss_pred             CCCccCCCCCCcCCChHHHHhh------hcCCC-CceeCCCCCCccCChhHHHHHHhHHhCCCCCcccCCCcccCCChHH
Q psy12030        148 EPKYQCPHCPHRAKHKANLKTH------IAPQL-GVFACNVCGKGYRYKTGLYRHKREECGQEPKYQCPHCPHKAKHKAN  220 (245)
Q Consensus       148 ~~~~~C~~C~~~f~~~~~l~~H------~~~h~-~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~~C~~C~~~f~~~~~  220 (245)
                      ++++.|.+|.+.|.+...|..+      +..+. .+|.|+.||+.|.....|..|++.+   +.+|.|+.|++.|.....
T Consensus        38 ~~~~~~~~~~~~~~~~~~l~~~~~l~~~~~~~~~kPy~C~~Cgk~Fss~s~L~~H~r~h---~~~~~C~~CgK~F~~~~s  114 (128)
T PHA00733         38 QKRLIRAVVKTLIYNPQLLDESSYLYKLLTSKAVSPYVCPLCLMPFSSSVSLKQHIRYT---EHSKVCPVCGKEFRNTDS  114 (128)
T ss_pred             hhhHHHHHHhhhccChhhhcchHHHHhhcccCCCCCccCCCCCCcCCCHHHHHHHHhcC---CcCccCCCCCCccCCHHH
Confidence            4566777777776666555554      22222 2588888888888888888888765   346888888888888888


Q ss_pred             HHHhHhhhCC
Q psy12030        221 LKTHIAIKHS  230 (245)
Q Consensus       221 l~~H~~~~~~  230 (245)
                      |..|+...|+
T Consensus       115 L~~H~~~~h~  124 (128)
T PHA00733        115 TLDHVCKKHN  124 (128)
T ss_pred             HHHHHHHhcC
Confidence            8888887775


No 14 
>PHA00733 hypothetical protein
Probab=99.15  E-value=4.9e-11  Score=83.28  Aligned_cols=78  Identities=22%  Similarity=0.284  Sum_probs=60.0

Q ss_pred             cccCcCCCccCchhHHH------hHHhhhcCCCCCccCCCCCCcCCChHHHHhhhcCCCCceeCCCCCCccCChhHHHHH
Q psy12030        122 FACDVCGKEYKYKRGLY------RHKKFECGQEPKYQCPHCPHRAKHKANLKTHIAPQLGVFACNVCGKGYRYKTGLYRH  195 (245)
Q Consensus       122 ~~C~~C~~~f~~~~~l~------~H~~~h~~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~C~~C~~~f~~~~~l~~H  195 (245)
                      +.|.+|...|.....|.      .|+. +++ .++|.|+.|++.|.+...|..|++.+..+|.|.+|+++|.....|..|
T Consensus        41 ~~~~~~~~~~~~~~~l~~~~~l~~~~~-~~~-~kPy~C~~Cgk~Fss~s~L~~H~r~h~~~~~C~~CgK~F~~~~sL~~H  118 (128)
T PHA00733         41 LIRAVVKTLIYNPQLLDESSYLYKLLT-SKA-VSPYVCPLCLMPFSSSVSLKQHIRYTEHSKVCPVCGKEFRNTDSTLDH  118 (128)
T ss_pred             HHHHHHhhhccChhhhcchHHHHhhcc-cCC-CCCccCCCCCCcCCCHHHHHHHHhcCCcCccCCCCCCccCCHHHHHHH
Confidence            44444554444444444      4432 234 788999999999999999999999877779999999999999999999


Q ss_pred             HhHHhC
Q psy12030        196 KREECG  201 (245)
Q Consensus       196 ~~~h~~  201 (245)
                      +...|+
T Consensus       119 ~~~~h~  124 (128)
T PHA00733        119 VCKKHN  124 (128)
T ss_pred             HHHhcC
Confidence            988776


No 15 
>PHA02768 hypothetical protein; Provisional
Probab=99.10  E-value=6.3e-11  Score=68.36  Aligned_cols=42  Identities=17%  Similarity=0.504  Sum_probs=26.1

Q ss_pred             eeCCCCCCccCChhHHHHHHhHHhCCCCCcccCCCcccCCChHHH
Q psy12030        177 FACNVCGKGYRYKTGLYRHKREECGQEPKYQCPHCPHKAKHKANL  221 (245)
Q Consensus       177 ~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~~C~~C~~~f~~~~~l  221 (245)
                      |+|+.||+.|...++|..|+++|+   ++|+|..|++.|...+.|
T Consensus         6 y~C~~CGK~Fs~~~~L~~H~r~H~---k~~kc~~C~k~f~~~s~l   47 (55)
T PHA02768          6 YECPICGEIYIKRKSMITHLRKHN---TNLKLSNCKRISLRTGEY   47 (55)
T ss_pred             cCcchhCCeeccHHHHHHHHHhcC---CcccCCcccceeccccee
Confidence            566666666666666666666664   456666666666655544


No 16 
>PHA02768 hypothetical protein; Provisional
Probab=99.03  E-value=9.8e-11  Score=67.55  Aligned_cols=37  Identities=19%  Similarity=0.367  Sum_probs=27.1

Q ss_pred             cccCCCcccCCChHHHHHhHhhhCCCCCCCCCCCCcccc
Q psy12030        206 YQCPHCPHKAKHKANLKTHIAIKHSDRILPPQEGRVWTR  244 (245)
Q Consensus       206 ~~C~~C~~~f~~~~~l~~H~~~~~~~~~~~C~~C~~~f~  244 (245)
                      |.|+.||+.|+.++.|..|+++|+  ++|+|..|++.|.
T Consensus         6 y~C~~CGK~Fs~~~~L~~H~r~H~--k~~kc~~C~k~f~   42 (55)
T PHA02768          6 YECPICGEIYIKRKSMITHLRKHN--TNLKLSNCKRISL   42 (55)
T ss_pred             cCcchhCCeeccHHHHHHHHHhcC--CcccCCcccceec
Confidence            677777777777777777777776  5777777777663


No 17 
>KOG3993|consensus
Probab=98.91  E-value=2.2e-10  Score=92.14  Aligned_cols=160  Identities=19%  Similarity=0.324  Sum_probs=91.9

Q ss_pred             ceecccccccccChhHHhcchhcccCCCCCccCCCCcccccChHHHHHhcC-----------------------------
Q psy12030         69 GFECQVCGKRYKYKRGLHRHKQDECGQEPKYQCPQCKDSFFSWSAFHKNLS-----------------------------  119 (245)
Q Consensus        69 ~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~~C~~C~~~f~~~~~l~~h~~-----------------------------  119 (245)
                      .|.|..|-..|.+...|.+|.-...- ...|+|++|++.|..-.+|-.|.+                             
T Consensus       267 dyiCqLCK~kYeD~F~LAQHrC~RIV-~vEYrCPEC~KVFsCPANLASHRRWHKPR~eaa~a~~~P~k~~~~~rae~~ea  345 (500)
T KOG3993|consen  267 DYICQLCKEKYEDAFALAQHRCPRIV-HVEYRCPECDKVFSCPANLASHRRWHKPRPEAAKAGSPPPKQAVETRAEVQEA  345 (500)
T ss_pred             HHHHHHHHHhhhhHHHHhhccCCeeE-EeeecCCcccccccCchhhhhhhcccCCchhhhhcCCCChhhhhhhhhhhhhc
Confidence            48899999899999999888754433 445777777777766666644431                             


Q ss_pred             ---------CccccCcCCCccCchhHHHhHHhhhcCCCCC----------------ccCCCCCCcCCChHHHHhhhcCCC
Q psy12030        120 ---------GMFACDVCGKEYKYKRGLYRHKKFECGQEPK----------------YQCPHCPHRAKHKANLKTHIAPQL  174 (245)
Q Consensus       120 ---------~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~----------------~~C~~C~~~f~~~~~l~~H~~~h~  174 (245)
                               +.|.|.+|++.|....-|+.|+.+|+.....                +.+..+.-.+.....--.+.-.+.
T Consensus       346 ~rsg~dss~gi~~C~~C~KkFrRqAYLrKHqlthq~~~~~k~~a~~f~~s~~~~l~~~~~~~a~h~~a~~~~g~~vl~~a  425 (500)
T KOG3993|consen  346 ERSGDDSSSGIFSCHTCGKKFRRQAYLRKHQLTHQRAPLAKEKAPKFLLSRVIPLMHFNQAVATHSSASDSHGDEVLYVA  425 (500)
T ss_pred             cccCCcccCceeecHHhhhhhHHHHHHHHhHHhhhccccchhcccCcchhhcccccccccccccccccccccccceeeee
Confidence                     1255666666666666666665555431110                112222211111111000101111


Q ss_pred             Cc---eeCCCCCCccCChhHHHHHHhHHhCCCCCcccCCCcccCCChHHHHHhHhhhCC
Q psy12030        175 GV---FACNVCGKGYRYKTGLYRHKREECGQEPKYQCPHCPHKAKHKANLKTHIAIKHS  230 (245)
Q Consensus       175 ~~---~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~~C~~C~~~f~~~~~l~~H~~~~~~  230 (245)
                      +.   ..+++||..+..+..--.+.+.-.. +.-|.|.+|.-.|.++..|.+|+..-|.
T Consensus       426 ~sael~~pp~~~~ppsss~~sgg~~rlg~~-~q~f~~ky~~atfyss~~ltrhin~~Hp  483 (500)
T KOG3993|consen  426 GSAELELPPYDGSPPSSSGSSGGYGRLGIA-EQGFTCKYCPATFYSSPGLTRHINKCHP  483 (500)
T ss_pred             ccccccCCCCCCCCcccCCCCCccccccch-hhccccccchHhhhcCcchHhHhhhcCh
Confidence            11   3356677666665554444444444 5569999999999999999999877663


No 18 
>PF13465 zf-H2C2_2:  Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A ....
Probab=98.87  E-value=8.4e-10  Score=54.53  Aligned_cols=24  Identities=8%  Similarity=0.007  Sum_probs=13.4

Q ss_pred             HHHhHhhhCCCCCCCCCCCCcccc
Q psy12030        221 LKTHIAIKHSDRILPPQEGRVWTR  244 (245)
Q Consensus       221 l~~H~~~~~~~~~~~C~~C~~~f~  244 (245)
                      |.+|+++|+|++||.|++|++.|.
T Consensus         2 l~~H~~~H~~~k~~~C~~C~k~F~   25 (26)
T PF13465_consen    2 LRRHMRTHTGEKPYKCPYCGKSFS   25 (26)
T ss_dssp             HHHHHHHHSSSSSEEESSSSEEES
T ss_pred             HHHHhhhcCCCCCCCCCCCcCeeC
Confidence            455555555555555555555553


No 19 
>PHA00616 hypothetical protein
Probab=98.86  E-value=1e-09  Score=60.24  Aligned_cols=34  Identities=24%  Similarity=0.390  Sum_probs=27.6

Q ss_pred             CcccCCCcccCCChHHHHHhHhhhCCCCCCCCCC
Q psy12030        205 KYQCPHCPHKAKHKANLKTHIAIKHSDRILPPQE  238 (245)
Q Consensus       205 ~~~C~~C~~~f~~~~~l~~H~~~~~~~~~~~C~~  238 (245)
                      ||+|+.||+.|..++.|.+|++.|||++++.|+.
T Consensus         1 pYqC~~CG~~F~~~s~l~~H~r~~hg~~~~~~~~   34 (44)
T PHA00616          1 MYQCLRCGGIFRKKKEVIEHLLSVHKQNKLTLEY   34 (44)
T ss_pred             CCccchhhHHHhhHHHHHHHHHHhcCCCccceeE
Confidence            5788888888888888888888888888887754


No 20 
>PF13465 zf-H2C2_2:  Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A ....
Probab=98.81  E-value=2.7e-09  Score=52.71  Aligned_cols=26  Identities=38%  Similarity=0.784  Sum_probs=23.8

Q ss_pred             HHHHHHhHHhCCCCCcccCCCcccCCC
Q psy12030        191 GLYRHKREECGQEPKYQCPHCPHKAKH  217 (245)
Q Consensus       191 ~l~~H~~~h~~~~~~~~C~~C~~~f~~  217 (245)
                      +|.+|+++|++ ++||.|++|++.|.+
T Consensus         1 ~l~~H~~~H~~-~k~~~C~~C~k~F~~   26 (26)
T PF13465_consen    1 NLRRHMRTHTG-EKPYKCPYCGKSFSN   26 (26)
T ss_dssp             HHHHHHHHHSS-SSSEEESSSSEEESS
T ss_pred             CHHHHhhhcCC-CCCCCCCCCcCeeCc
Confidence            58999999999 999999999999974


No 21 
>KOG3993|consensus
Probab=98.79  E-value=4.5e-10  Score=90.37  Aligned_cols=146  Identities=15%  Similarity=0.254  Sum_probs=93.6

Q ss_pred             CccCCCCcccccChHHHHHhc-----CCccccCcCCCccCchhHHHhHHhhhcCCCCCcc--CCCCCCcCCChHHHHhhh
Q psy12030         98 KYQCPQCKDSFFSWSAFHKNL-----SGMFACDVCGKEYKYKRGLYRHKKFECGQEPKYQ--CPHCPHRAKHKANLKTHI  170 (245)
Q Consensus        98 ~~~C~~C~~~f~~~~~l~~h~-----~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~~--C~~C~~~f~~~~~l~~H~  170 (245)
                      .|.|.+|...|.+...|-+|.     ...|+|++|+++|.-..+|..|.|+|-.....-.  -+-=.+....+...+.=.
T Consensus       267 dyiCqLCK~kYeD~F~LAQHrC~RIV~vEYrCPEC~KVFsCPANLASHRRWHKPR~eaa~a~~~P~k~~~~~rae~~ea~  346 (500)
T KOG3993|consen  267 DYICQLCKEKYEDAFALAQHRCPRIVHVEYRCPECDKVFSCPANLASHRRWHKPRPEAAKAGSPPPKQAVETRAEVQEAE  346 (500)
T ss_pred             HHHHHHHHHhhhhHHHHhhccCCeeEEeeecCCcccccccCchhhhhhhcccCCchhhhhcCCCChhhhhhhhhhhhhcc
Confidence            499999999999999998887     3479999999999999999999999954111000  000000000011111101


Q ss_pred             c----CCCCceeCCCCCCccCChhHHHHHHhHHhCCC-------------------------------------------
Q psy12030        171 A----PQLGVFACNVCGKGYRYKTGLYRHKREECGQE-------------------------------------------  203 (245)
Q Consensus       171 ~----~h~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~-------------------------------------------  203 (245)
                      +    .-.+.|.|..|++.|....+|+.|+.+|+..+                                           
T Consensus       347 rsg~dss~gi~~C~~C~KkFrRqAYLrKHqlthq~~~~~k~~a~~f~~s~~~~l~~~~~~~a~h~~a~~~~g~~vl~~a~  426 (500)
T KOG3993|consen  347 RSGDDSSSGIFSCHTCGKKFRRQAYLRKHQLTHQRAPLAKEKAPKFLLSRVIPLMHFNQAVATHSSASDSHGDEVLYVAG  426 (500)
T ss_pred             ccCCcccCceeecHHhhhhhHHHHHHHHhHHhhhccccchhcccCcchhhcccccccccccccccccccccccceeeeec
Confidence            1    12224888888888888888888877775411                                           


Q ss_pred             --CCcccCCCcccCCChHHHHHhHhhhCCCCCCCCCCCCccc
Q psy12030        204 --PKYQCPHCPHKAKHKANLKTHIAIKHSDRILPPQEGRVWT  243 (245)
Q Consensus       204 --~~~~C~~C~~~f~~~~~l~~H~~~~~~~~~~~C~~C~~~f  243 (245)
                        --..|++||-.+.++..-..+.+.-+.+..|.|.+|.-.|
T Consensus       427 sael~~pp~~~~ppsss~~sgg~~rlg~~~q~f~~ky~~atf  468 (500)
T KOG3993|consen  427 SAELELPPYDGSPPSSSGSSGGYGRLGIAEQGFTCKYCPATF  468 (500)
T ss_pred             cccccCCCCCCCCcccCCCCCccccccchhhccccccchHhh
Confidence              1244666776666666555565555666677777776554


No 22 
>PHA00732 hypothetical protein
Probab=98.57  E-value=4.1e-08  Score=62.27  Aligned_cols=44  Identities=27%  Similarity=0.556  Sum_probs=20.2

Q ss_pred             eeCCCCCCccCChhHHHHHHhHHhCCCCCcccCCCcccCCChHHHHHhHh
Q psy12030        177 FACNVCGKGYRYKTGLYRHKREECGQEPKYQCPHCPHKAKHKANLKTHIA  226 (245)
Q Consensus       177 ~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~~C~~C~~~f~~~~~l~~H~~  226 (245)
                      |.|+.||+.|.+.+.|..|++.++.   ++.|+.||+.|.   .|..|++
T Consensus         2 y~C~~Cgk~F~s~s~Lk~H~r~~H~---~~~C~~CgKsF~---~l~~H~~   45 (79)
T PHA00732          2 FKCPICGFTTVTLFALKQHARRNHT---LTKCPVCNKSYR---RLNQHFY   45 (79)
T ss_pred             ccCCCCCCccCCHHHHHHHhhcccC---CCccCCCCCEeC---Chhhhhc
Confidence            4455555555555555555543211   134555555554   2444443


No 23 
>PHA00616 hypothetical protein
Probab=98.52  E-value=3.2e-08  Score=54.37  Aligned_cols=39  Identities=18%  Similarity=0.208  Sum_probs=33.5

Q ss_pred             ceeCCCCCCccCChhHHHHHHhHHhCCCCCcccCCCcccC
Q psy12030        176 VFACNVCGKGYRYKTGLYRHKREECGQEPKYQCPHCPHKA  215 (245)
Q Consensus       176 ~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~~C~~C~~~f  215 (245)
                      ||.|..||+.|...+.|..|++.||+ ++++.|+.=-..|
T Consensus         1 pYqC~~CG~~F~~~s~l~~H~r~~hg-~~~~~~~~~y~~f   39 (44)
T PHA00616          1 MYQCLRCGGIFRKKKEVIEHLLSVHK-QNKLTLEYFYIYF   39 (44)
T ss_pred             CCccchhhHHHhhHHHHHHHHHHhcC-CCccceeEEEEEE
Confidence            48899999999999999999999999 8999987643333


No 24 
>PHA00732 hypothetical protein
Probab=98.52  E-value=9.8e-08  Score=60.53  Aligned_cols=38  Identities=21%  Similarity=0.312  Sum_probs=33.4

Q ss_pred             CcccCCCcccCCChHHHHHhHhhhCCCCCCCCCCCCcccc
Q psy12030        205 KYQCPHCPHKAKHKANLKTHIAIKHSDRILPPQEGRVWTR  244 (245)
Q Consensus       205 ~~~C~~C~~~f~~~~~l~~H~~~~~~~~~~~C~~C~~~f~  244 (245)
                      ||.|+.||+.|.+.+.|..|++.+|.  ++.|++||+.|.
T Consensus         1 py~C~~Cgk~F~s~s~Lk~H~r~~H~--~~~C~~CgKsF~   38 (79)
T PHA00732          1 MFKCPICGFTTVTLFALKQHARRNHT--LTKCPVCNKSYR   38 (79)
T ss_pred             CccCCCCCCccCCHHHHHHHhhcccC--CCccCCCCCEeC
Confidence            68999999999999999999986443  368999999986


No 25 
>PF05605 zf-Di19:  Drought induced 19 protein (Di19), zinc-binding;  InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins. Di19 has been found to be strongly expressed in both the roots and leaves of Arabidopsis thaliana during progressive drought [], whilst RING finger proteins are thought to play a role in spermatogenesis. The precise function is unknown.
Probab=98.46  E-value=3.2e-07  Score=54.08  Aligned_cols=51  Identities=29%  Similarity=0.602  Sum_probs=40.5

Q ss_pred             eeCCCCCCccCChhHHHHHHhHHhCC-CCCcccCCCcccCCChHHHHHhHhhhCC
Q psy12030        177 FACNVCGKGYRYKTGLYRHKREECGQ-EPKYQCPHCPHKAKHKANLKTHIAIKHS  230 (245)
Q Consensus       177 ~~C~~C~~~f~~~~~l~~H~~~h~~~-~~~~~C~~C~~~f~~~~~l~~H~~~~~~  230 (245)
                      |.|+.|++ ..+...|..|....|.. .+.+.||+|...+.  .+|..|+..+|+
T Consensus         3 f~CP~C~~-~~~~~~L~~H~~~~H~~~~~~v~CPiC~~~~~--~~l~~Hl~~~H~   54 (54)
T PF05605_consen    3 FTCPYCGK-GFSESSLVEHCEDEHRSESKNVVCPICSSRVT--DNLIRHLNSQHR   54 (54)
T ss_pred             cCCCCCCC-ccCHHHHHHHHHhHCcCCCCCccCCCchhhhh--hHHHHHHHHhcC
Confidence            78999999 45677899998876653 45799999998654  489999998875


No 26 
>PF00096 zf-C2H2:  Zinc finger, C2H2 type;  InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger: #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C], where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter []. This entry represents the classical C2H2 zinc finger domain.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0005622 intracellular; PDB: 2D9H_A 2EPC_A 1SP1_A 1VA3_A 2WBT_B 2ELR_A 2YTP_A 2YTT_A 1VA1_A 2ELO_A ....
Probab=98.16  E-value=1.2e-06  Score=41.93  Aligned_cols=22  Identities=41%  Similarity=0.833  Sum_probs=13.8

Q ss_pred             cccCCCcccCCChHHHHHhHhh
Q psy12030        206 YQCPHCPHKAKHKANLKTHIAI  227 (245)
Q Consensus       206 ~~C~~C~~~f~~~~~l~~H~~~  227 (245)
                      |.|+.|++.|.+.+.|..|++.
T Consensus         1 y~C~~C~~~f~~~~~l~~H~~~   22 (23)
T PF00096_consen    1 YKCPICGKSFSSKSNLKRHMRR   22 (23)
T ss_dssp             EEETTTTEEESSHHHHHHHHHH
T ss_pred             CCCCCCCCccCCHHHHHHHHhH
Confidence            4566666666666666666654


No 27 
>PF13894 zf-C2H2_4:  C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A ....
Probab=98.04  E-value=3.4e-06  Score=40.58  Aligned_cols=24  Identities=33%  Similarity=0.851  Sum_probs=13.9

Q ss_pred             cccCCCcccCCChHHHHHhHhhhC
Q psy12030        206 YQCPHCPHKAKHKANLKTHIAIKH  229 (245)
Q Consensus       206 ~~C~~C~~~f~~~~~l~~H~~~~~  229 (245)
                      |.|++|++.|.+...|..|++++|
T Consensus         1 ~~C~~C~~~~~~~~~l~~H~~~~H   24 (24)
T PF13894_consen    1 FQCPICGKSFRSKSELRQHMRTHH   24 (24)
T ss_dssp             EE-SSTS-EESSHHHHHHHHHHHS
T ss_pred             CCCcCCCCcCCcHHHHHHHHHhhC
Confidence            456666666666666666666554


No 28 
>PF00096 zf-C2H2:  Zinc finger, C2H2 type;  InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger: #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C], where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter []. This entry represents the classical C2H2 zinc finger domain.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0005622 intracellular; PDB: 2D9H_A 2EPC_A 1SP1_A 1VA3_A 2WBT_B 2ELR_A 2YTP_A 2YTT_A 1VA1_A 2ELO_A ....
Probab=98.03  E-value=3.6e-06  Score=40.16  Aligned_cols=23  Identities=39%  Similarity=0.940  Sum_probs=19.2

Q ss_pred             eeCCCCCCccCChhHHHHHHhHH
Q psy12030        177 FACNVCGKGYRYKTGLYRHKREE  199 (245)
Q Consensus       177 ~~C~~C~~~f~~~~~l~~H~~~h  199 (245)
                      |.|+.|++.|.++..|..|++.|
T Consensus         1 y~C~~C~~~f~~~~~l~~H~~~H   23 (23)
T PF00096_consen    1 YKCPICGKSFSSKSNLKRHMRRH   23 (23)
T ss_dssp             EEETTTTEEESSHHHHHHHHHHH
T ss_pred             CCCCCCCCccCCHHHHHHHHhHC
Confidence            67888888888888888888774


No 29 
>PF05605 zf-Di19:  Drought induced 19 protein (Di19), zinc-binding;  InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins. Di19 has been found to be strongly expressed in both the roots and leaves of Arabidopsis thaliana during progressive drought [], whilst RING finger proteins are thought to play a role in spermatogenesis. The precise function is unknown.
Probab=98.01  E-value=7.4e-06  Score=48.21  Aligned_cols=37  Identities=32%  Similarity=0.600  Sum_probs=20.3

Q ss_pred             cccCcCCCccCchhHHHhHHhhhcCC-CCCccCCCCCCc
Q psy12030        122 FACDVCGKEYKYKRGLYRHKKFECGQ-EPKYQCPHCPHR  159 (245)
Q Consensus       122 ~~C~~C~~~f~~~~~l~~H~~~h~~~-~~~~~C~~C~~~  159 (245)
                      |+|++|++ ..+...|..|....|.. .+.+.|++|...
T Consensus         3 f~CP~C~~-~~~~~~L~~H~~~~H~~~~~~v~CPiC~~~   40 (54)
T PF05605_consen    3 FTCPYCGK-GFSESSLVEHCEDEHRSESKNVVCPICSSR   40 (54)
T ss_pred             cCCCCCCC-ccCHHHHHHHHHhHCcCCCCCccCCCchhh
Confidence            66666766 34455666665544432 234556655543


No 30 
>PF09237 GAGA:  GAGA factor;  InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  Members of this entry bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 1YUI_A 1YUJ_A.
Probab=97.97  E-value=4e-06  Score=47.07  Aligned_cols=41  Identities=22%  Similarity=0.499  Sum_probs=26.8

Q ss_pred             HHHHhHHhCCCCCcccCCCcccCCChHHHHHhHhhhCCCCC
Q psy12030        193 YRHKREECGQEPKYQCPHCPHKAKHKANLKTHIAIKHSDRI  233 (245)
Q Consensus       193 ~~H~~~h~~~~~~~~C~~C~~~f~~~~~l~~H~~~~~~~~~  233 (245)
                      ..+.+.+...+.|-.|++|+..+.+..+|++|+.+.|+.+|
T Consensus        12 ~~~~k~~~~S~~PatCP~C~a~~~~srnLrRHle~~H~~k~   52 (54)
T PF09237_consen   12 TKKPKSKSQSEQPATCPICGAVIRQSRNLRRHLEIRHFKKP   52 (54)
T ss_dssp             ----CCCCTTS--EE-TTT--EESSHHHHHHHHHHHTTTS-
T ss_pred             hhHHHHhhccCCCCCCCcchhhccchhhHHHHHHHHhcccC
Confidence            55666666668889999999999999999999999998876


No 31 
>PF13912 zf-C2H2_6:  C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B.
Probab=97.95  E-value=5.2e-06  Score=41.33  Aligned_cols=26  Identities=19%  Similarity=0.436  Sum_probs=19.6

Q ss_pred             CcccCCCcccCCChHHHHHhHhhhCC
Q psy12030        205 KYQCPHCPHKAKHKANLKTHIAIKHS  230 (245)
Q Consensus       205 ~~~C~~C~~~f~~~~~l~~H~~~~~~  230 (245)
                      ||.|..|++.|.+...|..|++.|++
T Consensus         1 ~~~C~~C~~~F~~~~~l~~H~~~h~~   26 (27)
T PF13912_consen    1 PFECDECGKTFSSLSALREHKRSHCS   26 (27)
T ss_dssp             SEEETTTTEEESSHHHHHHHHCTTTT
T ss_pred             CCCCCccCCccCChhHHHHHhHHhcC
Confidence            57788888888888888888776653


No 32 
>PF12756 zf-C2H2_2:  C2H2 type zinc-finger (2 copies); PDB: 2DMI_A.
Probab=97.84  E-value=1.1e-05  Score=54.14  Aligned_cols=71  Identities=21%  Similarity=0.400  Sum_probs=13.3

Q ss_pred             cCcCCCccCchhHHHhHHhhhcCCCCCccCCCCCCcCCChHHHHhhhcCCCC-ceeCCCCCCccCChhHHHHHHhHH
Q psy12030        124 CDVCGKEYKYKRGLYRHKKFECGQEPKYQCPHCPHRAKHKANLKTHIAPQLG-VFACNVCGKGYRYKTGLYRHKREE  199 (245)
Q Consensus       124 C~~C~~~f~~~~~l~~H~~~h~~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~-~~~C~~C~~~f~~~~~l~~H~~~h  199 (245)
                      |..|+..|.+...|..|+...|+-..+     ....+.....+..+.+.... .+.|..|++.|.+...|..|++.+
T Consensus         2 C~~C~~~f~~~~~l~~H~~~~H~~~~~-----~~~~l~~~~~~~~~~~~~~~~~~~C~~C~~~f~s~~~l~~Hm~~~   73 (100)
T PF12756_consen    2 CLFCDESFSSVDDLLQHMKKKHGFDIP-----DQKYLVDPNRLLNYLRKKVKESFRCPYCNKTFRSREALQEHMRSK   73 (100)
T ss_dssp             ----------------------------------------------------SSEEBSSSS-EESSHHHHHHHHHHT
T ss_pred             ccccccccccccccccccccccccccc-----cccccccccccccccccccCCCCCCCccCCCCcCHHHHHHHHcCc
Confidence            666777777777777776655551111     11111122233333332222 255666666666666666666543


No 33 
>PF13894 zf-C2H2_4:  C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A ....
Probab=97.81  E-value=1.9e-05  Score=37.88  Aligned_cols=24  Identities=42%  Similarity=0.916  Sum_probs=18.7

Q ss_pred             eeCCCCCCccCChhHHHHHHhHHh
Q psy12030        177 FACNVCGKGYRYKTGLYRHKREEC  200 (245)
Q Consensus       177 ~~C~~C~~~f~~~~~l~~H~~~h~  200 (245)
                      |.|++|++.|.+...|..|+.+||
T Consensus         1 ~~C~~C~~~~~~~~~l~~H~~~~H   24 (24)
T PF13894_consen    1 FQCPICGKSFRSKSELRQHMRTHH   24 (24)
T ss_dssp             EE-SSTS-EESSHHHHHHHHHHHS
T ss_pred             CCCcCCCCcCCcHHHHHHHHHhhC
Confidence            678889999999999999988774


No 34 
>PF12756 zf-C2H2_2:  C2H2 type zinc-finger (2 copies); PDB: 2DMI_A.
Probab=97.77  E-value=1.7e-05  Score=53.05  Aligned_cols=69  Identities=16%  Similarity=0.399  Sum_probs=18.6

Q ss_pred             ecccccccccChhHHhcchhcccCCCCCccCCCCcccccChHHHHHh----cCCccccCcCCCccCchhHHHhHHhhh
Q psy12030         71 ECQVCGKRYKYKRGLHRHKQDECGQEPKYQCPQCKDSFFSWSAFHKN----LSGMFACDVCGKEYKYKRGLYRHKKFE  144 (245)
Q Consensus        71 ~C~~C~~~f~~~~~l~~H~~~h~~~~~~~~C~~C~~~f~~~~~l~~h----~~~~~~C~~C~~~f~~~~~l~~H~~~h  144 (245)
                      +|..|+..|.+...|..||...|+...+     ....+.....+...    +...+.|..|++.|.+...|..|++.+
T Consensus         1 ~C~~C~~~f~~~~~l~~H~~~~H~~~~~-----~~~~l~~~~~~~~~~~~~~~~~~~C~~C~~~f~s~~~l~~Hm~~~   73 (100)
T PF12756_consen    1 QCLFCDESFSSVDDLLQHMKKKHGFDIP-----DQKYLVDPNRLLNYLRKKVKESFRCPYCNKTFRSREALQEHMRSK   73 (100)
T ss_dssp             -----------------------------------------------------SSEEBSSSS-EESSHHHHHHHHHHT
T ss_pred             Cccccccccccccccccccccccccccc-----cccccccccccccccccccCCCCCCCccCCCCcCHHHHHHHHcCc
Confidence            4899999999999999999877763222     11111122222222    223578888888888888888888764


No 35 
>PF13912 zf-C2H2_6:  C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B.
Probab=97.59  E-value=3.6e-05  Score=38.18  Aligned_cols=26  Identities=38%  Similarity=0.905  Sum_probs=22.8

Q ss_pred             ceecccccccccChhHHhcchhcccC
Q psy12030         69 GFECQVCGKRYKYKRGLHRHKQDECG   94 (245)
Q Consensus        69 ~~~C~~C~~~f~~~~~l~~H~~~h~~   94 (245)
                      +|.|..|++.|.+...|..|++.|++
T Consensus         1 ~~~C~~C~~~F~~~~~l~~H~~~h~~   26 (27)
T PF13912_consen    1 PFECDECGKTFSSLSALREHKRSHCS   26 (27)
T ss_dssp             SEEETTTTEEESSHHHHHHHHCTTTT
T ss_pred             CCCCCccCCccCChhHHHHHhHHhcC
Confidence            58899999999999999999988754


No 36 
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning]
Probab=97.57  E-value=3.1e-05  Score=60.81  Aligned_cols=43  Identities=26%  Similarity=0.416  Sum_probs=35.8

Q ss_pred             CCCcccCC--CcccCCChHHHHHhHhhhC-------------------CCCCCCCCCCCccccC
Q psy12030        203 EPKYQCPH--CPHKAKHKANLKTHIAIKH-------------------SDRILPPQEGRVWTRA  245 (245)
Q Consensus       203 ~~~~~C~~--C~~~f~~~~~l~~H~~~~~-------------------~~~~~~C~~C~~~f~~  245 (245)
                      +|||+|++  |+|++.....|+-|+.--|                   .+|||+|++|+|++++
T Consensus       347 ~KpykCpV~gC~K~YknqnGLKYH~lhGH~~~~~~~~p~p~~~~~F~~~~KPYrCevC~KRYKN  410 (423)
T COG5189         347 GKPYKCPVEGCNKKYKNQNGLKYHMLHGHQNQKLHENPSPEKMNIFSAKDKPYRCEVCDKRYKN  410 (423)
T ss_pred             CceecCCCCCchhhhccccchhhhhhccccCcccCCCCCccccccccccCCceeccccchhhcc
Confidence            68999987  9999999999999986433                   3699999999998864


No 37 
>KOG2231|consensus
Probab=97.42  E-value=0.00032  Score=61.40  Aligned_cols=121  Identities=20%  Similarity=0.409  Sum_probs=74.0

Q ss_pred             cCCCCcccccChHHHHHhcC---CccccCcC---------CCccCchhHHHhHHhhhcCCCC----CccCCCCCCcCCCh
Q psy12030        100 QCPQCKDSFFSWSAFHKNLS---GMFACDVC---------GKEYKYKRGLYRHKKFECGQEP----KYQCPHCPHRAKHK  163 (245)
Q Consensus       100 ~C~~C~~~f~~~~~l~~h~~---~~~~C~~C---------~~~f~~~~~l~~H~~~h~~~~~----~~~C~~C~~~f~~~  163 (245)
                      .|..| -.|.+...|+.|+.   +.+.|..|         .....+...|.+|++.-...++    .-.|..|...|...
T Consensus       117 ~~~~c-~~~~s~~~Lk~H~~~~H~~~~c~lC~~~~kif~~e~k~Yt~~el~~h~~~gd~d~~s~rGhp~C~~C~~~fld~  195 (669)
T KOG2231|consen  117 ECLHC-TEFKSVENLKNHMRDQHKLHLCSLCLQNLKIFINERKLYTRAELNLHLMFGDPDDESCRGHPLCKFCHERFLDD  195 (669)
T ss_pred             CCccc-cchhHHHHHHHHHHHhhhhhccccccccceeeeeeeehehHHHHHHHHhcCCCccccccCCccchhhhhhhccH
Confidence            34445 44455555555551   23334333         2223455677777664322122    24588999999999


Q ss_pred             HHHHhhhcCCCCceeCCCC------CCccCChhHHHHHHhHHhCCCCCcccC--CC-cccCCChHHHHHhHhhh
Q psy12030        164 ANLKTHIAPQLGVFACNVC------GKGYRYKTGLYRHKREECGQEPKYQCP--HC-PHKAKHKANLKTHIAIK  228 (245)
Q Consensus       164 ~~l~~H~~~h~~~~~C~~C------~~~f~~~~~l~~H~~~h~~~~~~~~C~--~C-~~~f~~~~~l~~H~~~~  228 (245)
                      ..|.+|++.++  |.|..|      +.-|....+|..|.+.+|     |.|.  .| .+.|.....+..|++.|
T Consensus       196 ~el~rH~~~~h--~~chfC~~~~~~neyy~~~~dLe~HfR~~H-----flCE~~~C~~~~f~~~~~~ei~lk~~  262 (669)
T KOG2231|consen  196 DELYRHLRFDH--EFCHFCDYKTGQNEYYNDYDDLEEHFRKGH-----FLCEEEFCRTKKFYVAFELEIELKAH  262 (669)
T ss_pred             HHHHHhhccce--eheeecCcccccchhcccchHHHHHhhhcC-----ccccccccccceeeehhHHHHHHHhh
Confidence            99999988766  444444      566888899999988764     6787  56 34455555666666633


No 38 
>PF13909 zf-H2C2_5:  C2H2-type zinc-finger domain; PDB: 1X5W_A.
Probab=97.41  E-value=8.9e-05  Score=35.62  Aligned_cols=23  Identities=48%  Similarity=1.051  Sum_probs=12.9

Q ss_pred             cccCCCcccCCChHHHHHhHhhhC
Q psy12030        206 YQCPHCPHKAKHKANLKTHIAIKH  229 (245)
Q Consensus       206 ~~C~~C~~~f~~~~~l~~H~~~~~  229 (245)
                      |+|+.|+.... ...|..|++.+|
T Consensus         1 y~C~~C~y~t~-~~~l~~H~~~~H   23 (24)
T PF13909_consen    1 YKCPHCSYSTS-KSNLKRHLKRHH   23 (24)
T ss_dssp             EE-SSSS-EES-HHHHHHHHHHHH
T ss_pred             CCCCCCCCcCC-HHHHHHHHHhhC
Confidence            45666666665 666666666655


No 39 
>smart00355 ZnF_C2H2 zinc finger.
Probab=97.35  E-value=0.00022  Score=34.66  Aligned_cols=23  Identities=39%  Similarity=0.830  Sum_probs=13.8

Q ss_pred             cccCCCcccCCChHHHHHhHhhh
Q psy12030        206 YQCPHCPHKAKHKANLKTHIAIK  228 (245)
Q Consensus       206 ~~C~~C~~~f~~~~~l~~H~~~~  228 (245)
                      |.|+.|++.|.....|..|++.|
T Consensus         1 ~~C~~C~~~f~~~~~l~~H~~~H   23 (26)
T smart00355        1 YRCPECGKVFKSKSALKEHMRTH   23 (26)
T ss_pred             CCCCCCcchhCCHHHHHHHHHHh
Confidence            45666666666666666666543


No 40 
>PRK04860 hypothetical protein; Provisional
Probab=97.27  E-value=0.00014  Score=52.82  Aligned_cols=35  Identities=29%  Similarity=0.690  Sum_probs=18.8

Q ss_pred             eeCCCCCCccCChhHHHHHHhHHhCCCCCcccCCCcccCC
Q psy12030        177 FACNVCGKGYRYKTGLYRHKREECGQEPKYQCPHCPHKAK  216 (245)
Q Consensus       177 ~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~~C~~C~~~f~  216 (245)
                      |.|. |+.   ....+.+|.++|.+ +++|.|..|+..|.
T Consensus       120 Y~C~-C~~---~~~~~rrH~ri~~g-~~~YrC~~C~~~l~  154 (160)
T PRK04860        120 YRCK-CQE---HQLTVRRHNRVVRG-EAVYRCRRCGETLV  154 (160)
T ss_pred             EEcC-CCC---eeCHHHHHHHHhcC-CccEECCCCCceeE
Confidence            5554 554   44445555555555 55555555555544


No 41 
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning]
Probab=97.23  E-value=8.9e-05  Score=58.30  Aligned_cols=25  Identities=28%  Similarity=0.588  Sum_probs=22.4

Q ss_pred             CCCCcccCCCcccCCChHHHHHhHh
Q psy12030        202 QEPKYQCPHCPHKAKHKANLKTHIA  226 (245)
Q Consensus       202 ~~~~~~C~~C~~~f~~~~~l~~H~~  226 (245)
                      +.|||+|++|+|++.....|+-|..
T Consensus       395 ~~KPYrCevC~KRYKNlNGLKYHr~  419 (423)
T COG5189         395 KDKPYRCEVCDKRYKNLNGLKYHRK  419 (423)
T ss_pred             cCCceeccccchhhccCccceeccc
Confidence            3789999999999999999999865


No 42 
>PF12874 zf-met:  Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A.
Probab=97.12  E-value=0.00029  Score=34.11  Aligned_cols=23  Identities=22%  Similarity=0.566  Sum_probs=16.1

Q ss_pred             cccCCCcccCCChHHHHHhHhhh
Q psy12030        206 YQCPHCPHKAKHKANLKTHIAIK  228 (245)
Q Consensus       206 ~~C~~C~~~f~~~~~l~~H~~~~  228 (245)
                      |.|.+|++.|.+...|..|++.+
T Consensus         1 ~~C~~C~~~f~s~~~~~~H~~s~   23 (25)
T PF12874_consen    1 FYCDICNKSFSSENSLRQHLRSK   23 (25)
T ss_dssp             EEETTTTEEESSHHHHHHHHTTH
T ss_pred             CCCCCCCCCcCCHHHHHHHHCcC
Confidence            56777777777777777777643


No 43 
>smart00355 ZnF_C2H2 zinc finger.
Probab=97.03  E-value=0.00052  Score=33.23  Aligned_cols=24  Identities=33%  Similarity=0.750  Sum_probs=19.8

Q ss_pred             eeCCCCCCccCChhHHHHHHhHHh
Q psy12030        177 FACNVCGKGYRYKTGLYRHKREEC  200 (245)
Q Consensus       177 ~~C~~C~~~f~~~~~l~~H~~~h~  200 (245)
                      |.|..|++.|.....|..|++.|.
T Consensus         1 ~~C~~C~~~f~~~~~l~~H~~~H~   24 (26)
T smart00355        1 YRCPECGKVFKSKSALKEHMRTHX   24 (26)
T ss_pred             CCCCCCcchhCCHHHHHHHHHHhc
Confidence            568888999998889998888663


No 44 
>PF13909 zf-H2C2_5:  C2H2-type zinc-finger domain; PDB: 1X5W_A.
Probab=96.98  E-value=0.00089  Score=32.03  Aligned_cols=24  Identities=25%  Similarity=0.523  Sum_probs=18.7

Q ss_pred             eeCCCCCCccCChhHHHHHHhHHhC
Q psy12030        177 FACNVCGKGYRYKTGLYRHKREECG  201 (245)
Q Consensus       177 ~~C~~C~~~f~~~~~l~~H~~~h~~  201 (245)
                      |.|+.|++... ...|..|++.+++
T Consensus         1 y~C~~C~y~t~-~~~l~~H~~~~H~   24 (24)
T PF13909_consen    1 YKCPHCSYSTS-KSNLKRHLKRHHP   24 (24)
T ss_dssp             EE-SSSS-EES-HHHHHHHHHHHHS
T ss_pred             CCCCCCCCcCC-HHHHHHHHHhhCc
Confidence            68999998888 8899999988764


No 45 
>PF12171 zf-C2H2_jaz:  Zinc-finger double-stranded RNA-binding;  InterPro: IPR022755  This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length. The mammalian members of this group occur multiple times along the protein, joined by flexible linkers, and are referred to as JAZ - dsRNA-binding ZF protein - zinc-fingers. The JAZ proteins are expressed in all tissues tested and localise in the nucleus, particularly the nucleolus []. JAZ preferentially binds to double-stranded (ds) RNA or RNA/DNA hybrids rather than DNA. In addition to binding double-stranded RNA, these zinc-fingers are required for nucleolar localisation.   This entry represents the multiple-adjacent-C2H2 zinc finger, JAZ. ; PDB: 4DGW_A 1ZR9_A.
Probab=96.75  E-value=0.00079  Score=33.28  Aligned_cols=22  Identities=23%  Similarity=0.537  Sum_probs=17.2

Q ss_pred             cccCCCcccCCChHHHHHhHhh
Q psy12030        206 YQCPHCPHKAKHKANLKTHIAI  227 (245)
Q Consensus       206 ~~C~~C~~~f~~~~~l~~H~~~  227 (245)
                      |.|..|++.|.+...|..|+++
T Consensus         2 ~~C~~C~k~f~~~~~~~~H~~s   23 (27)
T PF12171_consen    2 FYCDACDKYFSSENQLKQHMKS   23 (27)
T ss_dssp             CBBTTTTBBBSSHHHHHCCTTS
T ss_pred             CCcccCCCCcCCHHHHHHHHcc
Confidence            6788888888888888888764


No 46 
>KOG2231|consensus
Probab=96.72  E-value=0.0028  Score=55.74  Aligned_cols=115  Identities=24%  Similarity=0.427  Sum_probs=81.6

Q ss_pred             ccCCCCcccccChHHHHHhcCCccccCcCCCccCchhHHHhHHhhhcCCCCCccCCCC---------CCcCCChHHHHhh
Q psy12030         99 YQCPQCKDSFFSWSAFHKNLSGMFACDVCGKEYKYKRGLYRHKKFECGQEPKYQCPHC---------PHRAKHKANLKTH  169 (245)
Q Consensus        99 ~~C~~C~~~f~~~~~l~~h~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~~C~~C---------~~~f~~~~~l~~H  169 (245)
                      +.|.+|+..|.-       +.....|..| ..|.+...|..|+...|+   .+.|..|         .....++..|..|
T Consensus       100 ~~C~~C~~~~~~-------~~~~~~~~~c-~~~~s~~~Lk~H~~~~H~---~~~c~lC~~~~kif~~e~k~Yt~~el~~h  168 (669)
T KOG2231|consen  100 HSCHICDRRFRA-------LYNKKECLHC-TEFKSVENLKNHMRDQHK---LHLCSLCLQNLKIFINERKLYTRAELNLH  168 (669)
T ss_pred             hhcCccccchhh-------hcccCCCccc-cchhHHHHHHHHHHHhhh---hhccccccccceeeeeeeehehHHHHHHH
Confidence            678888877521       0112468888 888899999999966544   2444443         2233446678888


Q ss_pred             hcC-------CCCceeCCCCCCccCChhHHHHHHhHHhCCCCCcccCCC------cccCCChHHHHHhHhhhC
Q psy12030        170 IAP-------QLGVFACNVCGKGYRYKTGLYRHKREECGQEPKYQCPHC------PHKAKHKANLKTHIAIKH  229 (245)
Q Consensus       170 ~~~-------h~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~~C~~C------~~~f~~~~~l~~H~~~~~  229 (245)
                      +..       +.|--.|..|...|.....|++|++.+|     |.|..|      +..|..-..|..|.+..|
T Consensus       169 ~~~gd~d~~s~rGhp~C~~C~~~fld~~el~rH~~~~h-----~~chfC~~~~~~neyy~~~~dLe~HfR~~H  236 (669)
T KOG2231|consen  169 LMFGDPDDESCRGHPLCKFCHERFLDDDELYRHLRFDH-----EFCHFCDYKTGQNEYYNDYDDLEEHFRKGH  236 (669)
T ss_pred             HhcCCCccccccCCccchhhhhhhccHHHHHHhhccce-----eheeecCcccccchhcccchHHHHHhhhcC
Confidence            643       2333679999999999999999998765     466666      567888999999999776


No 47 
>PF09237 GAGA:  GAGA factor;  InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  Members of this entry bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 1YUI_A 1YUJ_A.
Probab=96.69  E-value=0.0018  Score=36.55  Aligned_cols=29  Identities=24%  Similarity=0.341  Sum_probs=19.4

Q ss_pred             ceeCCCCCCccCChhHHHHHHhHHhCCCCC
Q psy12030        176 VFACNVCGKGYRYKTGLYRHKREECGQEPK  205 (245)
Q Consensus       176 ~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~  205 (245)
                      |-.|++|+..+....+|.+|+.+.|+ .+|
T Consensus        24 PatCP~C~a~~~~srnLrRHle~~H~-~k~   52 (54)
T PF09237_consen   24 PATCPICGAVIRQSRNLRRHLEIRHF-KKP   52 (54)
T ss_dssp             -EE-TTT--EESSHHHHHHHHHHHTT-TS-
T ss_pred             CCCCCcchhhccchhhHHHHHHHHhc-ccC
Confidence            47788888888888888888888777 443


No 48 
>PF12874 zf-met:  Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A.
Probab=96.67  E-value=0.0012  Score=31.82  Aligned_cols=23  Identities=30%  Similarity=0.810  Sum_probs=17.7

Q ss_pred             eeCCCCCCccCChhHHHHHHhHH
Q psy12030        177 FACNVCGKGYRYKTGLYRHKREE  199 (245)
Q Consensus       177 ~~C~~C~~~f~~~~~l~~H~~~h  199 (245)
                      |.|.+|+..|.+...|..|++.+
T Consensus         1 ~~C~~C~~~f~s~~~~~~H~~s~   23 (25)
T PF12874_consen    1 FYCDICNKSFSSENSLRQHLRSK   23 (25)
T ss_dssp             EEETTTTEEESSHHHHHHHHTTH
T ss_pred             CCCCCCCCCcCCHHHHHHHHCcC
Confidence            56888888888888888887654


No 49 
>PRK04860 hypothetical protein; Provisional
Probab=96.60  E-value=0.0018  Score=47.10  Aligned_cols=37  Identities=14%  Similarity=0.317  Sum_probs=33.3

Q ss_pred             CCcccCCCcccCCChHHHHHhHhhhCCCCCCCCCCCCcccc
Q psy12030        204 PKYQCPHCPHKAKHKANLKTHIAIKHSDRILPPQEGRVWTR  244 (245)
Q Consensus       204 ~~~~C~~C~~~f~~~~~l~~H~~~~~~~~~~~C~~C~~~f~  244 (245)
                      -+|.|. |+.   ....+.+|.+++.++++|.|..|+..|.
T Consensus       118 ~~Y~C~-C~~---~~~~~rrH~ri~~g~~~YrC~~C~~~l~  154 (160)
T PRK04860        118 FPYRCK-CQE---HQLTVRRHNRVVRGEAVYRCRRCGETLV  154 (160)
T ss_pred             EEEEcC-CCC---eeCHHHHHHHHhcCCccEECCCCCceeE
Confidence            479998 997   7888999999999999999999998874


No 50 
>PF12171 zf-C2H2_jaz:  Zinc-finger double-stranded RNA-binding;  InterPro: IPR022755  This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length. The mammalian members of this group occur multiple times along the protein, joined by flexible linkers, and are referred to as JAZ - dsRNA-binding ZF protein - zinc-fingers. The JAZ proteins are expressed in all tissues tested and localise in the nucleus, particularly the nucleolus []. JAZ preferentially binds to double-stranded (ds) RNA or RNA/DNA hybrids rather than DNA. In addition to binding double-stranded RNA, these zinc-fingers are required for nucleolar localisation.   This entry represents the multiple-adjacent-C2H2 zinc finger, JAZ. ; PDB: 4DGW_A 1ZR9_A.
Probab=96.53  E-value=0.0019  Score=31.89  Aligned_cols=22  Identities=27%  Similarity=0.702  Sum_probs=19.4

Q ss_pred             eecccccccccChhHHhcchhc
Q psy12030         70 FECQVCGKRYKYKRGLHRHKQD   91 (245)
Q Consensus        70 ~~C~~C~~~f~~~~~l~~H~~~   91 (245)
                      |.|..|++.|.+...|..|++.
T Consensus         2 ~~C~~C~k~f~~~~~~~~H~~s   23 (27)
T PF12171_consen    2 FYCDACDKYFSSENQLKQHMKS   23 (27)
T ss_dssp             CBBTTTTBBBSSHHHHHCCTTS
T ss_pred             CCcccCCCCcCCHHHHHHHHcc
Confidence            6799999999999999999875


No 51 
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only]
Probab=96.26  E-value=0.0059  Score=48.92  Aligned_cols=122  Identities=24%  Similarity=0.483  Sum_probs=69.6

Q ss_pred             eeccc--ccccccChhHHhcchhcccCCCCCccCCCCc---ccc------cChHHHHHhcCC---------ccccCcCCC
Q psy12030         70 FECQV--CGKRYKYKRGLHRHKQDECGQEPKYQCPQCK---DSF------FSWSAFHKNLSG---------MFACDVCGK  129 (245)
Q Consensus        70 ~~C~~--C~~~f~~~~~l~~H~~~h~~~~~~~~C~~C~---~~f------~~~~~l~~h~~~---------~~~C~~C~~  129 (245)
                      |.|+.  |..+......|+.|....|+   .+.|.+|-   +.|      .++..|+.|..+         .-.|..|..
T Consensus       152 F~CP~skc~~~C~~~k~lk~H~K~~H~---~~~C~~C~~nKk~F~~E~~lF~~~~Lr~H~~~G~~e~GFKGHP~C~FC~~  228 (493)
T COG5236         152 FKCPKSKCHRRCGSLKELKKHYKAQHG---FVLCSECIGNKKDFWNEIRLFRSSTLRDHKNGGLEEEGFKGHPLCIFCKI  228 (493)
T ss_pred             hcCCchhhhhhhhhHHHHHHHHHhhcC---cEEhHhhhcCcccCccceeeeecccccccccCCccccCcCCCchhhhccc
Confidence            77876  77777778889999887765   45666663   233      234455666522         345777777


Q ss_pred             ccCchhHHHhHHhhhcCCCCCccCCCCCCc-------CCChHHHHhhhcCCCCceeCCC--CC----CccCChhHHHHHH
Q psy12030        130 EYKYKRGLYRHKKFECGQEPKYQCPHCPHR-------AKHKANLKTHIAPQLGVFACNV--CG----KGYRYKTGLYRHK  196 (245)
Q Consensus       130 ~f~~~~~l~~H~~~h~~~~~~~~C~~C~~~-------f~~~~~l~~H~~~h~~~~~C~~--C~----~~f~~~~~l~~H~  196 (245)
                      -|.+-..|..|+|..|.     .|-+|.+.       |.+-..|.+|.+.-+  |.|.+  |.    .+|.....|+.|+
T Consensus       229 ~FYdDDEL~~HcR~~HE-----~ChICD~v~p~~~QYFK~Y~~Le~HF~~~h--y~ct~qtc~~~k~~vf~~~~el~~h~  301 (493)
T COG5236         229 YFYDDDELRRHCRLRHE-----ACHICDMVGPIRYQYFKSYEDLEAHFRNAH--YCCTFQTCRVGKCYVFPYHTELLEHL  301 (493)
T ss_pred             eecChHHHHHHHHhhhh-----hhhhhhccCccchhhhhCHHHHHHHhhcCc--eEEEEEEEecCcEEEeccHHHHHHHH
Confidence            77777777777775443     34444433       333444555533222  33322  21    2456666666666


Q ss_pred             hHHhC
Q psy12030        197 REECG  201 (245)
Q Consensus       197 ~~h~~  201 (245)
                      ...|+
T Consensus       302 ~~~h~  306 (493)
T COG5236         302 TRFHK  306 (493)
T ss_pred             HHHhh
Confidence            55443


No 52 
>PF13913 zf-C2HC_2:  zinc-finger of a C2HC-type
Probab=95.50  E-value=0.013  Score=28.26  Aligned_cols=20  Identities=30%  Similarity=0.597  Sum_probs=12.1

Q ss_pred             cccCCCcccCCChHHHHHhHh
Q psy12030        206 YQCPHCPHKAKHKANLKTHIA  226 (245)
Q Consensus       206 ~~C~~C~~~f~~~~~l~~H~~  226 (245)
                      ..|+.||..| ....|.+|++
T Consensus         3 ~~C~~CgR~F-~~~~l~~H~~   22 (25)
T PF13913_consen    3 VPCPICGRKF-NPDRLEKHEK   22 (25)
T ss_pred             CcCCCCCCEE-CHHHHHHHHH
Confidence            3566666666 5556666654


No 53 
>smart00451 ZnF_U1 U1-like zinc finger. Family of C2H2-type zinc fingers, present in matrin, U1 small nuclear ribonucleoprotein C and other RNA-binding proteins.
Probab=95.46  E-value=0.012  Score=30.80  Aligned_cols=23  Identities=13%  Similarity=0.392  Sum_probs=17.1

Q ss_pred             CcccCCCcccCCChHHHHHhHhh
Q psy12030        205 KYQCPHCPHKAKHKANLKTHIAI  227 (245)
Q Consensus       205 ~~~C~~C~~~f~~~~~l~~H~~~  227 (245)
                      +|.|.+|++.|.+...+..|++.
T Consensus         3 ~~~C~~C~~~~~~~~~~~~H~~g   25 (35)
T smart00451        3 GFYCKLCNVTFTDEISVEAHLKG   25 (35)
T ss_pred             CeEccccCCccCCHHHHHHHHCh
Confidence            47778888888877777777653


No 54 
>KOG1146|consensus
Probab=95.44  E-value=0.0057  Score=57.26  Aligned_cols=103  Identities=18%  Similarity=0.358  Sum_probs=70.1

Q ss_pred             CCCccCchhHHHhHHhhhcCCCCCccCCCCCCcCCChHHHHhhhcCCC---------------------------CceeC
Q psy12030        127 CGKEYKYKRGLYRHKKFECGQEPKYQCPHCPHRAKHKANLKTHIAPQL---------------------------GVFAC  179 (245)
Q Consensus       127 C~~~f~~~~~l~~H~~~h~~~~~~~~C~~C~~~f~~~~~l~~H~~~h~---------------------------~~~~C  179 (245)
                      ++..+..+..+..|+...+...+.+.|+.|+..|.....|..|++.-+                           ++|.|
T Consensus       442 ~e~~~~s~r~~~~~t~~L~S~~kt~~cpkc~~~yk~a~~L~vhmRskhp~~~~~~c~~gq~~~~~arg~~~~~~~~p~~C  521 (1406)
T KOG1146|consen  442 AEPLLESKRSLEGQTVVLHSFFKTLKCPKCNWHYKLAQTLGVHMRSKHPESQSAYCKAGQNHPRLARGEVYRCPGKPYPC  521 (1406)
T ss_pred             hhhhhhhhcccccceeeeecccccccCCccchhhhhHHHhhhcccccccccchhHhHhccccccccccccccCCCCcccc
Confidence            344444445555555444444577888888888888888888876511                           02778


Q ss_pred             CCCCCccCChhHHHHHHhHHhC------------------------------------------CCCCcccCCCcccCCC
Q psy12030        180 NVCGKGYRYKTGLYRHKREECG------------------------------------------QEPKYQCPHCPHKAKH  217 (245)
Q Consensus       180 ~~C~~~f~~~~~l~~H~~~h~~------------------------------------------~~~~~~C~~C~~~f~~  217 (245)
                      ..|...+....+|..|+..--.                                          .+.++.|.+|++-.+-
T Consensus       522 ~~C~~stttng~LsihlqS~~h~~~lee~~~~~g~~v~~~~~~v~s~~P~~ag~~~~ags~~pktkP~~~C~vc~yetni  601 (1406)
T KOG1146|consen  522 RACNYSTTTNGNLSIHLQSDLHRNELEEAEENAGEQVRLLPASVTSAVPEEAGLGPSAGSSGPKTKPSWRCEVCSYETNI  601 (1406)
T ss_pred             eeeeeeeecchHHHHHHHHHhhHHHHHHHHhccccchhhhhhhhcccCcccccCCCCCCCCCCCCCCCcchhhhcchhhh
Confidence            8888888888888888764200                                          0235889999888888


Q ss_pred             hHHHHHhHhhhC
Q psy12030        218 KANLKTHIAIKH  229 (245)
Q Consensus       218 ~~~l~~H~~~~~  229 (245)
                      .-+|+.|+..-+
T Consensus       602 arnlrihmtss~  613 (1406)
T KOG1146|consen  602 ARNLRIHMTASP  613 (1406)
T ss_pred             hhccccccccCC
Confidence            888888886543


No 55 
>TIGR00622 ssl1 transcription factor ssl1. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=95.35  E-value=0.046  Score=36.91  Aligned_cols=21  Identities=19%  Similarity=0.659  Sum_probs=9.5

Q ss_pred             eeCCCCCCccCChhHHHHHHh
Q psy12030        177 FACNVCGKGYRYKTGLYRHKR  197 (245)
Q Consensus       177 ~~C~~C~~~f~~~~~l~~H~~  197 (245)
                      |.|+.|...|--.-+...|..
T Consensus        82 y~C~~C~~~FC~dCD~fiHe~  102 (112)
T TIGR00622        82 YVCAVCKNVFCVDCDVFVHES  102 (112)
T ss_pred             eeCCCCCCccccccchhhhhh
Confidence            444444444444444444433


No 56 
>PF13913 zf-C2HC_2:  zinc-finger of a C2HC-type
Probab=94.73  E-value=0.028  Score=27.07  Aligned_cols=19  Identities=26%  Similarity=0.871  Sum_probs=11.4

Q ss_pred             eCCCCCCccCChhHHHHHHh
Q psy12030        178 ACNVCGKGYRYKTGLYRHKR  197 (245)
Q Consensus       178 ~C~~C~~~f~~~~~l~~H~~  197 (245)
                      .|+.||+.| ....|..|+.
T Consensus         4 ~C~~CgR~F-~~~~l~~H~~   22 (25)
T PF13913_consen    4 PCPICGRKF-NPDRLEKHEK   22 (25)
T ss_pred             cCCCCCCEE-CHHHHHHHHH
Confidence            466666666 4555666654


No 57 
>smart00451 ZnF_U1 U1-like zinc finger. Family of C2H2-type zinc fingers, present in matrin, U1 small nuclear ribonucleoprotein C and other RNA-binding proteins.
Probab=94.51  E-value=0.04  Score=28.80  Aligned_cols=24  Identities=21%  Similarity=0.538  Sum_probs=19.1

Q ss_pred             CceeCCCCCCccCChhHHHHHHhH
Q psy12030        175 GVFACNVCGKGYRYKTGLYRHKRE  198 (245)
Q Consensus       175 ~~~~C~~C~~~f~~~~~l~~H~~~  198 (245)
                      ++|.|++|+..|.+...+..|+..
T Consensus         2 ~~~~C~~C~~~~~~~~~~~~H~~g   25 (35)
T smart00451        2 GGFYCKLCNVTFTDEISVEAHLKG   25 (35)
T ss_pred             cCeEccccCCccCCHHHHHHHHCh
Confidence            357788888888888888888764


No 58 
>cd00350 rubredoxin_like Rubredoxin_like; nonheme iron binding domain containing a [Fe(SCys)4] center. The family includes rubredoxins, a small electron transfer protein, and a slightly smaller modular rubredoxin domain present in rubrerythrin and nigerythrin and detected either N- or C-terminal to such proteins as flavin reductase, NAD(P)H-nitrite reductase, and ferredoxin-thioredoxin reductase. In rubredoxin, the iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), but iron can also be replaced by cobalt, nickel or zinc and believed to be involved in electron transfer.  Rubrerythrins and nigerythrins are small homodimeric proteins, generally consisting of 2 domains: a rubredoxin domain C-terminal to a non-sulfur, oxo-bridged diiron site in the N-terminal rubrerythrin domain.  Rubrerythrins and nigerythrins have putative peroxide activity.
Probab=94.34  E-value=0.026  Score=29.24  Aligned_cols=11  Identities=45%  Similarity=1.156  Sum_probs=6.6

Q ss_pred             eeCCCCCCccC
Q psy12030        177 FACNVCGKGYR  187 (245)
Q Consensus       177 ~~C~~C~~~f~  187 (245)
                      |.|.+||..+.
T Consensus         2 ~~C~~CGy~y~   12 (33)
T cd00350           2 YVCPVCGYIYD   12 (33)
T ss_pred             EECCCCCCEEC
Confidence            56666665544


No 59 
>KOG2482|consensus
Probab=94.10  E-value=0.065  Score=43.11  Aligned_cols=24  Identities=25%  Similarity=0.582  Sum_probs=21.8

Q ss_pred             ceecccccccccChhHHhcchhcc
Q psy12030         69 GFECQVCGKRYKYKRGLHRHKQDE   92 (245)
Q Consensus        69 ~~~C~~C~~~f~~~~~l~~H~~~h   92 (245)
                      .+.|-.|.+.|.++..|+.||+..
T Consensus       195 r~~CLyCekifrdkntLkeHMrkK  218 (423)
T KOG2482|consen  195 RLRCLYCEKIFRDKNTLKEHMRKK  218 (423)
T ss_pred             hheeeeeccccCCcHHHHHHHHhc
Confidence            489999999999999999999864


No 60 
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only]
Probab=93.86  E-value=0.06  Score=43.37  Aligned_cols=74  Identities=20%  Similarity=0.364  Sum_probs=46.5

Q ss_pred             cCCCCCCcCCChHHHHhhhcCCCCc-eeCCCCCC----ccCChhHHHHHHhHHhCCCCCcccCC--Cc----ccCCChHH
Q psy12030        152 QCPHCPHRAKHKANLKTHIAPQLGV-FACNVCGK----GYRYKTGLYRHKREECGQEPKYQCPH--CP----HKAKHKAN  220 (245)
Q Consensus       152 ~C~~C~~~f~~~~~l~~H~~~h~~~-~~C~~C~~----~f~~~~~l~~H~~~h~~~~~~~~C~~--C~----~~f~~~~~  220 (245)
                      .|..|...|.....|.+|++..+.. |.|+.=+.    -|.+...|..|.+.-     .|.|..  |-    .+|.+...
T Consensus       222 ~C~FC~~~FYdDDEL~~HcR~~HE~ChICD~v~p~~~QYFK~Y~~Le~HF~~~-----hy~ct~qtc~~~k~~vf~~~~e  296 (493)
T COG5236         222 LCIFCKIYFYDDDELRRHCRLRHEACHICDMVGPIRYQYFKSYEDLEAHFRNA-----HYCCTFQTCRVGKCYVFPYHTE  296 (493)
T ss_pred             hhhhccceecChHHHHHHHHhhhhhhhhhhccCccchhhhhCHHHHHHHhhcC-----ceEEEEEEEecCcEEEeccHHH
Confidence            4777777777777777776654443 44443222    366667777776532     366643  42    36788888


Q ss_pred             HHHhHhhhCC
Q psy12030        221 LKTHIAIKHS  230 (245)
Q Consensus       221 l~~H~~~~~~  230 (245)
                      |..|+-..|+
T Consensus       297 l~~h~~~~h~  306 (493)
T COG5236         297 LLEHLTRFHK  306 (493)
T ss_pred             HHHHHHHHhh
Confidence            8888877775


No 61 
>COG5048 FOG: Zn-finger [General function prediction only]
Probab=93.76  E-value=0.019  Score=48.76  Aligned_cols=119  Identities=19%  Similarity=0.296  Sum_probs=85.9

Q ss_pred             ccccCcCCCccCchhHHHhHHh--hhcCCC--CCccCC--CCCCcCCChHHHHhhhcCCCCc--eeCC------------
Q psy12030        121 MFACDVCGKEYKYKRGLYRHKK--FECGQE--PKYQCP--HCPHRAKHKANLKTHIAPQLGV--FACN------------  180 (245)
Q Consensus       121 ~~~C~~C~~~f~~~~~l~~H~~--~h~~~~--~~~~C~--~C~~~f~~~~~l~~H~~~h~~~--~~C~------------  180 (245)
                      .+.|..|...|.....|..|.+  .|.+ +  +++.|+  .|++.|.....+..|...|.+.  +.+.            
T Consensus       289 ~~~~~~~~~~~s~~~~l~~~~~~~~h~~-~~~~~~~~p~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  367 (467)
T COG5048         289 PIKSKQCNISFSRSSPLTRHLRSVNHSG-ESLKPFSCPYSLCGKLFSRNDALKRHILLHTSISPAKEKLLNSSSKFSPLL  367 (467)
T ss_pred             CCCCccccCCcccccccccccccccccc-ccCCceeeeccCCCccccccccccCCcccccCCCccccccccCcccccccc
Confidence            5889999999999999999999  7877 6  899999  7999999999999998777653  2211            


Q ss_pred             -------------------------CCCCccCChhHHHHHHhHHhCCCC--CcccCCCcccCCChHHHHHhHhhhCCCCC
Q psy12030        181 -------------------------VCGKGYRYKTGLYRHKREECGQEP--KYQCPHCPHKAKHKANLKTHIAIKHSDRI  233 (245)
Q Consensus       181 -------------------------~C~~~f~~~~~l~~H~~~h~~~~~--~~~C~~C~~~f~~~~~l~~H~~~~~~~~~  233 (245)
                                               .|...+.....+..|...+.. ..  .+.+..|++.+.....+..|++.+....+
T Consensus       368 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  446 (467)
T COG5048         368 NNEPPQSLQQYKDLKNDKKSETLSNSCIRNFKRDSNLSLHIITHLS-FRPYNCKNPPCSKSFNRHYNLIPHKKIHTNHAP  446 (467)
T ss_pred             CCCCccchhhccCccCCccccccccchhhhhccccccccccccccc-cCCcCCCCCcchhhccCcccccccccccccCCc
Confidence                                     133333444444444444333 22  46677899999999999999888887777


Q ss_pred             CCCCCCCc
Q psy12030        234 LPPQEGRV  241 (245)
Q Consensus       234 ~~C~~C~~  241 (245)
                      +.|..++.
T Consensus       447 ~~~~~~~~  454 (467)
T COG5048         447 LLCSILKS  454 (467)
T ss_pred             eeeccccc
Confidence            76665554


No 62 
>PF12013 DUF3505:  Protein of unknown function (DUF3505);  InterPro: IPR022698  This family of proteins is functionally uncharacterised. This protein is found in eukaryotes. Proteins in this family are typically between 247 to 1018 amino acids in length. This region contains two segments that are likely to be C2H2 zinc binding domains. 
Probab=93.69  E-value=0.18  Score=34.21  Aligned_cols=25  Identities=32%  Similarity=0.814  Sum_probs=23.8

Q ss_pred             ccc----CCCcccCCChHHHHHhHhhhCC
Q psy12030        206 YQC----PHCPHKAKHKANLKTHIAIKHS  230 (245)
Q Consensus       206 ~~C----~~C~~~f~~~~~l~~H~~~~~~  230 (245)
                      |.|    +.|++.+.+...+.+|++.+||
T Consensus        81 ~~C~~~~~~C~y~~~~~~~m~~H~~~~Hg  109 (109)
T PF12013_consen   81 YRCQCDPPHCGYITRSKKTMRKHWRKEHG  109 (109)
T ss_pred             eeeecCCCCCCcEeccHHHHHHHHHHhcC
Confidence            999    9999999999999999999986


No 63 
>KOG1146|consensus
Probab=93.20  E-value=0.0068  Score=56.79  Aligned_cols=29  Identities=17%  Similarity=0.260  Sum_probs=22.0

Q ss_pred             CCCcccCCCcccCCChHHHHHhHhhhCCCC
Q psy12030        203 EPKYQCPHCPHKAKHKANLKTHIAIKHSDR  232 (245)
Q Consensus       203 ~~~~~C~~C~~~f~~~~~l~~H~~~~~~~~  232 (245)
                      -.+| |+.|...|.....|..||++.+++.
T Consensus      1327 ~~~~-c~~c~~~~~~~~alqihm~~~~~~~ 1355 (1406)
T KOG1146|consen 1327 CTYH-CLACEVLLSGREALQIHMRSSAHRR 1355 (1406)
T ss_pred             cccc-chHHHhhcchhHHHHHHHHHhhhcc
Confidence            3345 8888888888888888888766544


No 64 
>KOG2785|consensus
Probab=92.99  E-value=0.26  Score=40.44  Aligned_cols=52  Identities=19%  Similarity=0.324  Sum_probs=42.0

Q ss_pred             eeCCCCCCccCChhHHHHHHhHHhCC----------------------CCCcccCCCc---ccCCChHHHHHhHhhh
Q psy12030        177 FACNVCGKGYRYKTGLYRHKREECGQ----------------------EPKYQCPHCP---HKAKHKANLKTHIAIK  228 (245)
Q Consensus       177 ~~C~~C~~~f~~~~~l~~H~~~h~~~----------------------~~~~~C~~C~---~~f~~~~~l~~H~~~~  228 (245)
                      -.|-.|+..+.+...-..|+..+||=                      ..-+.|-.|+   +.|.+..+.++||...
T Consensus       167 t~CLfC~~~~k~~e~~~~HM~~~HgffIPdreYL~D~~GLl~YLgeKV~~~~~CL~CN~~~~~f~sleavr~HM~~K  243 (390)
T KOG2785|consen  167 TDCLFCDKKSKSLEENLKHMFKEHGFFIPDREYLTDEKGLLKYLGEKVGIGFICLFCNELGRPFSSLEAVRAHMRDK  243 (390)
T ss_pred             cceeecCCCcccHHHHHHHHhhccCCcCCchHhhhchhHHHHHHHHHhccCceEEEeccccCcccccHHHHHHHhhc
Confidence            56888999999998899999988871                      2347788888   8899999999998754


No 65 
>COG4049 Uncharacterized protein containing archaeal-type C2H2 Zn-finger [General function prediction only]
Probab=92.80  E-value=0.044  Score=31.52  Aligned_cols=27  Identities=22%  Similarity=0.536  Sum_probs=13.9

Q ss_pred             CCCcccCCCcccCCChHHHHHhHhhhC
Q psy12030        203 EPKYQCPHCPHKAKHKANLKTHIAIKH  229 (245)
Q Consensus       203 ~~~~~C~~C~~~f~~~~~l~~H~~~~~  229 (245)
                      |--+.||.||..|....++.+|....|
T Consensus        15 E~~lrCPRC~~~FR~~K~Y~RHVNKaH   41 (65)
T COG4049          15 EEFLRCPRCGMVFRRRKDYIRHVNKAH   41 (65)
T ss_pred             ceeeeCCchhHHHHHhHHHHHHhhHHh
Confidence            444555555555555555555554444


No 66 
>PF10571 UPF0547:  Uncharacterised protein family UPF0547;  InterPro: IPR018886  This domain may well be a type of zinc-finger as it carries two pairs of highly conserved cysteine residues though with no accompanying histidines. Several members are annotated as putative helicases. 
Probab=92.73  E-value=0.1  Score=25.36  Aligned_cols=12  Identities=8%  Similarity=-0.482  Sum_probs=7.8

Q ss_pred             CCCCCCCccccC
Q psy12030        234 LPPQEGRVWTRA  245 (245)
Q Consensus       234 ~~C~~C~~~f~~  245 (245)
                      -.|+.||+.|.+
T Consensus        15 ~~Cp~CG~~F~~   26 (26)
T PF10571_consen   15 KFCPHCGYDFEA   26 (26)
T ss_pred             CcCCCCCCCCcC
Confidence            347777777754


No 67 
>COG5048 FOG: Zn-finger [General function prediction only]
Probab=92.72  E-value=0.029  Score=47.66  Aligned_cols=62  Identities=24%  Similarity=0.419  Sum_probs=56.3

Q ss_pred             ceeCCCCCCccCChhHHHHHHh--HHhCCC--CCcccC--CCcccCCChHHHHHhHhhhCCCCCCCCCC
Q psy12030        176 VFACNVCGKGYRYKTGLYRHKR--EECGQE--PKYQCP--HCPHKAKHKANLKTHIAIKHSDRILPPQE  238 (245)
Q Consensus       176 ~~~C~~C~~~f~~~~~l~~H~~--~h~~~~--~~~~C~--~C~~~f~~~~~l~~H~~~~~~~~~~~C~~  238 (245)
                      ++.|..|...|.....|..|.+  .|.+ +  +|+.|+  .|++.|.....+..|...|.+..++.+..
T Consensus       289 ~~~~~~~~~~~s~~~~l~~~~~~~~h~~-~~~~~~~~p~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  356 (467)
T COG5048         289 PIKSKQCNISFSRSSPLTRHLRSVNHSG-ESLKPFSCPYSLCGKLFSRNDALKRHILLHTSISPAKEKL  356 (467)
T ss_pred             CCCCccccCCcccccccccccccccccc-ccCCceeeeccCCCccccccccccCCcccccCCCcccccc
Confidence            4789999999999999999999  7877 7  999999  79999999999999999999988877654


No 68 
>TIGR00622 ssl1 transcription factor ssl1. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=92.59  E-value=0.17  Score=34.20  Aligned_cols=79  Identities=16%  Similarity=0.215  Sum_probs=54.1

Q ss_pred             CCCccCCCCCCcCCChHHHHhhhcC--CCCc------------eeCCCCCCccCChhHHHHHHhHHhCCCCCcccCCCcc
Q psy12030        148 EPKYQCPHCPHRAKHKANLKTHIAP--QLGV------------FACNVCGKGYRYKTGLYRHKREECGQEPKYQCPHCPH  213 (245)
Q Consensus       148 ~~~~~C~~C~~~f~~~~~l~~H~~~--h~~~------------~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~~C~~C~~  213 (245)
                      +-|..|++||-...+...|.+-...  ...+            ..|-.|+..|........  ..-.. ...|.|+.|..
T Consensus        13 ~LP~~CpiCgLtLVss~HLARSyHHLfPl~~f~ev~~~~~~~~~~C~~C~~~f~~~~~~~~--~~~~~-~~~y~C~~C~~   89 (112)
T TIGR00622        13 ELPVECPICGLTLILSTHLARSYHHLFPLKAFQEIPLEEYNGSRFCFGCQGPFPKPPVSPF--DELKD-SHRYVCAVCKN   89 (112)
T ss_pred             CCCCcCCcCCCEEeccchHHHhhhccCCCcccccccccccCCCCcccCcCCCCCCcccccc--ccccc-ccceeCCCCCC
Confidence            6789999999999999998876321  0111            248889998876532110  00111 44699999999


Q ss_pred             cCCChHHHHHhHhhhC
Q psy12030        214 KAKHKANLKTHIAIKH  229 (245)
Q Consensus       214 ~f~~~~~l~~H~~~~~  229 (245)
                      .|-..-+.-.|...|.
T Consensus        90 ~FC~dCD~fiHe~Lh~  105 (112)
T TIGR00622        90 VFCVDCDVFVHESLHC  105 (112)
T ss_pred             ccccccchhhhhhccC
Confidence            9998888888876655


No 69 
>KOG2893|consensus
Probab=92.35  E-value=0.037  Score=42.16  Aligned_cols=41  Identities=24%  Similarity=0.433  Sum_probs=19.0

Q ss_pred             cCCCCcccccChHHHHHhc-CCccccCcCCCccCchhHHHhH
Q psy12030        100 QCPQCKDSFFSWSAFHKNL-SGMFACDVCGKEYKYKRGLYRH  140 (245)
Q Consensus       100 ~C~~C~~~f~~~~~l~~h~-~~~~~C~~C~~~f~~~~~l~~H  140 (245)
                      .|.+|++.|.+..-|..|. .+.|+|.+|.+.+.+...|..|
T Consensus        12 wcwycnrefddekiliqhqkakhfkchichkkl~sgpglsih   53 (341)
T KOG2893|consen   12 WCWYCNREFDDEKILIQHQKAKHFKCHICHKKLFSGPGLSIH   53 (341)
T ss_pred             eeeecccccchhhhhhhhhhhccceeeeehhhhccCCCceee
Confidence            3445555555444444444 2344455554444444444444


No 70 
>cd00729 rubredoxin_SM Rubredoxin, Small Modular nonheme iron binding domain containing a [Fe(SCys)4] center, present in rubrerythrin and nigerythrin and detected either N- or C-terminal to such proteins as flavin reductase, NAD(P)H-nitrite reductase, and ferredoxin-thioredoxin reductase. In rubredoxin, the iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), and  believed to be involved in electron transfer. Rubrerythrins and nigerythrins are small homodimeric proteins, generally consisting of 2 domains: a rubredoxin domain C-terminal to a non-sulfur, oxo-bridged diiron site in the N-terminal rubrerythrin domain. Rubrerythrins and nigerythrins have putative peroxide activity.
Probab=91.02  E-value=0.14  Score=26.74  Aligned_cols=10  Identities=30%  Similarity=0.816  Sum_probs=5.4

Q ss_pred             CCcccCCCcc
Q psy12030        204 PKYQCPHCPH  213 (245)
Q Consensus       204 ~~~~C~~C~~  213 (245)
                      .|..|++||.
T Consensus        17 ~p~~CP~Cg~   26 (34)
T cd00729          17 APEKCPICGA   26 (34)
T ss_pred             CCCcCcCCCC
Confidence            4455666653


No 71 
>COG2888 Predicted Zn-ribbon RNA-binding protein with a function in translation [Translation, ribosomal structure and biogenesis]
Probab=91.01  E-value=0.19  Score=29.45  Aligned_cols=8  Identities=50%  Similarity=1.593  Sum_probs=3.8

Q ss_pred             CcccCCCc
Q psy12030        205 KYQCPHCP  212 (245)
Q Consensus       205 ~~~C~~C~  212 (245)
                      +|.|+.||
T Consensus        50 ~Y~Cp~CG   57 (61)
T COG2888          50 PYRCPKCG   57 (61)
T ss_pred             ceECCCcC
Confidence            44444444


No 72 
>COG2888 Predicted Zn-ribbon RNA-binding protein with a function in translation [Translation, ribosomal structure and biogenesis]
Probab=90.90  E-value=0.24  Score=29.10  Aligned_cols=9  Identities=33%  Similarity=1.361  Sum_probs=4.0

Q ss_pred             ccCCCCccc
Q psy12030         99 YQCPQCKDS  107 (245)
Q Consensus        99 ~~C~~C~~~  107 (245)
                      |.|+.||+.
T Consensus        28 F~CPnCGe~   36 (61)
T COG2888          28 FPCPNCGEV   36 (61)
T ss_pred             eeCCCCCce
Confidence            444444433


No 73 
>TIGR02098 MJ0042_CXXC MJ0042 family finger-like domain. This domain contains a CXXCX(19)CXXC motif suggestive of both zinc fingers and thioredoxin, usually found at the N-terminus of prokaryotic proteins. One partially characterized gene, agmX, is among a large set in Myxococcus whose interruption affects adventurous gliding motility.
Probab=90.74  E-value=0.16  Score=27.13  Aligned_cols=12  Identities=17%  Similarity=0.725  Sum_probs=5.5

Q ss_pred             ecccccccccCh
Q psy12030         71 ECQVCGKRYKYK   82 (245)
Q Consensus        71 ~C~~C~~~f~~~   82 (245)
                      .|+.|+..|.-.
T Consensus         4 ~CP~C~~~~~v~   15 (38)
T TIGR02098         4 QCPNCKTSFRVV   15 (38)
T ss_pred             ECCCCCCEEEeC
Confidence            444454444433


No 74 
>COG4049 Uncharacterized protein containing archaeal-type C2H2 Zn-finger [General function prediction only]
Probab=90.74  E-value=0.079  Score=30.50  Aligned_cols=31  Identities=19%  Similarity=0.493  Sum_probs=25.7

Q ss_pred             ccCCCceecccccccccChhHHhcchhcccC
Q psy12030         64 QQYSKGFECQVCGKRYKYKRGLHRHKQDECG   94 (245)
Q Consensus        64 ~~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~   94 (245)
                      ..++..+.|+.||..|..+.++.+|....|+
T Consensus        12 RDGE~~lrCPRC~~~FR~~K~Y~RHVNKaH~   42 (65)
T COG4049          12 RDGEEFLRCPRCGMVFRRRKDYIRHVNKAHG   42 (65)
T ss_pred             cCCceeeeCCchhHHHHHhHHHHHHhhHHhh
Confidence            3456778999999999999999999876654


No 75 
>KOG2893|consensus
Probab=90.57  E-value=0.062  Score=40.99  Aligned_cols=47  Identities=21%  Similarity=0.487  Sum_probs=32.8

Q ss_pred             CCCCCCccCChhHHHHHHhHHhCCCCCcccCCCcccCCChHHHHHhHhhhCC
Q psy12030        179 CNVCGKGYRYKTGLYRHKREECGQEPKYQCPHCPHKAKHKANLKTHIAIKHS  230 (245)
Q Consensus       179 C~~C~~~f~~~~~l~~H~~~h~~~~~~~~C~~C~~~f~~~~~l~~H~~~~~~  230 (245)
                      |=+|++.|....-|.+|++     .|.|+|.+|-+..-+...|..|-...|.
T Consensus        13 cwycnrefddekiliqhqk-----akhfkchichkkl~sgpglsihcmqvhk   59 (341)
T KOG2893|consen   13 CWYCNREFDDEKILIQHQK-----AKHFKCHICHKKLFSGPGLSIHCMQVHK   59 (341)
T ss_pred             eeecccccchhhhhhhhhh-----hccceeeeehhhhccCCCceeehhhhhh
Confidence            5567788888777777765     3457888888777777777777544443


No 76 
>KOG4173|consensus
Probab=90.52  E-value=0.096  Score=39.06  Aligned_cols=46  Identities=26%  Similarity=0.478  Sum_probs=26.0

Q ss_pred             ccccCc--CCCccCchhHHHhHHhhhcCCCCCccCCCCCCcCCChHHHHhhh
Q psy12030        121 MFACDV--CGKEYKYKRGLYRHKKFECGQEPKYQCPHCPHRAKHKANLKTHI  170 (245)
Q Consensus       121 ~~~C~~--C~~~f~~~~~l~~H~~~h~~~~~~~~C~~C~~~f~~~~~l~~H~  170 (245)
                      .+.|..  |...|.+......|..+-|+    -.|..|.+.|.+...|..|+
T Consensus        79 ~~~cqvagc~~~~d~lD~~E~hY~~~h~----~sCs~C~r~~Pt~hLLd~HI  126 (253)
T KOG4173|consen   79 AFACQVAGCCQVFDALDDYEHHYHTLHG----NSCSFCKRAFPTGHLLDAHI  126 (253)
T ss_pred             cccccccchHHHHhhhhhHHHhhhhccc----chhHHHHHhCCchhhhhHHH
Confidence            355554  55566665556666555555    35666666666665555553


No 77 
>PF13717 zinc_ribbon_4:  zinc-ribbon domain
Probab=90.30  E-value=0.2  Score=26.45  Aligned_cols=8  Identities=38%  Similarity=1.186  Sum_probs=3.1

Q ss_pred             cccCcCCC
Q psy12030        122 FACDVCGK  129 (245)
Q Consensus       122 ~~C~~C~~  129 (245)
                      .+|+.|+.
T Consensus        26 v~C~~C~~   33 (36)
T PF13717_consen   26 VRCSKCGH   33 (36)
T ss_pred             EECCCCCC
Confidence            33444433


No 78 
>PHA00626 hypothetical protein
Probab=90.13  E-value=0.21  Score=28.85  Aligned_cols=14  Identities=21%  Similarity=0.489  Sum_probs=7.7

Q ss_pred             CceeCCCCCCccCC
Q psy12030        175 GVFACNVCGKGYRY  188 (245)
Q Consensus       175 ~~~~C~~C~~~f~~  188 (245)
                      ..|+|+.||+.|+.
T Consensus        22 nrYkCkdCGY~ft~   35 (59)
T PHA00626         22 DDYVCCDCGYNDSK   35 (59)
T ss_pred             cceEcCCCCCeech
Confidence            34666666655543


No 79 
>PF13719 zinc_ribbon_5:  zinc-ribbon domain
Probab=90.06  E-value=0.23  Score=26.45  Aligned_cols=9  Identities=33%  Similarity=0.940  Sum_probs=3.6

Q ss_pred             cccCcCCCc
Q psy12030        122 FACDVCGKE  130 (245)
Q Consensus       122 ~~C~~C~~~  130 (245)
                      .+|+.|+..
T Consensus        26 vrC~~C~~~   34 (37)
T PF13719_consen   26 VRCPKCGHV   34 (37)
T ss_pred             EECCCCCcE
Confidence            334444433


No 80 
>COG1592 Rubrerythrin [Energy production and conversion]
Probab=89.16  E-value=0.32  Score=35.53  Aligned_cols=22  Identities=41%  Similarity=0.907  Sum_probs=16.3

Q ss_pred             eeCCCCCCccCChhHHHHHHhHHhCCCCCcccCCCc
Q psy12030        177 FACNVCGKGYRYKTGLYRHKREECGQEPKYQCPHCP  212 (245)
Q Consensus       177 ~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~~C~~C~  212 (245)
                      |.|++||..+             -+ +.|-.||+||
T Consensus       135 ~vC~vCGy~~-------------~g-e~P~~CPiCg  156 (166)
T COG1592         135 WVCPVCGYTH-------------EG-EAPEVCPICG  156 (166)
T ss_pred             EEcCCCCCcc-------------cC-CCCCcCCCCC
Confidence            8888887653             25 7788888887


No 81 
>smart00659 RPOLCX RNA polymerase subunit CX. present in RNA polymerase I, II and III
Probab=89.14  E-value=0.22  Score=27.69  Aligned_cols=26  Identities=23%  Similarity=0.728  Sum_probs=15.5

Q ss_pred             eeCCCCCCccCChhHHHHHHhHHhCCCCCcccCCCccc
Q psy12030        177 FACNVCGKGYRYKTGLYRHKREECGQEPKYQCPHCPHK  214 (245)
Q Consensus       177 ~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~~C~~C~~~  214 (245)
                      |.|..||..|.-.           . ..+.+|+.||..
T Consensus         3 Y~C~~Cg~~~~~~-----------~-~~~irC~~CG~r   28 (44)
T smart00659        3 YICGECGRENEIK-----------S-KDVVRCRECGYR   28 (44)
T ss_pred             EECCCCCCEeecC-----------C-CCceECCCCCce
Confidence            6677777665532           1 345677777654


No 82 
>smart00531 TFIIE Transcription initiation factor IIE.
Probab=88.37  E-value=0.34  Score=34.87  Aligned_cols=35  Identities=31%  Similarity=0.854  Sum_probs=19.2

Q ss_pred             CCccCCCCcccccChHHHHH-hcCCccccCcCCCcc
Q psy12030         97 PKYQCPQCKDSFFSWSAFHK-NLSGMFACDVCGKEY  131 (245)
Q Consensus        97 ~~~~C~~C~~~f~~~~~l~~-h~~~~~~C~~C~~~f  131 (245)
                      ..|.|+.|+..|.....+.. ...+.|.|+.||...
T Consensus        98 ~~Y~Cp~C~~~y~~~ea~~~~d~~~~f~Cp~Cg~~l  133 (147)
T smart00531       98 AYYKCPNCQSKYTFLEANQLLDMDGTFTCPRCGEEL  133 (147)
T ss_pred             cEEECcCCCCEeeHHHHHHhcCCCCcEECCCCCCEE
Confidence            45666666666655444432 234446666666544


No 83 
>KOG2482|consensus
Probab=88.12  E-value=0.68  Score=37.53  Aligned_cols=24  Identities=25%  Similarity=0.412  Sum_probs=21.9

Q ss_pred             cccCCCcccCCChHHHHHhHhhhC
Q psy12030        206 YQCPHCPHKAKHKANLKTHIAIKH  229 (245)
Q Consensus       206 ~~C~~C~~~f~~~~~l~~H~~~~~  229 (245)
                      ..|-.|.....+...|..||++.|
T Consensus       280 v~CLfC~~~~en~~~l~eHmk~vH  303 (423)
T KOG2482|consen  280 VVCLFCTNFYENPVFLFEHMKIVH  303 (423)
T ss_pred             eEEEeeccchhhHHHHHHHHHHHH
Confidence            589999999899999999999887


No 84 
>PRK14890 putative Zn-ribbon RNA-binding protein; Provisional
Probab=87.85  E-value=0.41  Score=28.19  Aligned_cols=8  Identities=50%  Similarity=1.530  Sum_probs=3.8

Q ss_pred             CcccCCCc
Q psy12030        205 KYQCPHCP  212 (245)
Q Consensus       205 ~~~C~~C~  212 (245)
                      +|.|+.||
T Consensus        48 ~Y~CP~CG   55 (59)
T PRK14890         48 PYTCPKCG   55 (59)
T ss_pred             ceECCCCC
Confidence            44444444


No 85 
>KOG2186|consensus
Probab=87.71  E-value=0.28  Score=37.95  Aligned_cols=47  Identities=23%  Similarity=0.497  Sum_probs=33.0

Q ss_pred             cccCcCCCccCchhHHHhHHhhhcCCCCCccCCCCCCcCCChHHHHhhhcC
Q psy12030        122 FACDVCGKEYKYKRGLYRHKKFECGQEPKYQCPHCPHRAKHKANLKTHIAP  172 (245)
Q Consensus       122 ~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~~C~~C~~~f~~~~~l~~H~~~  172 (245)
                      |.|..||....- ..+..|+-+-++  ..|.|..|++.|.. ..+..|..-
T Consensus         4 FtCnvCgEsvKK-p~vekH~srCrn--~~fSCIDC~k~F~~-~sYknH~kC   50 (276)
T KOG2186|consen    4 FTCNVCGESVKK-PQVEKHMSRCRN--AYFSCIDCGKTFER-VSYKNHTKC   50 (276)
T ss_pred             Eehhhhhhhccc-cchHHHHHhccC--CeeEEeeccccccc-chhhhhhhh
Confidence            788888876544 446678766555  55888888888886 677777543


No 86 
>smart00834 CxxC_CXXC_SSSS Putative regulatory protein. CxxC_CXXC_SSSS represents a region of about 41 amino acids found in a number of small proteins in a wide range of bacteria. The region usually begins with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One protein in this entry has been noted as a putative regulatory protein, designated FmdB. Most proteins in this entry have a C-terminal region containing highly degenerate sequence.
Probab=87.26  E-value=0.16  Score=27.56  Aligned_cols=11  Identities=27%  Similarity=1.123  Sum_probs=6.5

Q ss_pred             eeCCCCCCccC
Q psy12030        177 FACNVCGKGYR  187 (245)
Q Consensus       177 ~~C~~C~~~f~  187 (245)
                      |.|..||..|.
T Consensus         6 y~C~~Cg~~fe   16 (41)
T smart00834        6 YRCEDCGHTFE   16 (41)
T ss_pred             EEcCCCCCEEE
Confidence            55666666554


No 87 
>COG1997 RPL43A Ribosomal protein L37AE/L43A [Translation, ribosomal structure and biogenesis]
Probab=87.25  E-value=0.51  Score=30.13  Aligned_cols=33  Identities=27%  Similarity=0.625  Sum_probs=22.2

Q ss_pred             CCccCCCCCCcCCChHHHHhhhcCCCCceeCCCCCCccCCh
Q psy12030        149 PKYQCPHCPHRAKHKANLKTHIAPQLGVFACNVCGKGYRYK  189 (245)
Q Consensus       149 ~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~C~~C~~~f~~~  189 (245)
                      ..|.|+.|++.        .+.+.-++.|.|..||..|.--
T Consensus        34 ~~~~Cp~C~~~--------~VkR~a~GIW~C~kCg~~fAGg   66 (89)
T COG1997          34 AKHVCPFCGRT--------TVKRIATGIWKCRKCGAKFAGG   66 (89)
T ss_pred             cCCcCCCCCCc--------ceeeeccCeEEcCCCCCeeccc
Confidence            35778888765        2345566678888888877643


No 88 
>TIGR02605 CxxC_CxxC_SSSS putative regulatory protein, FmdB family. This model represents a region of about 50 amino acids found in a number of small proteins in a wide range of bacteria. The region begins usually with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One member of this family is has been noted as a putative regulatory protein, designated FmdB (PubMed:8841393). Most members of this family have a C-terminal region containing highly degenerate sequence, such as SSTSESTKSSGSSGSSGSSESKASGSTEKSTSSTTAAAAV in Mycobacterium tuberculosis and VAVGGSAPAPSPAPRAGGGGGGCCGGGCCG in Streptomyces avermitilis. These low complexity regions, which are not included in the model, resemble low-complexity C-terminal regions of some heterocycle-containing bacteriocin precursors.
Probab=86.91  E-value=0.18  Score=29.10  Aligned_cols=29  Identities=24%  Similarity=0.810  Sum_probs=16.3

Q ss_pred             eeCCCCCCccCChhHHHHHHhHHhCCCCCcccCCCcc
Q psy12030        177 FACNVCGKGYRYKTGLYRHKREECGQEPKYQCPHCPH  213 (245)
Q Consensus       177 ~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~~C~~C~~  213 (245)
                      |.|..||..|.....+.       . +.+-.|+.||.
T Consensus         6 y~C~~Cg~~fe~~~~~~-------~-~~~~~CP~Cg~   34 (52)
T TIGR02605         6 YRCTACGHRFEVLQKMS-------D-DPLATCPECGG   34 (52)
T ss_pred             EEeCCCCCEeEEEEecC-------C-CCCCCCCCCCC
Confidence            67777777766432211       1 33456777775


No 89 
>PRK14890 putative Zn-ribbon RNA-binding protein; Provisional
Probab=86.23  E-value=0.6  Score=27.51  Aligned_cols=10  Identities=40%  Similarity=1.285  Sum_probs=4.9

Q ss_pred             CccCCCCccc
Q psy12030         98 KYQCPQCKDS  107 (245)
Q Consensus        98 ~~~C~~C~~~  107 (245)
                      .|.|+.||+.
T Consensus        25 ~F~CPnCG~~   34 (59)
T PRK14890         25 KFLCPNCGEV   34 (59)
T ss_pred             EeeCCCCCCe
Confidence            3455555544


No 90 
>PF09986 DUF2225:  Uncharacterized protein conserved in bacteria (DUF2225);  InterPro: IPR018708 This conserved bacterial family has no known function.
Probab=86.20  E-value=0.23  Score=38.20  Aligned_cols=13  Identities=23%  Similarity=0.562  Sum_probs=9.6

Q ss_pred             eeCCCCCCccCCh
Q psy12030        177 FACNVCGKGYRYK  189 (245)
Q Consensus       177 ~~C~~C~~~f~~~  189 (245)
                      +.|+.||.+|...
T Consensus        49 ~vCP~CgyA~~~~   61 (214)
T PF09986_consen   49 WVCPHCGYAAFEE   61 (214)
T ss_pred             EECCCCCCccccc
Confidence            6788888876644


No 91 
>KOG2186|consensus
Probab=85.87  E-value=0.48  Score=36.68  Aligned_cols=45  Identities=22%  Similarity=0.605  Sum_probs=24.4

Q ss_pred             ccCCCCCCcCCChHHHHhhhcCCCCc-eeCCCCCCccCChhHHHHHHh
Q psy12030        151 YQCPHCPHRAKHKANLKTHIAPQLGV-FACNVCGKGYRYKTGLYRHKR  197 (245)
Q Consensus       151 ~~C~~C~~~f~~~~~l~~H~~~h~~~-~~C~~C~~~f~~~~~l~~H~~  197 (245)
                      |.|.+||.+..- ..+.+|+-.-++. |.|-.||.+|.. .++..|..
T Consensus         4 FtCnvCgEsvKK-p~vekH~srCrn~~fSCIDC~k~F~~-~sYknH~k   49 (276)
T KOG2186|consen    4 FTCNVCGESVKK-PQVEKHMSRCRNAYFSCIDCGKTFER-VSYKNHTK   49 (276)
T ss_pred             Eehhhhhhhccc-cchHHHHHhccCCeeEEeeccccccc-chhhhhhh
Confidence            556666666553 3444455444443 666666666665 34445544


No 92 
>PF09538 FYDLN_acid:  Protein of unknown function (FYDLN_acid);  InterPro: IPR012644 Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues. The function of members of this family is unknown.
Probab=85.86  E-value=0.68  Score=31.34  Aligned_cols=15  Identities=20%  Similarity=0.521  Sum_probs=7.1

Q ss_pred             CCccCCCCCCcCCCh
Q psy12030        149 PKYQCPHCPHRAKHK  163 (245)
Q Consensus       149 ~~~~C~~C~~~f~~~  163 (245)
                      .|..|+.||..|.-.
T Consensus        25 ~PivCP~CG~~~~~~   39 (108)
T PF09538_consen   25 DPIVCPKCGTEFPPE   39 (108)
T ss_pred             CCccCCCCCCccCcc
Confidence            344455555544433


No 93 
>COG5151 SSL1 RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, subunit SSL1 [Transcription / DNA replication, recombination, and repair]
Probab=85.59  E-value=0.73  Score=36.83  Aligned_cols=79  Identities=14%  Similarity=0.313  Sum_probs=39.6

Q ss_pred             ccccCcCCCccCchhHHHhHHhhhc----------C-CCCCccCCCCCCcCCChHHHHhhhcCCCCceeCCCCCCccCCh
Q psy12030        121 MFACDVCGKEYKYKRGLYRHKKFEC----------G-QEPKYQCPHCPHRAKHKANLKTHIAPQLGVFACNVCGKGYRYK  189 (245)
Q Consensus       121 ~~~C~~C~~~f~~~~~l~~H~~~h~----------~-~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~C~~C~~~f~~~  189 (245)
                      |..|+.|+........|.+-...--          + +-+.-.|-.|.-.|.-...-..-..+-.+.|.|+.|...|-..
T Consensus       322 Pi~CP~Csl~LilsthLarSyhhL~PLk~f~E~p~~~~~ks~~Cf~CQ~~fp~~~~~~~~~~~ss~rY~Ce~CK~~FC~d  401 (421)
T COG5151         322 PISCPICSLQLILSTHLARSYHHLYPLKPFVEKPEGTNPKSTHCFVCQGPFPKPPVSPFDESTSSGRYQCELCKSTFCSD  401 (421)
T ss_pred             CccCcchhHHHHHHHHHHHHHHhhccCcccccccCCCCCCCccceeccCCCCCCCCCcccccccccceechhhhhhhhhh
Confidence            4567777666555544443322110          1 0112235556555554322111122233447777777777777


Q ss_pred             hHHHHHHhHH
Q psy12030        190 TGLYRHKREE  199 (245)
Q Consensus       190 ~~l~~H~~~h  199 (245)
                      -+...|...|
T Consensus       402 CdvfiHe~Lh  411 (421)
T COG5151         402 CDVFIHETLH  411 (421)
T ss_pred             hHHHHHHHHh
Confidence            7777776655


No 94 
>KOG4173|consensus
Probab=85.29  E-value=0.3  Score=36.53  Aligned_cols=75  Identities=24%  Similarity=0.448  Sum_probs=51.0

Q ss_pred             ceeccc--ccccccChhHHhcchhcccCCCCCccCCCCcccccChHHHHHhcCCccccCcCCCccCchhHHHhHHhhhcC
Q psy12030         69 GFECQV--CGKRYKYKRGLHRHKQDECGQEPKYQCPQCKDSFFSWSAFHKNLSGMFACDVCGKEYKYKRGLYRHKKFECG  146 (245)
Q Consensus        69 ~~~C~~--C~~~f~~~~~l~~H~~~h~~~~~~~~C~~C~~~f~~~~~l~~h~~~~~~C~~C~~~f~~~~~l~~H~~~h~~  146 (245)
                      .+.|++  |...|........|...-|+                           ..|..|.+.|.+...|..|+...|.
T Consensus        79 ~~~cqvagc~~~~d~lD~~E~hY~~~h~---------------------------~sCs~C~r~~Pt~hLLd~HI~E~HD  131 (253)
T KOG4173|consen   79 AFACQVAGCCQVFDALDDYEHHYHTLHG---------------------------NSCSFCKRAFPTGHLLDAHILEWHD  131 (253)
T ss_pred             cccccccchHHHHhhhhhHHHhhhhccc---------------------------chhHHHHHhCCchhhhhHHHHHHHH
Confidence            366766  66777777777777666555                           4677888888888888888765432


Q ss_pred             ---------CCCCccCCC--CCCcCCChHHHHhhh
Q psy12030        147 ---------QEPKYQCPH--CPHRAKHKANLKTHI  170 (245)
Q Consensus       147 ---------~~~~~~C~~--C~~~f~~~~~l~~H~  170 (245)
                               +..-|.|-+  |+..|.+...-+.|+
T Consensus       132 s~Fqa~veRG~dMy~ClvEgCt~KFkT~r~RkdH~  166 (253)
T KOG4173|consen  132 SLFQALVERGQDMYQCLVEGCTEKFKTSRDRKDHM  166 (253)
T ss_pred             HHHHHHHHcCccHHHHHHHhhhhhhhhhhhhhhHH
Confidence                     133467743  777777777777774


No 95 
>PF02892 zf-BED:  BED zinc finger;  InterPro: IPR003656 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents predicted BED-type zinc finger domains. The BED finger which was named after the Drosophila proteins BEAF and DREF, is found in one or more copies in cellular regulatory factors and transposases from plants, animals and fungi. The BED finger is an about 50 to 60 amino acid residues domain that contains a characteristic motif with two highly conserved aromatic positions, as well as a shared pattern of cysteines and histidines that is predicted to form a zinc finger. As diverse BED fingers are able to bind DNA, it has been suggested that DNA-binding is the general function of this domain []. Some proteins known to contain a BED domain include animal, plant and fungi AC1 and Hobo-like transposases; Caenorhabditis elegans Dpy-20 protein, a predicted cuticular gene transcriptional regulator; Drosophila BEAF (boundary element-associated factor), thought to be involved in chromatin insulation; Drosophila DREF, a transcriptional regulator for S-phase genes; and tobacco 3AF1 and tomato E4/E8-BP1, light- and ethylene-regulated DNA binding proteins that contain two BED fingers. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003677 DNA binding; PDB: 2DJR_A 2CT5_A.
Probab=85.19  E-value=0.79  Score=25.34  Aligned_cols=26  Identities=35%  Similarity=0.543  Sum_probs=15.2

Q ss_pred             CCCcccCCCcccCCCh----HHHHHhHhhh
Q psy12030        203 EPKYQCPHCPHKAKHK----ANLKTHIAIK  228 (245)
Q Consensus       203 ~~~~~C~~C~~~f~~~----~~l~~H~~~~  228 (245)
                      .....|.+|++.+...    +.|..|++..
T Consensus        14 ~~~a~C~~C~~~~~~~~~~ts~l~~HL~~~   43 (45)
T PF02892_consen   14 KKKAKCKYCGKVIKYSSGGTSNLKRHLKKK   43 (45)
T ss_dssp             SS-EEETTTTEE-----SSTHHHHHHHHHT
T ss_pred             cCeEEeCCCCeEEeeCCCcHHHHHHhhhhh
Confidence            5557788888777663    7788887543


No 96 
>PF03604 DNA_RNApol_7kD:  DNA directed RNA polymerase, 7 kDa subunit;  InterPro: IPR006591 DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Each class of RNA polymerase is assembled from 9 to 15 different polypeptides. Rbp10 (RNA polymerase CX) is a domain found in RNA polymerase subunit 10; present in RNA polymerase I, II and III.; GO: 0003677 DNA binding, 0003899 DNA-directed RNA polymerase activity, 0006351 transcription, DNA-dependent; PDB: 2PMZ_Z 3HKZ_X 2NVX_L 3S1Q_L 2JA6_L 3S17_L 3HOW_L 3HOV_L 3PO2_L 3HOZ_L ....
Probab=84.35  E-value=0.7  Score=23.69  Aligned_cols=10  Identities=40%  Similarity=1.275  Sum_probs=5.0

Q ss_pred             CcccCCCccc
Q psy12030        205 KYQCPHCPHK  214 (245)
Q Consensus       205 ~~~C~~C~~~  214 (245)
                      +.+|+.||..
T Consensus        17 ~irC~~CG~R   26 (32)
T PF03604_consen   17 PIRCPECGHR   26 (32)
T ss_dssp             TSSBSSSS-S
T ss_pred             cEECCcCCCe
Confidence            4556666544


No 97 
>TIGR00373 conserved hypothetical protein TIGR00373. This family of proteins is, so far, restricted to archaeal genomes. The family appears to be distantly related to the N-terminal region of the eukaryotic transcription initiation factor IIE alpha chain.
Probab=84.23  E-value=1.2  Score=32.42  Aligned_cols=16  Identities=13%  Similarity=0.480  Sum_probs=8.4

Q ss_pred             eeCCCCCCccCChhHH
Q psy12030        177 FACNVCGKGYRYKTGL  192 (245)
Q Consensus       177 ~~C~~C~~~f~~~~~l  192 (245)
                      |.|+.|+..|+....+
T Consensus       110 Y~Cp~c~~r~tf~eA~  125 (158)
T TIGR00373       110 FICPNMCVRFTFNEAM  125 (158)
T ss_pred             EECCCCCcEeeHHHHH
Confidence            5555555555544444


No 98 
>PRK06266 transcription initiation factor E subunit alpha; Validated
Probab=84.19  E-value=0.6  Score=34.77  Aligned_cols=28  Identities=21%  Similarity=0.746  Sum_probs=16.3

Q ss_pred             eeCCCCCCccCChhHHHHHHhHHhCCCCCcccCCCccc
Q psy12030        177 FACNVCGKGYRYKTGLYRHKREECGQEPKYQCPHCPHK  214 (245)
Q Consensus       177 ~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~~C~~C~~~  214 (245)
                      |.|+.|+..|+....+.          ..|.|+.||-.
T Consensus       118 Y~Cp~C~~rytf~eA~~----------~~F~Cp~Cg~~  145 (178)
T PRK06266        118 FFCPNCHIRFTFDEAME----------YGFRCPQCGEM  145 (178)
T ss_pred             EECCCCCcEEeHHHHhh----------cCCcCCCCCCC
Confidence            66666666666554431          23666666654


No 99 
>COG1592 Rubrerythrin [Energy production and conversion]
Probab=83.57  E-value=0.83  Score=33.41  Aligned_cols=23  Identities=13%  Similarity=0.192  Sum_probs=19.9

Q ss_pred             CcccCCCcccCCChHHHHHhHhhhCCCCCCCCCCCC
Q psy12030        205 KYQCPHCPHKAKHKANLKTHIAIKHSDRILPPQEGR  240 (245)
Q Consensus       205 ~~~C~~C~~~f~~~~~l~~H~~~~~~~~~~~C~~C~  240 (245)
                      -|.|++||..             +-|+.|-.||+||
T Consensus       134 ~~vC~vCGy~-------------~~ge~P~~CPiCg  156 (166)
T COG1592         134 VWVCPVCGYT-------------HEGEAPEVCPICG  156 (166)
T ss_pred             EEEcCCCCCc-------------ccCCCCCcCCCCC
Confidence            5999999965             4568999999999


No 100
>KOG2807|consensus
Probab=83.04  E-value=2.1  Score=34.59  Aligned_cols=23  Identities=13%  Similarity=0.521  Sum_probs=16.8

Q ss_pred             eeCCCCCCccCChhHHHHHHhHH
Q psy12030        177 FACNVCGKGYRYKTGLYRHKREE  199 (245)
Q Consensus       177 ~~C~~C~~~f~~~~~l~~H~~~h  199 (245)
                      |.|..|...|-..-+...|...|
T Consensus       346 y~C~~Ck~~FCldCDv~iHesLh  368 (378)
T KOG2807|consen  346 YRCESCKNVFCLDCDVFIHESLH  368 (378)
T ss_pred             EEchhccceeeccchHHHHhhhh
Confidence            77777877777777777766555


No 101
>COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair]
Probab=82.74  E-value=1  Score=41.01  Aligned_cols=24  Identities=13%  Similarity=0.115  Sum_probs=15.4

Q ss_pred             CCCcccCCCcccCCChHHHHHhHhhhCCCCCCCCCCCCc
Q psy12030        203 EPKYQCPHCPHKAKHKANLKTHIAIKHSDRILPPQEGRV  241 (245)
Q Consensus       203 ~~~~~C~~C~~~f~~~~~l~~H~~~~~~~~~~~C~~C~~  241 (245)
                      .....|.+||               ++...|..|+.||-
T Consensus       460 ~~~L~CH~Cg---------------~~~~~p~~Cp~Cgs  483 (730)
T COG1198         460 TGQLRCHYCG---------------YQEPIPQSCPECGS  483 (730)
T ss_pred             CCeeEeCCCC---------------CCCCCCCCCCCCCC
Confidence            3456777777               34456777777773


No 102
>PF09538 FYDLN_acid:  Protein of unknown function (FYDLN_acid);  InterPro: IPR012644 Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues. The function of members of this family is unknown.
Probab=82.09  E-value=1  Score=30.42  Aligned_cols=30  Identities=20%  Similarity=0.532  Sum_probs=22.0

Q ss_pred             eeCCCCCCccCChhHHHHHHhHHhCCCCCcccCCCcccCCCh
Q psy12030        177 FACNVCGKGYRYKTGLYRHKREECGQEPKYQCPHCPHKAKHK  218 (245)
Q Consensus       177 ~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~~C~~C~~~f~~~  218 (245)
                      ..|+.||..|..-           + ..|..||+||..|.-.
T Consensus        10 R~Cp~CG~kFYDL-----------n-k~PivCP~CG~~~~~~   39 (108)
T PF09538_consen   10 RTCPSCGAKFYDL-----------N-KDPIVCPKCGTEFPPE   39 (108)
T ss_pred             ccCCCCcchhccC-----------C-CCCccCCCCCCccCcc
Confidence            5688888887642           2 4678888888887765


No 103
>PF06524 NOA36:  NOA36 protein;  InterPro: IPR010531 This family consists of several NOA36 proteins which contain 29 highly conserved cysteine residues. The function of this protein is unknown.; GO: 0008270 zinc ion binding, 0005634 nucleus
Probab=82.03  E-value=0.91  Score=35.36  Aligned_cols=26  Identities=15%  Similarity=0.424  Sum_probs=15.9

Q ss_pred             CCCccCCCCCCcCCChHHHHhhhcCC
Q psy12030        148 EPKYQCPHCPHRAKHKANLKTHIAPQ  173 (245)
Q Consensus       148 ~~~~~C~~C~~~f~~~~~l~~H~~~h  173 (245)
                      .+++.|+.|+........|..-.++|
T Consensus       207 ~k~~PCPKCg~et~eTkdLSmStR~h  232 (314)
T PF06524_consen  207 GKPIPCPKCGYETQETKDLSMSTRSH  232 (314)
T ss_pred             CCCCCCCCCCCcccccccceeeeecc
Confidence            35667777776666666665554444


No 104
>smart00614 ZnF_BED BED zinc finger. DNA-binding domain in chromatin-boundary-element-binding proteins and transposases
Probab=81.58  E-value=1.3  Score=25.22  Aligned_cols=21  Identities=29%  Similarity=0.649  Sum_probs=11.3

Q ss_pred             cccCCCcccCCCh-----HHHHHhHh
Q psy12030        206 YQCPHCPHKAKHK-----ANLKTHIA  226 (245)
Q Consensus       206 ~~C~~C~~~f~~~-----~~l~~H~~  226 (245)
                      -.|.+|++.+...     +.|.+|++
T Consensus        19 a~C~~C~~~l~~~~~~gTs~L~rHl~   44 (50)
T smart00614       19 AKCKYCGKKLSRSSKGGTSNLRRHLR   44 (50)
T ss_pred             EEecCCCCEeeeCCCCCcHHHHHHHH
Confidence            3455555555433     46666665


No 105
>PRK09678 DNA-binding transcriptional regulator; Provisional
Probab=81.56  E-value=0.39  Score=29.79  Aligned_cols=41  Identities=22%  Similarity=0.428  Sum_probs=25.2

Q ss_pred             eeCCCCCCccCChhHHHHHHhHHhCCCCCcccC--CCcccCCChHH
Q psy12030        177 FACNVCGKGYRYKTGLYRHKREECGQEPKYQCP--HCPHKAKHKAN  220 (245)
Q Consensus       177 ~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~~C~--~C~~~f~~~~~  220 (245)
                      +.|+.||....-...-.....  .. +.-+.|.  .||.+|.....
T Consensus         2 m~CP~Cg~~a~irtSr~~s~~--~~-~~Y~qC~N~eCg~tF~t~es   44 (72)
T PRK09678          2 FHCPLCQHAAHARTSRYITDT--TK-ERYHQCQNVNCSATFITYES   44 (72)
T ss_pred             ccCCCCCCccEEEEChhcChh--hh-eeeeecCCCCCCCEEEEEEE
Confidence            468888876644444333322  22 6778887  78888876543


No 106
>smart00531 TFIIE Transcription initiation factor IIE.
Probab=81.52  E-value=0.94  Score=32.60  Aligned_cols=34  Identities=18%  Similarity=0.590  Sum_probs=17.3

Q ss_pred             eeCCCCCCccCChhHHHHHHhHHhCCCCCcccCCCcccC
Q psy12030        177 FACNVCGKGYRYKTGLYRHKREECGQEPKYQCPHCPHKA  215 (245)
Q Consensus       177 ~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~~C~~C~~~f  215 (245)
                      |.|+.|+..|.....+.. .  . . ...|.||.||...
T Consensus       100 Y~Cp~C~~~y~~~ea~~~-~--d-~-~~~f~Cp~Cg~~l  133 (147)
T smart00531      100 YKCPNCQSKYTFLEANQL-L--D-M-DGTFTCPRCGEEL  133 (147)
T ss_pred             EECcCCCCEeeHHHHHHh-c--C-C-CCcEECCCCCCEE
Confidence            677777766664333221 0  0 1 2236777776543


No 107
>PRK04023 DNA polymerase II large subunit; Validated
Probab=80.03  E-value=2.5  Score=39.67  Aligned_cols=9  Identities=33%  Similarity=1.091  Sum_probs=5.6

Q ss_pred             ccCCCCCCc
Q psy12030        151 YQCPHCPHR  159 (245)
Q Consensus       151 ~~C~~C~~~  159 (245)
                      ..|+.||..
T Consensus       627 RfCpsCG~~  635 (1121)
T PRK04023        627 RKCPSCGKE  635 (1121)
T ss_pred             ccCCCCCCc
Confidence            456666665


No 108
>PF09986 DUF2225:  Uncharacterized protein conserved in bacteria (DUF2225);  InterPro: IPR018708 This conserved bacterial family has no known function.
Probab=78.94  E-value=2.6  Score=32.46  Aligned_cols=57  Identities=16%  Similarity=0.239  Sum_probs=33.1

Q ss_pred             cccccccceeeeeecccCcceeeeeccCCCCCCcccccccccCCCCCccccccCCCceecccccccccCh
Q psy12030         13 NKIMPVCLYAMFVEKSTNTKMEFIAIRNSNVDKSLNTNVLNAHGFNIWPLVQQYSKGFECQVCGKRYKYK   82 (245)
Q Consensus        13 ~~~~~~c~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~C~~C~~~f~~~   82 (245)
                      ...||.|+..|.+................     +...+...+        .---....|+.||.+|...
T Consensus         5 ~~~CPvC~~~F~~~~vrs~~~r~~~~d~D-----~~~~Y~~vn--------P~~Y~V~vCP~CgyA~~~~   61 (214)
T PF09986_consen    5 KITCPVCGKEFKTKKVRSGKIRVIRRDSD-----FCPRYKGVN--------PLFYEVWVCPHCGYAAFEE   61 (214)
T ss_pred             ceECCCCCCeeeeeEEEcCCceEeeecCC-----CccccCCCC--------CeeeeEEECCCCCCccccc
Confidence            34789999999998777776665532221     111111100        0011347899999886654


No 109
>COG1996 RPC10 DNA-directed RNA polymerase, subunit RPC10 (contains C4-type Zn-finger) [Transcription]
Probab=78.85  E-value=0.98  Score=25.61  Aligned_cols=27  Identities=22%  Similarity=0.667  Sum_probs=16.9

Q ss_pred             eeCCCCCCccCChhHHHHHHhHHhCCCCCcccCCCccc
Q psy12030        177 FACNVCGKGYRYKTGLYRHKREECGQEPKYQCPHCPHK  214 (245)
Q Consensus       177 ~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~~C~~C~~~  214 (245)
                      |.|..||+.|..   +       .. .....|++||..
T Consensus         7 Y~C~~Cg~~~~~---~-------~~-~~~irCp~Cg~r   33 (49)
T COG1996           7 YKCARCGREVEL---D-------QE-TRGIRCPYCGSR   33 (49)
T ss_pred             EEhhhcCCeeeh---h-------hc-cCceeCCCCCcE
Confidence            788888877711   1       11 445778888764


No 110
>smart00734 ZnF_Rad18 Rad18-like CCHC zinc finger. Yeast Rad18p functions with Rad5p in error-free post-replicative DNA repair. This zinc finger is likely to bind nucleic-acids.
Probab=78.65  E-value=2.1  Score=20.72  Aligned_cols=20  Identities=25%  Similarity=0.645  Sum_probs=14.2

Q ss_pred             cccCCCcccCCChHHHHHhHh
Q psy12030        206 YQCPHCPHKAKHKANLKTHIA  226 (245)
Q Consensus       206 ~~C~~C~~~f~~~~~l~~H~~  226 (245)
                      ..||+|++.+ ....+..|+.
T Consensus         2 v~CPiC~~~v-~~~~in~HLD   21 (26)
T smart00734        2 VQCPVCFREV-PENLINSHLD   21 (26)
T ss_pred             CcCCCCcCcc-cHHHHHHHHH
Confidence            3588888887 5567777764


No 111
>PF09723 Zn-ribbon_8:  Zinc ribbon domain;  InterPro: IPR013429  This entry represents a region of about 41 amino acids found in a number of small proteins in a wide range of bacteria. The region usually begins with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One protein in this entry has been noted as a putative regulatory protein, designated FmdB []. Most proteins in this entry have a C-terminal region containing highly degenerate sequence.
Probab=78.08  E-value=0.54  Score=25.78  Aligned_cols=12  Identities=25%  Similarity=1.140  Sum_probs=7.3

Q ss_pred             eecccccccccC
Q psy12030         70 FECQVCGKRYKY   81 (245)
Q Consensus        70 ~~C~~C~~~f~~   81 (245)
                      |.|..||..|..
T Consensus         6 y~C~~Cg~~fe~   17 (42)
T PF09723_consen    6 YRCEECGHEFEV   17 (42)
T ss_pred             EEeCCCCCEEEE
Confidence            566666666643


No 112
>TIGR00373 conserved hypothetical protein TIGR00373. This family of proteins is, so far, restricted to archaeal genomes. The family appears to be distantly related to the N-terminal region of the eukaryotic transcription initiation factor IIE alpha chain.
Probab=77.96  E-value=1.3  Score=32.25  Aligned_cols=32  Identities=25%  Similarity=0.441  Sum_probs=19.3

Q ss_pred             CCCccCCCCcccccChHHHHHhcCCccccCcCCCcc
Q psy12030         96 EPKYQCPQCKDSFFSWSAFHKNLSGMFACDVCGKEY  131 (245)
Q Consensus        96 ~~~~~C~~C~~~f~~~~~l~~h~~~~~~C~~C~~~f  131 (245)
                      ...|.|+.|+..|+....+..    .|.|+.||..+
T Consensus       107 ~~~Y~Cp~c~~r~tf~eA~~~----~F~Cp~Cg~~L  138 (158)
T TIGR00373       107 NMFFICPNMCVRFTFNEAMEL----NFTCPRCGAML  138 (158)
T ss_pred             CCeEECCCCCcEeeHHHHHHc----CCcCCCCCCEe
Confidence            345667777766665555542    46677776544


No 113
>PF13240 zinc_ribbon_2:  zinc-ribbon domain
Probab=77.09  E-value=1  Score=21.09  Aligned_cols=6  Identities=0%  Similarity=-0.296  Sum_probs=3.0

Q ss_pred             CCCCCc
Q psy12030        236 PQEGRV  241 (245)
Q Consensus       236 C~~C~~  241 (245)
                      |+.||.
T Consensus        16 C~~CG~   21 (23)
T PF13240_consen   16 CPNCGT   21 (23)
T ss_pred             hhhhCC
Confidence            555554


No 114
>PRK00464 nrdR transcriptional regulator NrdR; Validated
Probab=76.20  E-value=0.82  Score=33.08  Aligned_cols=13  Identities=31%  Similarity=0.669  Sum_probs=6.1

Q ss_pred             cccCcCCCccCch
Q psy12030        122 FACDVCGKEYKYK  134 (245)
Q Consensus       122 ~~C~~C~~~f~~~  134 (245)
                      ++|+.||..|.+.
T Consensus        29 ~~c~~c~~~f~~~   41 (154)
T PRK00464         29 RECLACGKRFTTF   41 (154)
T ss_pred             eeccccCCcceEe
Confidence            4444455444443


No 115
>PRK06266 transcription initiation factor E subunit alpha; Validated
Probab=75.80  E-value=1.6  Score=32.47  Aligned_cols=31  Identities=29%  Similarity=0.555  Sum_probs=17.9

Q ss_pred             CCccCCCCcccccChHHHHHhcCCccccCcCCCcc
Q psy12030         97 PKYQCPQCKDSFFSWSAFHKNLSGMFACDVCGKEY  131 (245)
Q Consensus        97 ~~~~C~~C~~~f~~~~~l~~h~~~~~~C~~C~~~f  131 (245)
                      ..|.|+.|+..|+....+.    ..|.|+.||..+
T Consensus       116 ~~Y~Cp~C~~rytf~eA~~----~~F~Cp~Cg~~L  146 (178)
T PRK06266        116 MFFFCPNCHIRFTFDEAME----YGFRCPQCGEML  146 (178)
T ss_pred             CEEECCCCCcEEeHHHHhh----cCCcCCCCCCCC
Confidence            4566766666665554443    246666666544


No 116
>PRK00398 rpoP DNA-directed RNA polymerase subunit P; Provisional
Probab=75.77  E-value=0.91  Score=25.38  Aligned_cols=10  Identities=30%  Similarity=1.188  Sum_probs=4.8

Q ss_pred             eecccccccc
Q psy12030         70 FECQVCGKRY   79 (245)
Q Consensus        70 ~~C~~C~~~f   79 (245)
                      |.|+.||..|
T Consensus         4 y~C~~CG~~~   13 (46)
T PRK00398          4 YKCARCGREV   13 (46)
T ss_pred             EECCCCCCEE
Confidence            4455555444


No 117
>TIGR02300 FYDLN_acid conserved hypothetical protein TIGR02300. Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues. The function of members of this family is unknown.
Probab=75.07  E-value=2.4  Score=29.33  Aligned_cols=13  Identities=8%  Similarity=-0.069  Sum_probs=6.2

Q ss_pred             CCccCCCCCCcCC
Q psy12030        149 PKYQCPHCPHRAK  161 (245)
Q Consensus       149 ~~~~C~~C~~~f~  161 (245)
                      .|..|+.||..|.
T Consensus        25 ~p~vcP~cg~~~~   37 (129)
T TIGR02300        25 RPAVSPYTGEQFP   37 (129)
T ss_pred             CCccCCCcCCccC
Confidence            3444555554443


No 118
>PF04959 ARS2:  Arsenite-resistance protein 2;  InterPro: IPR007042 This entry represents Arsenite-resistance protein 2 (also known as Serrate RNA effector molecule homolog) which is thought to play a role in arsenite resistance [], although does not directly confer arsenite resistance but rather modulates arsenic sensitivity []. Arsenite is a carcinogenic compound which can act as a comutagen by inhibiting DNA repair. It is also involved in cell cycle progression at S phase. ; PDB: 3AX1_A.
Probab=74.59  E-value=1.2  Score=34.05  Aligned_cols=24  Identities=21%  Similarity=0.479  Sum_probs=11.9

Q ss_pred             eeCCCCCCccCChhHHHHHHhHHh
Q psy12030        177 FACNVCGKGYRYKTGLYRHKREEC  200 (245)
Q Consensus       177 ~~C~~C~~~f~~~~~l~~H~~~h~  200 (245)
                      |.|..|++.|....-..+|+..-|
T Consensus        78 ~~C~lc~KlFkg~eFV~KHI~nKH  101 (214)
T PF04959_consen   78 WRCPLCGKLFKGPEFVRKHIFNKH  101 (214)
T ss_dssp             EEE-SSS-EESSHHHHHHHHHHH-
T ss_pred             ECCCCCCcccCChHHHHHHHhhcC
Confidence            555555555555555555555443


No 119
>PF06524 NOA36:  NOA36 protein;  InterPro: IPR010531 This family consists of several NOA36 proteins which contain 29 highly conserved cysteine residues. The function of this protein is unknown.; GO: 0008270 zinc ion binding, 0005634 nucleus
Probab=74.19  E-value=1.6  Score=34.10  Aligned_cols=26  Identities=15%  Similarity=0.399  Sum_probs=19.1

Q ss_pred             CCCcccCCCcccCCChHHHHHhHhhh
Q psy12030        203 EPKYQCPHCPHKAKHKANLKTHIAIK  228 (245)
Q Consensus       203 ~~~~~C~~C~~~f~~~~~l~~H~~~~  228 (245)
                      .+++.||.||.-......|.+-.++|
T Consensus       207 ~k~~PCPKCg~et~eTkdLSmStR~h  232 (314)
T PF06524_consen  207 GKPIPCPKCGYETQETKDLSMSTRSH  232 (314)
T ss_pred             CCCCCCCCCCCcccccccceeeeecc
Confidence            56788888888877777776665555


No 120
>cd00730 rubredoxin Rubredoxin; nonheme iron binding domains containing a [Fe(SCys)4] center. Rubredoxins are small nonheme iron proteins. The iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), but iron can also be replaced by cobalt, nickel or zinc. They are believed to be involved in electron transfer.
Probab=73.49  E-value=1.6  Score=24.92  Aligned_cols=7  Identities=57%  Similarity=1.701  Sum_probs=2.9

Q ss_pred             eeCCCCC
Q psy12030        177 FACNVCG  183 (245)
Q Consensus       177 ~~C~~C~  183 (245)
                      |.|++|+
T Consensus        35 w~CP~C~   41 (50)
T cd00730          35 WVCPVCG   41 (50)
T ss_pred             CCCCCCC
Confidence            3444443


No 121
>PF12013 DUF3505:  Protein of unknown function (DUF3505);  InterPro: IPR022698  This family of proteins is functionally uncharacterised. This protein is found in eukaryotes. Proteins in this family are typically between 247 to 1018 amino acids in length. This region contains two segments that are likely to be C2H2 zinc binding domains. 
Probab=71.93  E-value=3.5  Score=27.88  Aligned_cols=25  Identities=36%  Similarity=0.650  Sum_probs=22.2

Q ss_pred             eeC----CCCCCccCChhHHHHHHhHHhC
Q psy12030        177 FAC----NVCGKGYRYKTGLYRHKREECG  201 (245)
Q Consensus       177 ~~C----~~C~~~f~~~~~l~~H~~~h~~  201 (245)
                      |.|    ..|++.+.+...+..|.+.+||
T Consensus        81 ~~C~~~~~~C~y~~~~~~~m~~H~~~~Hg  109 (109)
T PF12013_consen   81 YRCQCDPPHCGYITRSKKTMRKHWRKEHG  109 (109)
T ss_pred             eeeecCCCCCCcEeccHHHHHHHHHHhcC
Confidence            889    8899999999999999988875


No 122
>PF15269 zf-C2H2_7:  Zinc-finger
Probab=70.39  E-value=4.8  Score=22.16  Aligned_cols=21  Identities=33%  Similarity=0.853  Sum_probs=14.9

Q ss_pred             cccCCCcccCCChHHHHHhHh
Q psy12030        206 YQCPHCPHKAKHKANLKTHIA  226 (245)
Q Consensus       206 ~~C~~C~~~f~~~~~l~~H~~  226 (245)
                      |+|-.|+.+...++.|-.||+
T Consensus        21 ykcfqcpftc~~kshl~nhmk   41 (54)
T PF15269_consen   21 YKCFQCPFTCNEKSHLFNHMK   41 (54)
T ss_pred             ceeecCCcccchHHHHHHHHH
Confidence            667777777777777777765


No 123
>smart00440 ZnF_C2C2 C2C2 Zinc finger. Nucleic-acid-binding motif in transcriptional elongation factor TFIIS and RNA polymerases.
Probab=70.32  E-value=0.34  Score=26.29  Aligned_cols=11  Identities=9%  Similarity=-0.272  Sum_probs=5.9

Q ss_pred             CCCCCCCcccc
Q psy12030        234 LPPQEGRVWTR  244 (245)
Q Consensus       234 ~~C~~C~~~f~  244 (245)
                      |.|..||+.++
T Consensus        29 y~C~~C~~~w~   39 (40)
T smart00440       29 YVCTKCGHRWR   39 (40)
T ss_pred             EEeCCCCCEeC
Confidence            55555555543


No 124
>PF13878 zf-C2H2_3:  zinc-finger of acetyl-transferase ESCO
Probab=69.60  E-value=5.1  Score=21.78  Aligned_cols=23  Identities=22%  Similarity=0.366  Sum_probs=14.3

Q ss_pred             cccCCCcccCC--ChHHHHHhHhhh
Q psy12030        206 YQCPHCPHKAK--HKANLKTHIAIK  228 (245)
Q Consensus       206 ~~C~~C~~~f~--~~~~l~~H~~~~  228 (245)
                      -.|+.||..|.  ...+-..|.+.|
T Consensus        14 ~~C~~CgM~Y~~~~~eD~~~H~~yH   38 (41)
T PF13878_consen   14 TTCPTCGMLYSPGSPEDEKLHKKYH   38 (41)
T ss_pred             cCCCCCCCEECCCCHHHHHHHHHHH
Confidence            56777777665  445566666554


No 125
>TIGR00280 L37a ribosomal protein L37a. This model finds eukaryotic ribosomal protein L37a and its archaeal orthologs. The nomeclature is tricky because eukaryotes have proteins called both L37 and L37a.
Probab=68.95  E-value=2.7  Score=27.29  Aligned_cols=33  Identities=27%  Similarity=0.790  Sum_probs=21.5

Q ss_pred             CCccCCCCCCcCCChHHHHhhhcCCCCceeCCCCCCccCCh
Q psy12030        149 PKYQCPHCPHRAKHKANLKTHIAPQLGVFACNVCGKGYRYK  189 (245)
Q Consensus       149 ~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~C~~C~~~f~~~  189 (245)
                      ..|.|+.|++.-..        +.-.+.|.|..|++.|.--
T Consensus        34 a~y~CpfCgk~~vk--------R~a~GIW~C~~C~~~~AGG   66 (91)
T TIGR00280        34 AKYVCPFCGKKTVK--------RGSTGIWTCRKCGAKFAGG   66 (91)
T ss_pred             cCccCCCCCCCceE--------EEeeEEEEcCCCCCEEeCC
Confidence            45788888754332        3445668888888876543


No 126
>PF00301 Rubredoxin:  Rubredoxin;  InterPro: IPR004039 Rubredoxin is a low molecular weight iron-containing bacterial protein involved in electron transfer [, ], sometimes replacing ferredoxin as an electron carrier []. The 3-D structures of a number of rubredoxins have been solved [, ]. The fold belongs to the alpha+beta class, with 2 alpha-helices and 2-3 beta-strands. Its active site contains an iron ion which is co-ordinated by the sulphurs of four conserved cysteine residues forming an almost regular tetrahedron. The conserved cysteines reside on two loops, which are the most conserved regions of the protein. In addition, a ring of acidic residues in the proximity of the [Fe(Cys)4] centre is also well-conserved []. ; GO: 0009055 electron carrier activity, 0046872 metal ion binding; PDB: 2RDV_C 1RDV_A 1S24_A 1T9O_B 1B2J_A 1SMW_A 2PVE_B 1BFY_A 1T9P_C 1C09_C ....
Probab=68.33  E-value=3.4  Score=23.26  Aligned_cols=13  Identities=38%  Similarity=1.073  Sum_probs=6.6

Q ss_pred             eecccccccccCh
Q psy12030         70 FECQVCGKRYKYK   82 (245)
Q Consensus        70 ~~C~~C~~~f~~~   82 (245)
                      |.|..||..+...
T Consensus         2 y~C~~CgyvYd~~   14 (47)
T PF00301_consen    2 YQCPVCGYVYDPE   14 (47)
T ss_dssp             EEETTTSBEEETT
T ss_pred             cCCCCCCEEEcCC
Confidence            4555555555433


No 127
>COG1773 Rubredoxin [Energy production and conversion]
Probab=68.23  E-value=2  Score=24.97  Aligned_cols=11  Identities=18%  Similarity=0.591  Sum_probs=4.9

Q ss_pred             ccCCCCCCcCC
Q psy12030        151 YQCPHCPHRAK  161 (245)
Q Consensus       151 ~~C~~C~~~f~  161 (245)
                      |+|..||..|.
T Consensus         4 ~~C~~CG~vYd   14 (55)
T COG1773           4 WRCSVCGYVYD   14 (55)
T ss_pred             eEecCCceEec
Confidence            44444444444


No 128
>PF05443 ROS_MUCR:  ROS/MUCR transcriptional regulator protein;  InterPro: IPR008807 This family consists of several ROS/MUCR transcriptional regulator proteins. The ros chromosomal gene is present in octopine and nopaline strains of Agrobacterium tumefaciens as well as in Rhizobium meliloti (Sinorhizobium meliloti). This gene encodes a 15.5 kDa protein that specifically represses the virC and virD operons in the virulence region of the Ti plasmid [] and is necessary for succinoglycan production []. S. meliloti can produce two types of acidic exopolysaccharides, succinoglycan and galactoglucan, that are interchangeable for infection of Medicago sativa (Alfalfa) nodules. MucR from S. meliloti acts as a transcriptional repressor that blocks the expression of the exp genes responsible for galactoglucan production therefore allowing the exclusive production of succinoglycan [].; GO: 0003677 DNA binding, 0008270 zinc ion binding, 0006355 regulation of transcription, DNA-dependent; PDB: 2JSP_A.
Probab=68.08  E-value=2.9  Score=29.43  Aligned_cols=22  Identities=32%  Similarity=0.558  Sum_probs=9.6

Q ss_pred             cccCCCcccCCChHHHHHhHhhhCC
Q psy12030        206 YQCPHCPHKAKHKANLKTHIAIKHS  230 (245)
Q Consensus       206 ~~C~~C~~~f~~~~~l~~H~~~~~~  230 (245)
                      ..|-+||+.|...   .+|++.|||
T Consensus        73 i~clecGk~~k~L---krHL~~~~g   94 (132)
T PF05443_consen   73 IICLECGKKFKTL---KRHLRTHHG   94 (132)
T ss_dssp             EE-TBT--EESBH---HHHHHHTT-
T ss_pred             eEEccCCcccchH---HHHHHHccC
Confidence            4555555555443   555555554


No 129
>PTZ00255 60S ribosomal protein L37a; Provisional
Probab=68.08  E-value=3.5  Score=26.79  Aligned_cols=34  Identities=29%  Similarity=0.674  Sum_probs=21.4

Q ss_pred             CCCccCCCCCCcCCChHHHHhhhcCCCCceeCCCCCCccCCh
Q psy12030        148 EPKYQCPHCPHRAKHKANLKTHIAPQLGVFACNVCGKGYRYK  189 (245)
Q Consensus       148 ~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~C~~C~~~f~~~  189 (245)
                      ...|.|+.|++.-..        +.-.+.|.|..|++.|.--
T Consensus        34 ~a~y~CpfCgk~~vk--------R~a~GIW~C~~C~~~~AGG   67 (90)
T PTZ00255         34 HAKYFCPFCGKHAVK--------RQAVGIWRCKGCKKTVAGG   67 (90)
T ss_pred             hCCccCCCCCCCcee--------eeeeEEEEcCCCCCEEeCC
Confidence            345788888754332        3334668888888876643


No 130
>PF09845 DUF2072:  Zn-ribbon containing protein (DUF2072);  InterPro: IPR018645  This archaeal Zinc-ribbon containing proteins have no known function. 
Probab=68.04  E-value=3.9  Score=28.52  Aligned_cols=13  Identities=23%  Similarity=0.790  Sum_probs=6.7

Q ss_pred             cccCcCCCccCch
Q psy12030        122 FACDVCGKEYKYK  134 (245)
Q Consensus       122 ~~C~~C~~~f~~~  134 (245)
                      ++|..||+.|.+.
T Consensus         2 H~Ct~Cg~~f~dg   14 (131)
T PF09845_consen    2 HQCTKCGRVFEDG   14 (131)
T ss_pred             cccCcCCCCcCCC
Confidence            4555555555443


No 131
>COG3357 Predicted transcriptional regulator containing an HTH domain fused to a Zn-ribbon [Transcription]
Probab=67.63  E-value=4  Score=26.35  Aligned_cols=13  Identities=15%  Similarity=0.565  Sum_probs=7.3

Q ss_pred             CcccCCCcccCCC
Q psy12030        205 KYQCPHCPHKAKH  217 (245)
Q Consensus       205 ~~~C~~C~~~f~~  217 (245)
                      |-.|..||+.|.+
T Consensus        58 Pa~CkkCGfef~~   70 (97)
T COG3357          58 PARCKKCGFEFRD   70 (97)
T ss_pred             ChhhcccCccccc
Confidence            4556666655554


No 132
>PF08274 PhnA_Zn_Ribbon:  PhnA Zinc-Ribbon ;  InterPro: IPR013987 The PhnA protein family includes the uncharacterised Escherichia coli protein PhnA and its homologues. The E. coli phnA gene is part of a large operon associated with alkylphosphonate uptake and carbon-phosphorus bond cleavage []. The protein is not related to the characterised phosphonoacetate hydrolase designated PhnA []. This entry represents the N-terminal domain of PhnA, which is predicted to form a zinc-ribbon.; PDB: 2AKL_A.
Probab=67.24  E-value=1.6  Score=22.03  Aligned_cols=9  Identities=33%  Similarity=0.936  Sum_probs=4.4

Q ss_pred             CCcccCCCc
Q psy12030        204 PKYQCPHCP  212 (245)
Q Consensus       204 ~~~~C~~C~  212 (245)
                      -.|.|+.|+
T Consensus        18 ~~~vCp~C~   26 (30)
T PF08274_consen   18 ELLVCPECG   26 (30)
T ss_dssp             SSEEETTTT
T ss_pred             CEEeCCccc
Confidence            345555554


No 133
>PF07754 DUF1610:  Domain of unknown function (DUF1610);  InterPro: IPR011668 This domain is found in archaeal species. It is likely to bind zinc via its four well-conserved cysteine residues.
Probab=67.20  E-value=2.3  Score=20.15  Aligned_cols=8  Identities=38%  Similarity=1.435  Sum_probs=4.3

Q ss_pred             CcccCCCc
Q psy12030        205 KYQCPHCP  212 (245)
Q Consensus       205 ~~~C~~C~  212 (245)
                      +|.|+.||
T Consensus        16 ~f~CPnCG   23 (24)
T PF07754_consen   16 PFPCPNCG   23 (24)
T ss_pred             eEeCCCCC
Confidence            45555555


No 134
>PF01780 Ribosomal_L37ae:  Ribosomal L37ae protein family;  InterPro: IPR002674 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms. The codons of the mRNA are exposed on the ribosome to allow tRNA binding. This leads to the incorporation of amino acids into the growing polypeptide chain in accordance with the genetic information. Incoming amino acid monomers enter the ribosomal A site in the form of aminoacyl-tRNAs complexed with elongation factor Tu (EF-Tu) and GTP. The growing polypeptide chain, situated in the P site as peptidyl-tRNA, is then transferred to aminoacyl-tRNA and the new peptidyl-tRNA, extended by one residue, is translocated to the P site with the aid the elongation factor G (EF-G) and GTP as the deacylated tRNA is released from the ribosome through one or more exit sites [, ]. About 2/3 of the mass of the ribosome consists of RNA and 1/3 of protein. The proteins are named in accordance with the subunit of the ribosome which they belong to - the small (S1 to S31) and the large (L1 to L44). Usually they decorate the rRNA cores of the subunits.  Many ribosomal proteins, particularly those of the large subunit, are composed of a globular, surfaced-exposed domain with long finger-like projections that extend into the rRNA core to stabilise its structure. Most of the proteins interact with multiple RNA elements, often from different domains. In the large subunit, about 1/3 of the 23S rRNA nucleotides are at least in van der Waal's contact with protein, and L22 interacts with all six domains of the 23S rRNA. Proteins S4 and S7, which initiate assembly of the 16S rRNA, are located at junctions of five and four RNA helices, respectively. In this way proteins serve to organise and stabilise the rRNA tertiary structure. While the crucial activities of decoding and peptide transfer are RNA based, proteins play an active role in functions that may have evolved to streamline the process of protein synthesis. In addition to their function in the ribosome, many ribosomal proteins have some function 'outside' the ribosome [, ]. This ribosomal protein is found in archaebacteria and eukaryotes []. Ribosomal protein L37 has a single zinc finger-like motif of the C2-C2 type [].; GO: 0003735 structural constituent of ribosome, 0006412 translation, 0005622 intracellular, 0005840 ribosome; PDB: 4A1E_Y 4A17_Y 4A1C_Y 4A1A_Y 3O58_g 3IZS_m 3O5H_g 1S1I_9 3IZR_m 1YSH_D ....
Probab=67.16  E-value=1.7  Score=28.17  Aligned_cols=32  Identities=31%  Similarity=0.842  Sum_probs=19.6

Q ss_pred             CCccCCCCCCcCCChHHHHhhhcCCCCceeCCCCCCccCC
Q psy12030        149 PKYQCPHCPHRAKHKANLKTHIAPQLGVFACNVCGKGYRY  188 (245)
Q Consensus       149 ~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~C~~C~~~f~~  188 (245)
                      ..|.|+.|++.-..        +.-.+.|.|..|++.|.-
T Consensus        34 ~ky~Cp~Cgk~~vk--------R~a~GIW~C~~C~~~~AG   65 (90)
T PF01780_consen   34 AKYTCPFCGKTSVK--------RVATGIWKCKKCGKKFAG   65 (90)
T ss_dssp             S-BEESSSSSSEEE--------EEETTEEEETTTTEEEE-
T ss_pred             CCCcCCCCCCceeE--------EeeeEEeecCCCCCEEeC
Confidence            34778877765432        344566888888876643


No 135
>PF12907 zf-met2:  Zinc-binding
Probab=66.82  E-value=3.1  Score=22.50  Aligned_cols=27  Identities=26%  Similarity=0.537  Sum_probs=15.8

Q ss_pred             cccCCCcc---cCCChHHHHHhHhhhCCCC
Q psy12030        206 YQCPHCPH---KAKHKANLKTHIAIKHSDR  232 (245)
Q Consensus       206 ~~C~~C~~---~f~~~~~l~~H~~~~~~~~  232 (245)
                      +.|.+|-.   .......|..|....|...
T Consensus         2 i~C~iC~qtF~~t~~~~~L~eH~enKHpK~   31 (40)
T PF12907_consen    2 IICKICRQTFMQTTNEPQLKEHAENKHPKN   31 (40)
T ss_pred             cCcHHhhHHHHhcCCHHHHHHHHHccCCCC
Confidence            45666663   3344566777766666554


No 136
>cd00924 Cyt_c_Oxidase_Vb Cytochrome c oxidase subunit Vb.  Cytochrome c oxidase (CcO), the terminal oxidase in the respiratory chains of eukaryotes and most bacteria, is a multi-chain transmembrane protein located in the inner membrane of mitochondria and the cell membrane of prokaryotes.  It catalyzes the reduction of O2 and simultaneously pumps protons across the membrane.  The number of subunits varies from three to five in bacteria and up to 13 in mammalian mitochondria. Subunits I, II, and III of mammalian CcO are encoded within the mitochondrial genome and the remaining 10 subunits are encoded within the nuclear genome.  Found only in eukaryotes, subunit Vb is one of three mammalian subunits that lacks a transmembrane region.  Subunit Vb is located on the matrix side of the membrane and binds the regulatory subunit of protein kinase A.  The abnormally extended conformation is stable only in the CcO assembly.
Probab=66.58  E-value=2.9  Score=27.69  Aligned_cols=12  Identities=33%  Similarity=0.822  Sum_probs=5.8

Q ss_pred             CCcccCCCcccC
Q psy12030        204 PKYQCPHCPHKA  215 (245)
Q Consensus       204 ~~~~C~~C~~~f  215 (245)
                      +|++|+.||..|
T Consensus        78 ~~~rC~eCG~~f   89 (97)
T cd00924          78 KPKRCPECGHVF   89 (97)
T ss_pred             CceeCCCCCcEE
Confidence            345555555443


No 137
>PF14353 CpXC:  CpXC protein
Probab=64.32  E-value=1.5  Score=30.59  Aligned_cols=24  Identities=25%  Similarity=0.522  Sum_probs=14.3

Q ss_pred             CCccCCCCCCcCCChHHHHhhhcC
Q psy12030        149 PKYQCPHCPHRAKHKANLKTHIAP  172 (245)
Q Consensus       149 ~~~~C~~C~~~f~~~~~l~~H~~~  172 (245)
                      ..+.|+.||..|.-...+.-|-..
T Consensus        37 ~~~~CP~Cg~~~~~~~p~lY~D~~   60 (128)
T PF14353_consen   37 FSFTCPSCGHKFRLEYPLLYHDPE   60 (128)
T ss_pred             CEEECCCCCCceecCCCEEEEcCC
Confidence            346677777777665555555333


No 138
>PF01096 TFIIS_C:  Transcription factor S-II (TFIIS);  InterPro: IPR001222 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents a zinc finger motif found in transcription factor IIs (TFIIS). In eukaryotes the initiation of transcription of protein encoding genes by polymerase II (Pol II) is modulated by general and specific transcription factors. The general transcription factors operate through common promoters elements (such as the TATA box). At least eight different proteins associate to form the general transcription factors: TFIIA, -IIB, -IID, -IIE, -IIF, -IIG, -IIH and -IIS []. During mRNA elongation, Pol II can encounter DNA sequences that cause reverse movement of the enzyme. Such backtracking involves extrusion of the RNA 3'-end into the pore, and can lead to transcriptional arrest. Escape from arrest requires cleavage of the extruded RNA with the help of TFIIS, which induces mRNA cleavage by enhancing the intrinsic nuclease activity of RNA polymerase (Pol) II, past template-encoded pause sites []. TFIIS extends from the polymerase surface via a pore to the internal active site. Two essential and invariant acidic residues in a TFIIS loop complement the Pol II active site and could position a metal ion and a water molecule for hydrolytic RNA cleavage. TFIIS also induces extensive structural changes in Pol II that would realign nucleic acids in the active centre.  TFIIS is a protein of about 300 amino acids. It contains three regions: a variable N-terminal domain not required for TFIIS activity; a conserved central domain required for Pol II binding; and a conserved C-terminal C4-type zinc finger essential for RNA cleavage. The zinc finger folds in a conformation termed a zinc ribbon [] characterised by a three-stranded antiparallel beta-sheet and two beta-hairpins. A backbone model for Pol II-TFIIS complex was obtained from X-ray analysis. It shows that a beta hairpin protrudes from the zinc finger and complements the pol II active site [].  Some viral proteins also contain the TFIIS zinc ribbon C-terminal domain. The Vaccinia virus protein, unlike its eukaryotic homologue, is an integral RNA polymerase subunit rather than a readily separable transcription factor []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003676 nucleic acid binding, 0008270 zinc ion binding, 0006351 transcription, DNA-dependent; PDB: 3M4O_I 3S14_I 2E2J_I 4A3J_I 3HOZ_I 1TWA_I 3S1Q_I 3S1N_I 1TWG_I 3I4M_I ....
Probab=63.26  E-value=0.11  Score=28.08  Aligned_cols=11  Identities=9%  Similarity=-0.353  Sum_probs=6.0

Q ss_pred             CCCCCCCcccc
Q psy12030        234 LPPQEGRVWTR  244 (245)
Q Consensus       234 ~~C~~C~~~f~  244 (245)
                      |.|..||+.||
T Consensus        29 y~C~~C~~~wr   39 (39)
T PF01096_consen   29 YVCCNCGHRWR   39 (39)
T ss_dssp             EEESSSTEEEE
T ss_pred             EEeCCCCCeeC
Confidence            55555555543


No 139
>COG3091 SprT Zn-dependent metalloprotease, SprT family [General function prediction only]
Probab=63.05  E-value=2.9  Score=29.94  Aligned_cols=32  Identities=31%  Similarity=0.727  Sum_probs=15.0

Q ss_pred             ceeCCCCCCccCChhHHHHHHhHHhCCCCCcccCCCcc
Q psy12030        176 VFACNVCGKGYRYKTGLYRHKREECGQEPKYQCPHCPH  213 (245)
Q Consensus       176 ~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~~C~~C~~  213 (245)
                      +|.|. |+..|.+.   ++|-..-.| + .|.|..|+-
T Consensus       117 ~Y~C~-C~q~~l~~---RRhn~~~~g-~-~YrC~~C~g  148 (156)
T COG3091         117 PYRCQ-CQQHYLRI---RRHNTVRRG-E-VYRCGKCGG  148 (156)
T ss_pred             eEEee-cCCccchh---hhccccccc-c-eEEeccCCc
Confidence            36666 66554432   223223223 3 566666653


No 140
>PRK14714 DNA polymerase II large subunit; Provisional
Probab=63.05  E-value=11  Score=36.57  Aligned_cols=8  Identities=38%  Similarity=1.173  Sum_probs=4.3

Q ss_pred             ccCCCCCC
Q psy12030        151 YQCPHCPH  158 (245)
Q Consensus       151 ~~C~~C~~  158 (245)
                      +.|+.||.
T Consensus       668 rkCPkCG~  675 (1337)
T PRK14714        668 RRCPSCGT  675 (1337)
T ss_pred             EECCCCCC
Confidence            45555554


No 141
>PRK03824 hypA hydrogenase nickel incorporation protein; Provisional
Probab=62.89  E-value=3  Score=29.53  Aligned_cols=13  Identities=31%  Similarity=0.933  Sum_probs=9.0

Q ss_pred             eeCCCCCCccCCh
Q psy12030        177 FACNVCGKGYRYK  189 (245)
Q Consensus       177 ~~C~~C~~~f~~~  189 (245)
                      +.|..||..|...
T Consensus        71 ~~C~~CG~~~~~~   83 (135)
T PRK03824         71 LKCRNCGNEWSLK   83 (135)
T ss_pred             EECCCCCCEEecc
Confidence            7787787766543


No 142
>PRK03976 rpl37ae 50S ribosomal protein L37Ae; Reviewed
Probab=62.50  E-value=4.2  Score=26.41  Aligned_cols=32  Identities=25%  Similarity=0.634  Sum_probs=20.6

Q ss_pred             CCccCCCCCCcCCChHHHHhhhcCCCCceeCCCCCCccCC
Q psy12030        149 PKYQCPHCPHRAKHKANLKTHIAPQLGVFACNVCGKGYRY  188 (245)
Q Consensus       149 ~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~C~~C~~~f~~  188 (245)
                      ..|.|+.|++.-..        +.-.+.|.|..|++.|.-
T Consensus        35 a~y~CpfCgk~~vk--------R~a~GIW~C~~C~~~~AG   66 (90)
T PRK03976         35 AKHVCPVCGRPKVK--------RVGTGIWECRKCGAKFAG   66 (90)
T ss_pred             cCccCCCCCCCceE--------EEEEEEEEcCCCCCEEeC
Confidence            44788888654332        344566888888887654


No 143
>KOG4167|consensus
Probab=62.42  E-value=1.6  Score=39.19  Aligned_cols=27  Identities=22%  Similarity=0.417  Sum_probs=24.5

Q ss_pred             CceecccccccccChhHHhcchhcccC
Q psy12030         68 KGFECQVCGKRYKYKRGLHRHKQDECG   94 (245)
Q Consensus        68 ~~~~C~~C~~~f~~~~~l~~H~~~h~~   94 (245)
                      ..|.|.+|++.|....+++.||++|.-
T Consensus       791 giFpCreC~kvF~KiKSrNAHMK~Hr~  817 (907)
T KOG4167|consen  791 GIFPCRECGKVFFKIKSRNAHMKTHRQ  817 (907)
T ss_pred             ceeehHHHHHHHHHHhhhhHHHHHHHH
Confidence            349999999999999999999999864


No 144
>KOG2593|consensus
Probab=60.65  E-value=6.6  Score=33.19  Aligned_cols=36  Identities=36%  Similarity=0.842  Sum_probs=27.7

Q ss_pred             CCCccCCCCcccccChHHHHH--hcCCccccCcCCCcc
Q psy12030         96 EPKYQCPQCKDSFFSWSAFHK--NLSGMFACDVCGKEY  131 (245)
Q Consensus        96 ~~~~~C~~C~~~f~~~~~l~~--h~~~~~~C~~C~~~f  131 (245)
                      ...|.|+.|.++|.+...++-  ...+.|.|..|+...
T Consensus       126 ~~~Y~Cp~C~kkyt~Lea~~L~~~~~~~F~C~~C~gel  163 (436)
T KOG2593|consen  126 VAGYVCPNCQKKYTSLEALQLLDNETGEFHCENCGGEL  163 (436)
T ss_pred             cccccCCccccchhhhHHHHhhcccCceEEEecCCCch
Confidence            567999999999988777643  446789999997544


No 145
>COG1571 Predicted DNA-binding protein containing a Zn-ribbon domain [General function prediction only]
Probab=59.73  E-value=6.1  Score=33.50  Aligned_cols=12  Identities=25%  Similarity=0.955  Sum_probs=5.7

Q ss_pred             CcccCCCcccCC
Q psy12030        205 KYQCPHCPHKAK  216 (245)
Q Consensus       205 ~~~C~~C~~~f~  216 (245)
                      -|+|+.||..+.
T Consensus       367 g~rC~kCg~~~~  378 (421)
T COG1571         367 GFRCKKCGTRAR  378 (421)
T ss_pred             CcccccccccCC
Confidence            455555554443


No 146
>KOG2785|consensus
Probab=59.38  E-value=8.6  Score=31.95  Aligned_cols=70  Identities=16%  Similarity=0.223  Sum_probs=44.2

Q ss_pred             ceecccccccccChhHHhcchhcccCCCCCccCCCCcccccChHHH----HHhcCCccccCcCC---CccCchhHHHhHH
Q psy12030         69 GFECQVCGKRYKYKRGLHRHKQDECGQEPKYQCPQCKDSFFSWSAF----HKNLSGMFACDVCG---KEYKYKRGLYRHK  141 (245)
Q Consensus        69 ~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~~C~~C~~~f~~~~~l----~~h~~~~~~C~~C~---~~f~~~~~l~~H~  141 (245)
                      |-.|-.|+..+.+...-..||..+|+---|    .=. -..+...|    -.-+...+.|-.|+   +.|.+....+.||
T Consensus       166 Pt~CLfC~~~~k~~e~~~~HM~~~HgffIP----dre-YL~D~~GLl~YLgeKV~~~~~CL~CN~~~~~f~sleavr~HM  240 (390)
T KOG2785|consen  166 PTDCLFCDKKSKSLEENLKHMFKEHGFFIP----DRE-YLTDEKGLLKYLGEKVGIGFICLFCNELGRPFSSLEAVRAHM  240 (390)
T ss_pred             CcceeecCCCcccHHHHHHHHhhccCCcCC----chH-hhhchhHHHHHHHHHhccCceEEEeccccCcccccHHHHHHH
Confidence            467888999998888888999888772111    000 00112222    12223457788887   8888888888888


Q ss_pred             hh
Q psy12030        142 KF  143 (245)
Q Consensus       142 ~~  143 (245)
                      ..
T Consensus       241 ~~  242 (390)
T KOG2785|consen  241 RD  242 (390)
T ss_pred             hh
Confidence            64


No 147
>PRK00432 30S ribosomal protein S27ae; Validated
Probab=58.90  E-value=9  Score=21.88  Aligned_cols=11  Identities=27%  Similarity=0.788  Sum_probs=5.6

Q ss_pred             CceeCCCCCCc
Q psy12030        175 GVFACNVCGKG  185 (245)
Q Consensus       175 ~~~~C~~C~~~  185 (245)
                      +.+.|..||..
T Consensus        36 ~r~~C~~Cgyt   46 (50)
T PRK00432         36 DRWHCGKCGYT   46 (50)
T ss_pred             CcEECCCcCCE
Confidence            34555555544


No 148
>KOG2907|consensus
Probab=58.54  E-value=4.1  Score=27.46  Aligned_cols=11  Identities=45%  Similarity=1.126  Sum_probs=5.6

Q ss_pred             cccCCCcccCC
Q psy12030        206 YQCPHCPHKAK  216 (245)
Q Consensus       206 ~~C~~C~~~f~  216 (245)
                      |.|+.|++.|.
T Consensus       103 YTC~kC~~k~~  113 (116)
T KOG2907|consen  103 YTCPKCKYKFT  113 (116)
T ss_pred             EEcCccceeee
Confidence            55555555443


No 149
>PRK04023 DNA polymerase II large subunit; Validated
Probab=58.51  E-value=11  Score=35.65  Aligned_cols=9  Identities=33%  Similarity=0.970  Sum_probs=5.1

Q ss_pred             eeCCCCCCc
Q psy12030        177 FACNVCGKG  185 (245)
Q Consensus       177 ~~C~~C~~~  185 (245)
                      +.|+.||..
T Consensus       664 y~CPKCG~E  672 (1121)
T PRK04023        664 DECEKCGRE  672 (1121)
T ss_pred             CcCCCCCCC
Confidence            556666643


No 150
>PRK12380 hydrogenase nickel incorporation protein HybF; Provisional
Probab=58.12  E-value=4.9  Score=27.47  Aligned_cols=11  Identities=18%  Similarity=0.259  Sum_probs=6.4

Q ss_pred             eeCCCCCCccC
Q psy12030        177 FACNVCGKGYR  187 (245)
Q Consensus       177 ~~C~~C~~~f~  187 (245)
                      ..|..||..|.
T Consensus        71 ~~C~~Cg~~~~   81 (113)
T PRK12380         71 AWCWDCSQVVE   81 (113)
T ss_pred             EEcccCCCEEe
Confidence            56666665544


No 151
>COG3364 Zn-ribbon containing protein [General function prediction only]
Probab=58.10  E-value=7.6  Score=25.68  Aligned_cols=12  Identities=25%  Similarity=0.545  Sum_probs=5.8

Q ss_pred             ccCCCCCCcCCC
Q psy12030        151 YQCPHCPHRAKH  162 (245)
Q Consensus       151 ~~C~~C~~~f~~  162 (245)
                      +.|..||..|..
T Consensus         3 H~CtrCG~vf~~   14 (112)
T COG3364           3 HQCTRCGEVFDD   14 (112)
T ss_pred             ceeccccccccc
Confidence            444445554444


No 152
>TIGR00595 priA primosomal protein N'. All proteins in this family for which functions are known are components of the primosome which is involved in replication, repair, and recombination.This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=57.30  E-value=6.9  Score=34.43  Aligned_cols=10  Identities=20%  Similarity=0.338  Sum_probs=5.3

Q ss_pred             cCCCCCCcCC
Q psy12030        152 QCPHCPHRAK  161 (245)
Q Consensus       152 ~C~~C~~~f~  161 (245)
                      .|..||....
T Consensus       215 ~C~~Cg~~~~  224 (505)
T TIGR00595       215 LCRSCGYILC  224 (505)
T ss_pred             EhhhCcCccC
Confidence            4666655443


No 153
>PLN02294 cytochrome c oxidase subunit Vb
Probab=56.96  E-value=5.7  Score=29.07  Aligned_cols=13  Identities=23%  Similarity=0.795  Sum_probs=7.6

Q ss_pred             CCCcccCCCcccC
Q psy12030        203 EPKYQCPHCPHKA  215 (245)
Q Consensus       203 ~~~~~C~~C~~~f  215 (245)
                      .+|++|++||..|
T Consensus       139 Gkp~RCpeCG~~f  151 (174)
T PLN02294        139 GKSFECPVCTQYF  151 (174)
T ss_pred             CCceeCCCCCCEE
Confidence            4456666666554


No 154
>COG1594 RPB9 DNA-directed RNA polymerase, subunit M/Transcription elongation factor TFIIS [Transcription]
Probab=55.53  E-value=8.2  Score=26.38  Aligned_cols=10  Identities=30%  Similarity=0.913  Sum_probs=6.9

Q ss_pred             ceeccccccc
Q psy12030         69 GFECQVCGKR   78 (245)
Q Consensus        69 ~~~C~~C~~~   78 (245)
                      ...|+.||..
T Consensus        72 ~~~CpkCg~~   81 (113)
T COG1594          72 KEKCPKCGNK   81 (113)
T ss_pred             cccCCCCCCc
Confidence            3678888754


No 155
>COG4888 Uncharacterized Zn ribbon-containing protein [General function prediction only]
Probab=55.07  E-value=1.8  Score=28.50  Aligned_cols=35  Identities=17%  Similarity=0.347  Sum_probs=16.1

Q ss_pred             eeCCCCCCccCChhHHHHHHhHHhCCCCCcccCCCcccCC
Q psy12030        177 FACNVCGKGYRYKTGLYRHKREECGQEPKYQCPHCPHKAK  216 (245)
Q Consensus       177 ~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~~C~~C~~~f~  216 (245)
                      |.|+.||..-...-.+..-     ...-...|..||..|.
T Consensus        23 FtCp~Cghe~vs~ctvkk~-----~~~g~~~Cg~CGls~e   57 (104)
T COG4888          23 FTCPRCGHEKVSSCTVKKT-----VNIGTAVCGNCGLSFE   57 (104)
T ss_pred             EecCccCCeeeeEEEEEec-----CceeEEEcccCcceEE
Confidence            6666666554433221110     1122345666666553


No 156
>COG3677 Transposase and inactivated derivatives [DNA replication, recombination, and repair]
Probab=55.04  E-value=10  Score=26.60  Aligned_cols=13  Identities=23%  Similarity=0.725  Sum_probs=7.8

Q ss_pred             CcccCCCcccCCC
Q psy12030        205 KYQCPHCPHKAKH  217 (245)
Q Consensus       205 ~~~C~~C~~~f~~  217 (245)
                      .|+|+.|++.|..
T Consensus        53 RyrC~~C~~tf~~   65 (129)
T COG3677          53 RYKCKSCGSTFTV   65 (129)
T ss_pred             ccccCCcCcceee
Confidence            3666666666653


No 157
>PF13451 zf-trcl:  Probable zinc-binding domain
Probab=54.97  E-value=6.7  Score=22.28  Aligned_cols=15  Identities=13%  Similarity=0.381  Sum_probs=7.3

Q ss_pred             CCcccCCCcccCCCh
Q psy12030        204 PKYQCPHCPHKAKHK  218 (245)
Q Consensus       204 ~~~~C~~C~~~f~~~  218 (245)
                      +++.|..||..|.-.
T Consensus         3 k~l~C~dCg~~FvfT   17 (49)
T PF13451_consen    3 KTLTCKDCGAEFVFT   17 (49)
T ss_pred             eeEEcccCCCeEEEe
Confidence            344555555554433


No 158
>PF05290 Baculo_IE-1:  Baculovirus immediate-early protein (IE-0);  InterPro: IPR007954 This entry contains the Baculovirus immediate-early protein IE-0.
Probab=53.63  E-value=5.4  Score=27.85  Aligned_cols=24  Identities=21%  Similarity=0.454  Sum_probs=14.9

Q ss_pred             hHHHhHHhhhcCCCCCccCCCCCCcCCChH
Q psy12030        135 RGLYRHKKFECGQEPKYQCPHCPHRAKHKA  164 (245)
Q Consensus       135 ~~l~~H~~~h~~~~~~~~C~~C~~~f~~~~  164 (245)
                      ..|..|-..|      -+|++|..+|.+..
T Consensus       112 a~LWK~~~~y------pvCPvCkTSFKss~  135 (140)
T PF05290_consen  112 ANLWKFCNLY------PVCPVCKTSFKSSS  135 (140)
T ss_pred             HHHHHHcccC------CCCCcccccccccc
Confidence            4565554433      36888888877654


No 159
>TIGR00100 hypA hydrogenase nickel insertion protein HypA. In Hpylori, hypA mutant abolished hydrogenase activity and decrease in urease activity. Nickel supplementation in media restored urease activity and partial hydrogenase activity. HypA probably involved in inserting Ni in enzymes.
Probab=53.30  E-value=5.8  Score=27.20  Aligned_cols=11  Identities=18%  Similarity=0.597  Sum_probs=6.6

Q ss_pred             eeCCCCCCccC
Q psy12030        177 FACNVCGKGYR  187 (245)
Q Consensus       177 ~~C~~C~~~f~  187 (245)
                      ..|..||..|.
T Consensus        71 ~~C~~Cg~~~~   81 (115)
T TIGR00100        71 CECEDCSEEVS   81 (115)
T ss_pred             EEcccCCCEEe
Confidence            56666665554


No 160
>PF08271 TF_Zn_Ribbon:  TFIIB zinc-binding;  InterPro: IPR013137 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents a zinc finger motif found in transcription factor IIB (TFIIB). In eukaryotes the initiation of transcription of protein encoding genes by the polymerase II complexe (Pol II) is modulated by general and specific transcription factors. The general transcription factors operate through common promoters elements (such as the TATA box). At least seven different proteins associate to form the general transcription factors: TFIIA, -IIB, -IID, -IIE, -IIF, -IIG, and -IIH [].  TFIIB and TFIID are responsible for promoter recognition and interaction with pol II; together with Pol II, they form a minimal initiation complex capable of transcription under certain conditions. The TATA box of a Pol II promoter is bound in the initiation complex by the TBP subunit of TFIID, which bends the DNA around the C-terminal domain of TFIIB whereas the N-terminal zinc finger of TFIIB interacts with Pol II [, ]. The TFIIB zinc finger adopts a zinc ribbon fold characterised by two beta-hairpins forming two structurally similar zinc-binding sub-sites []. The zinc finger contacts the rbp1 subunit of Pol II through its dock domain, a conserved region of about 70 amino acids located close to the polymerase active site []. In the Pol II complex this surface is located near the RNA exit groove. Interestingly this sequence is best conserved in the three polymerases that utilise a TFIIB-like general transcription factor (Pol II, Pol III, and archaeal RNA polymerase) but not in Pol I [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0006355 regulation of transcription, DNA-dependent; PDB: 1VD4_A 1PFT_A 3K1F_M 3K7A_M 1RO4_A 1RLY_A 1DL6_A.
Probab=53.18  E-value=3.7  Score=22.50  Aligned_cols=9  Identities=33%  Similarity=0.918  Sum_probs=3.6

Q ss_pred             cccCcCCCc
Q psy12030        122 FACDVCGKE  130 (245)
Q Consensus       122 ~~C~~C~~~  130 (245)
                      +.|..||..
T Consensus        20 ~vC~~CG~V   28 (43)
T PF08271_consen   20 LVCPNCGLV   28 (43)
T ss_dssp             EEETTT-BB
T ss_pred             EECCCCCCE
Confidence            444444443


No 161
>PF13824 zf-Mss51:  Zinc-finger of mitochondrial splicing suppressor 51
Probab=53.13  E-value=14  Score=21.55  Aligned_cols=16  Identities=19%  Similarity=0.684  Sum_probs=11.2

Q ss_pred             CCCcccCCCcccCCCh
Q psy12030        203 EPKYQCPHCPHKAKHK  218 (245)
Q Consensus       203 ~~~~~C~~C~~~f~~~  218 (245)
                      ...|.|+.||..+--+
T Consensus        12 ~v~~~Cp~cGipthcS   27 (55)
T PF13824_consen   12 HVNFECPDCGIPTHCS   27 (55)
T ss_pred             ccCCcCCCCCCcCccC
Confidence            5568888888765543


No 162
>PRK14873 primosome assembly protein PriA; Provisional
Probab=53.13  E-value=9.3  Score=34.86  Aligned_cols=49  Identities=20%  Similarity=0.570  Sum_probs=32.4

Q ss_pred             CccCCCCcccccChHHHHHhcCCccccCcCCCccCchhHHHhHHhhhcCCCCCccCCCCCCcCCChHHHHhhhcCCCCce
Q psy12030         98 KYQCPQCKDSFFSWSAFHKNLSGMFACDVCGKEYKYKRGLYRHKKFECGQEPKYQCPHCPHRAKHKANLKTHIAPQLGVF  177 (245)
Q Consensus        98 ~~~C~~C~~~f~~~~~l~~h~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~  177 (245)
                      ...|..||..              ..|+.|+-.+.      .|.    . .....|..||....              ++
T Consensus       383 ~l~C~~Cg~~--------------~~C~~C~~~L~------~h~----~-~~~l~Ch~CG~~~~--------------p~  423 (665)
T PRK14873        383 SLACARCRTP--------------ARCRHCTGPLG------LPS----A-GGTPRCRWCGRAAP--------------DW  423 (665)
T ss_pred             eeEhhhCcCe--------------eECCCCCCcee------Eec----C-CCeeECCCCcCCCc--------------Cc
Confidence            4578888877              67888886532      232    2 45678888885321              36


Q ss_pred             eCCCCCCc
Q psy12030        178 ACNVCGKG  185 (245)
Q Consensus       178 ~C~~C~~~  185 (245)
                      .|+.||..
T Consensus       424 ~Cp~Cgs~  431 (665)
T PRK14873        424 RCPRCGSD  431 (665)
T ss_pred             cCCCCcCC
Confidence            78888865


No 163
>PF14446 Prok-RING_1:  Prokaryotic RING finger family 1
Probab=53.04  E-value=6.4  Score=22.86  Aligned_cols=8  Identities=38%  Similarity=1.082  Sum_probs=3.8

Q ss_pred             cccCCCcc
Q psy12030        206 YQCPHCPH  213 (245)
Q Consensus       206 ~~C~~C~~  213 (245)
                      ..|+.|+.
T Consensus        22 VvCp~Cga   29 (54)
T PF14446_consen   22 VVCPECGA   29 (54)
T ss_pred             EECCCCCC
Confidence            44555543


No 164
>KOG3214|consensus
Probab=52.90  E-value=2.8  Score=27.52  Aligned_cols=12  Identities=17%  Similarity=0.467  Sum_probs=6.3

Q ss_pred             cccCCCcccCCC
Q psy12030        206 YQCPHCPHKAKH  217 (245)
Q Consensus       206 ~~C~~C~~~f~~  217 (245)
                      ..|.+|+..|..
T Consensus        48 ~sC~iC~esFqt   59 (109)
T KOG3214|consen   48 ASCRICEESFQT   59 (109)
T ss_pred             eeeeehhhhhcc
Confidence            445555555543


No 165
>KOG4167|consensus
Probab=52.67  E-value=2.8  Score=37.78  Aligned_cols=24  Identities=13%  Similarity=0.362  Sum_probs=22.6

Q ss_pred             cccCCCcccCCChHHHHHhHhhhC
Q psy12030        206 YQCPHCPHKAKHKANLKTHIAIKH  229 (245)
Q Consensus       206 ~~C~~C~~~f~~~~~l~~H~~~~~  229 (245)
                      |.|.+|++.|--..++..||++|.
T Consensus       793 FpCreC~kvF~KiKSrNAHMK~Hr  816 (907)
T KOG4167|consen  793 FPCRECGKVFFKIKSRNAHMKTHR  816 (907)
T ss_pred             eehHHHHHHHHHHhhhhHHHHHHH
Confidence            899999999999999999999986


No 166
>PF12760 Zn_Tnp_IS1595:  Transposase zinc-ribbon domain;  InterPro: IPR024442 This zinc binding domain is found in a range of transposase proteins such as ISSPO8, ISSOD11, ISRSSP2 etc. It may be a zinc-binding beta ribbon domain that could bind DNA.
Probab=52.47  E-value=10  Score=21.10  Aligned_cols=8  Identities=50%  Similarity=1.597  Sum_probs=4.2

Q ss_pred             ccCCCCCC
Q psy12030        151 YQCPHCPH  158 (245)
Q Consensus       151 ~~C~~C~~  158 (245)
                      +.|+.||.
T Consensus        19 ~~CP~Cg~   26 (46)
T PF12760_consen   19 FVCPHCGS   26 (46)
T ss_pred             CCCCCCCC
Confidence            44555554


No 167
>PF07295 DUF1451:  Protein of unknown function (DUF1451);  InterPro: IPR009912 This family consists of several hypothetical bacterial proteins of around 160 residues in length. Members of this family contain four highly conserved cysteine resides toward the C-terminal region of the protein. The function of this family is unknown.
Probab=51.82  E-value=5.4  Score=28.64  Aligned_cols=27  Identities=22%  Similarity=0.565  Sum_probs=14.4

Q ss_pred             CcccCCCcccCCChHHHHHhHhhhCCCCCCCCCCCCc
Q psy12030        205 KYQCPHCPHKAKHKANLKTHIAIKHSDRILPPQEGRV  241 (245)
Q Consensus       205 ~~~C~~C~~~f~~~~~l~~H~~~~~~~~~~~C~~C~~  241 (245)
                      .|.|..||...          ...+.+..-+|+.||.
T Consensus       112 ~l~C~~Cg~~~----------~~~~~~~l~~Cp~C~~  138 (146)
T PF07295_consen  112 TLVCENCGHEV----------ELTHPERLPPCPKCGH  138 (146)
T ss_pred             eEecccCCCEE----------EecCCCcCCCCCCCCC
Confidence            36677776431          1223455666777663


No 168
>PF04959 ARS2:  Arsenite-resistance protein 2;  InterPro: IPR007042 This entry represents Arsenite-resistance protein 2 (also known as Serrate RNA effector molecule homolog) which is thought to play a role in arsenite resistance [], although does not directly confer arsenite resistance but rather modulates arsenic sensitivity []. Arsenite is a carcinogenic compound which can act as a comutagen by inhibiting DNA repair. It is also involved in cell cycle progression at S phase. ; PDB: 3AX1_A.
Probab=50.55  E-value=13  Score=28.55  Aligned_cols=25  Identities=32%  Similarity=0.592  Sum_probs=18.5

Q ss_pred             CCCccCCCCCCcCCChHHHHhhhcC
Q psy12030        148 EPKYQCPHCPHRAKHKANLKTHIAP  172 (245)
Q Consensus       148 ~~~~~C~~C~~~f~~~~~l~~H~~~  172 (245)
                      +..|.|..|+|.|....-...|+..
T Consensus        75 ~~K~~C~lc~KlFkg~eFV~KHI~n   99 (214)
T PF04959_consen   75 EDKWRCPLCGKLFKGPEFVRKHIFN   99 (214)
T ss_dssp             SEEEEE-SSS-EESSHHHHHHHHHH
T ss_pred             CCEECCCCCCcccCChHHHHHHHhh
Confidence            4459999999999999888888543


No 169
>COG1998 RPS31 Ribosomal protein S27AE [Translation, ribosomal structure and biogenesis]
Probab=49.77  E-value=14  Score=20.98  Aligned_cols=10  Identities=40%  Similarity=0.969  Sum_probs=5.6

Q ss_pred             ceeCCCCCCc
Q psy12030        176 VFACNVCGKG  185 (245)
Q Consensus       176 ~~~C~~C~~~  185 (245)
                      .|.|..||.+
T Consensus        37 R~~CGkCgyT   46 (51)
T COG1998          37 RWACGKCGYT   46 (51)
T ss_pred             eeEeccccce
Confidence            4566666544


No 170
>TIGR00595 priA primosomal protein N'. All proteins in this family for which functions are known are components of the primosome which is involved in replication, repair, and recombination.This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=49.72  E-value=10  Score=33.43  Aligned_cols=39  Identities=26%  Similarity=0.555  Sum_probs=23.0

Q ss_pred             CccCCCCcccccChHHHHHhcCCccccCcCCCccCchhHHHhHHhhhcCCCCCccCCCCCCcCC
Q psy12030         98 KYQCPQCKDSFFSWSAFHKNLSGMFACDVCGKEYKYKRGLYRHKKFECGQEPKYQCPHCPHRAK  161 (245)
Q Consensus        98 ~~~C~~C~~~f~~~~~l~~h~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~~C~~C~~~f~  161 (245)
                      ...|..||..              ..|+.|+...      ..|.    . .....|..||....
T Consensus       213 ~~~C~~Cg~~--------------~~C~~C~~~l------~~h~----~-~~~l~Ch~Cg~~~~  251 (505)
T TIGR00595       213 NLLCRSCGYI--------------LCCPNCDVSL------TYHK----K-EGKLRCHYCGYQEP  251 (505)
T ss_pred             eeEhhhCcCc--------------cCCCCCCCce------EEec----C-CCeEEcCCCcCcCC
Confidence            3578888877              5788887543      2232    1 44566777765543


No 171
>PRK05978 hypothetical protein; Provisional
Probab=49.69  E-value=6.1  Score=28.38  Aligned_cols=10  Identities=20%  Similarity=0.693  Sum_probs=6.0

Q ss_pred             ccCCCcccCC
Q psy12030        207 QCPHCPHKAK  216 (245)
Q Consensus       207 ~C~~C~~~f~  216 (245)
                      .|+.||..|.
T Consensus        54 ~C~~CG~~~~   63 (148)
T PRK05978         54 HCAACGEDFT   63 (148)
T ss_pred             CccccCCccc
Confidence            5666666554


No 172
>PF02176 zf-TRAF:  TRAF-type zinc finger; PDB: 2EOD_A 2YUC_A 3HCU_A 3HCS_B 3HCT_A.
Probab=48.95  E-value=9.4  Score=22.35  Aligned_cols=39  Identities=23%  Similarity=0.539  Sum_probs=19.9

Q ss_pred             eeCCC-CCCccCChhHHHHHHhHHhCCCCCcccCC----CcccCC
Q psy12030        177 FACNV-CGKGYRYKTGLYRHKREECGQEPKYQCPH----CPHKAK  216 (245)
Q Consensus       177 ~~C~~-C~~~f~~~~~l~~H~~~h~~~~~~~~C~~----C~~~f~  216 (245)
                      ..|+. |+..-..+..|..|+...-. .++..|++    |+..+.
T Consensus        10 v~C~~~cc~~~i~r~~l~~H~~~~C~-~~~v~C~~~~~GC~~~~~   53 (60)
T PF02176_consen   10 VPCPNGCCNEMIPRKELDDHLENECP-KRPVPCPYSPYGCKERVP   53 (60)
T ss_dssp             EE-TT--S-BEEECCCHHHHHHTTST-TSEEE-SS----S--EEE
T ss_pred             eeCCCCCcccceeHHHHHHHHHccCC-CCcEECCCCCCCCCCccc
Confidence            55665 33333345567777775545 66677777    776554


No 173
>COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair]
Probab=48.67  E-value=6.2  Score=36.23  Aligned_cols=19  Identities=21%  Similarity=0.546  Sum_probs=13.7

Q ss_pred             CccCCCCcccccChHHHHHhcCCccccCcCCCc
Q psy12030         98 KYQCPQCKDSFFSWSAFHKNLSGMFACDVCGKE  130 (245)
Q Consensus        98 ~~~C~~C~~~f~~~~~l~~h~~~~~~C~~C~~~  130 (245)
                      ...|..||..              ..|+.|+..
T Consensus       435 ~l~C~~Cg~v--------------~~Cp~Cd~~  453 (730)
T COG1198         435 LLLCRDCGYI--------------AECPNCDSP  453 (730)
T ss_pred             eeecccCCCc--------------ccCCCCCcc
Confidence            4668888877              577777754


No 174
>PRK00564 hypA hydrogenase nickel incorporation protein; Provisional
Probab=48.29  E-value=11  Score=25.92  Aligned_cols=10  Identities=20%  Similarity=0.856  Sum_probs=5.2

Q ss_pred             eeCCCCCCcc
Q psy12030        177 FACNVCGKGY  186 (245)
Q Consensus       177 ~~C~~C~~~f  186 (245)
                      ..|..||..|
T Consensus        72 ~~C~~Cg~~~   81 (117)
T PRK00564         72 LECKDCSHVF   81 (117)
T ss_pred             EEhhhCCCcc
Confidence            5555555443


No 175
>COG4530 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=47.69  E-value=11  Score=25.21  Aligned_cols=14  Identities=7%  Similarity=-0.047  Sum_probs=7.7

Q ss_pred             CCCccCCCCCCcCC
Q psy12030        148 EPKYQCPHCPHRAK  161 (245)
Q Consensus       148 ~~~~~C~~C~~~f~  161 (245)
                      ..|..|+.||++|.
T Consensus        24 rdPiVsPytG~s~P   37 (129)
T COG4530          24 RDPIVSPYTGKSYP   37 (129)
T ss_pred             CCccccCcccccch
Confidence            44555555665553


No 176
>PF07649 C1_3:  C1-like domain;  InterPro: IPR011424 This short domain is rich in cysteines and histidines. The pattern of conservation is similar to that found in IPR002219 from INTERPRO. C1 domains are protein kinase C-like zinc finger structures. Diacylglycerol (DAG) kinases (DGKs) have a two or three commonly conserved cysteine-rich C1 domains []. DGKs modulate the balance between the two signaling lipids, DAG and phosphatidic acid (PA), by phosphorylating DAG to yield PA []. The PKD (protein kinase D) family are novel DAG receptors. They have twin C1 domains, designated C1a and C1b, which bind DAG or phorbol esters. Individual C1 domains differ in ligand-binding activity and selectivity []. ; GO: 0047134 protein-disulfide reductase activity, 0055114 oxidation-reduction process; PDB: 1V5N_A.
Probab=47.03  E-value=8.9  Score=19.01  Aligned_cols=7  Identities=29%  Similarity=1.265  Sum_probs=2.3

Q ss_pred             eeCCCCC
Q psy12030        177 FACNVCG  183 (245)
Q Consensus       177 ~~C~~C~  183 (245)
                      |.|..|+
T Consensus        16 Y~C~~Cd   22 (30)
T PF07649_consen   16 YRCSECD   22 (30)
T ss_dssp             EE-TTT-
T ss_pred             EECccCC
Confidence            4444443


No 177
>cd00065 FYVE FYVE domain; Zinc-binding domain; targets proteins to membrane lipids via interaction with phosphatidylinositol-3-phosphate, PI3P; present in Fab1, YOTB, Vac1, and EEA1;
Probab=46.63  E-value=17  Score=20.98  Aligned_cols=28  Identities=25%  Similarity=0.594  Sum_probs=17.8

Q ss_pred             eCCCCCCccCChhHHHHHHhHHhCCCCCcccCCCcccCCCh
Q psy12030        178 ACNVCGKGYRYKTGLYRHKREECGQEPKYQCPHCPHKAKHK  218 (245)
Q Consensus       178 ~C~~C~~~f~~~~~l~~H~~~h~~~~~~~~C~~C~~~f~~~  218 (245)
                      .|..|++.|..            . .+.+.|..||..|-..
T Consensus         4 ~C~~C~~~F~~------------~-~rk~~Cr~Cg~~~C~~   31 (57)
T cd00065           4 SCMGCGKPFTL------------T-RRRHHCRNCGRIFCSK   31 (57)
T ss_pred             cCcccCccccC------------C-ccccccCcCcCCcChH
Confidence            46677777763            2 4456777777776543


No 178
>smart00154 ZnF_AN1 AN1-like Zinc finger. Zinc finger at the C-terminus of An1, a ubiquitin-like protein in Xenopus laevis.
Probab=46.35  E-value=10  Score=20.31  Aligned_cols=14  Identities=21%  Similarity=0.615  Sum_probs=11.7

Q ss_pred             CcccCCCcccCCCh
Q psy12030        205 KYQCPHCPHKAKHK  218 (245)
Q Consensus       205 ~~~C~~C~~~f~~~  218 (245)
                      ||.|..|+..|=..
T Consensus        12 ~f~C~~C~~~FC~~   25 (39)
T smart00154       12 GFKCRHCGNLFCGE   25 (39)
T ss_pred             CeECCccCCccccc
Confidence            78999999888765


No 179
>PF03811 Zn_Tnp_IS1:  InsA N-terminal domain;  InterPro: IPR003220 Insertion elements are mobile elements in DNA, usually encoding proteins required for transposition, for example transposases. Protein InsA is absolutely required for transposition of insertion element 1. This entry represents a short zinc binding domain found in IS1 InsA family protein. It is found at the N terminus of the protein and may be a DNA-binding domain.; GO: 0006313 transposition, DNA-mediated
Probab=45.56  E-value=4.4  Score=21.38  Aligned_cols=30  Identities=13%  Similarity=0.316  Sum_probs=14.6

Q ss_pred             cccCCCcccCCChHHHHHhHhhhCCCCCCCCCCC
Q psy12030        206 YQCPHCPHKAKHKANLKTHIAIKHSDRILPPQEG  239 (245)
Q Consensus       206 ~~C~~C~~~f~~~~~l~~H~~~~~~~~~~~C~~C  239 (245)
                      ..||.|+..    ..+.+|=+...|-..|+|..|
T Consensus         6 v~CP~C~s~----~~v~k~G~~~~G~qryrC~~C   35 (36)
T PF03811_consen    6 VHCPRCQST----EGVKKNGKSPSGHQRYRCKDC   35 (36)
T ss_pred             eeCCCCCCC----CcceeCCCCCCCCEeEecCcC
Confidence            345666532    113334444445555666655


No 180
>COG2331 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=45.52  E-value=13  Score=23.12  Aligned_cols=30  Identities=20%  Similarity=0.747  Sum_probs=18.3

Q ss_pred             eeCCCCCCccCChhHHHHHHhHHhCCCCCcccCCCccc
Q psy12030        177 FACNVCGKGYRYKTGLYRHKREECGQEPKYQCPHCPHK  214 (245)
Q Consensus       177 ~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~~C~~C~~~  214 (245)
                      |+|..||..|.    +.+|+    .+...-.|+.|+-.
T Consensus        13 Y~c~~cg~~~d----vvq~~----~ddplt~ce~c~a~   42 (82)
T COG2331          13 YECTECGNRFD----VVQAM----TDDPLTTCEECGAR   42 (82)
T ss_pred             EeecccchHHH----HHHhc----ccCccccChhhChH
Confidence            88888886654    44443    22444568888753


No 181
>COG4957 Predicted transcriptional regulator [Transcription]
Probab=45.33  E-value=15  Score=25.81  Aligned_cols=22  Identities=27%  Similarity=0.341  Sum_probs=10.9

Q ss_pred             cccCCCcccCCChHHHHHhHhhhCC
Q psy12030        206 YQCPHCPHKAKHKANLKTHIAIKHS  230 (245)
Q Consensus       206 ~~C~~C~~~f~~~~~l~~H~~~~~~  230 (245)
                      ..|-++|+.|.   +|++|+.+|+|
T Consensus        77 IicLEDGkkfK---SLKRHL~t~~g   98 (148)
T COG4957          77 IICLEDGKKFK---SLKRHLTTHYG   98 (148)
T ss_pred             EEEeccCcchH---HHHHHHhcccC
Confidence            34555555543   34555555554


No 182
>COG1675 TFA1 Transcription initiation factor IIE, alpha subunit [Transcription]
Probab=45.15  E-value=34  Score=25.46  Aligned_cols=11  Identities=27%  Similarity=0.863  Sum_probs=5.9

Q ss_pred             eeCCCCCCccC
Q psy12030        177 FACNVCGKGYR  187 (245)
Q Consensus       177 ~~C~~C~~~f~  187 (245)
                      |.|+.|...|+
T Consensus       114 y~C~~~~~r~s  124 (176)
T COG1675         114 YVCPNCHVKYS  124 (176)
T ss_pred             eeCCCCCCccc
Confidence            55655554444


No 183
>PRK03681 hypA hydrogenase nickel incorporation protein; Validated
Probab=44.65  E-value=12  Score=25.57  Aligned_cols=9  Identities=22%  Similarity=0.593  Sum_probs=5.3

Q ss_pred             eeCCCCCCc
Q psy12030        177 FACNVCGKG  185 (245)
Q Consensus       177 ~~C~~C~~~  185 (245)
                      ..|..||..
T Consensus        71 ~~C~~Cg~~   79 (114)
T PRK03681         71 CWCETCQQY   79 (114)
T ss_pred             EEcccCCCe
Confidence            566666643


No 184
>PF01363 FYVE:  FYVE zinc finger;  InterPro: IPR000306 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The FYVE zinc finger is named after four proteins that it has been found in: Fab1, YOTB/ZK632.12, Vac1, and EEA1. The FYVE finger has been shown to bind two zinc ions []. The FYVE finger has eight potential zinc coordinating cysteine positions. Many members of this family also include two histidines in a motif R+HHC+XCG, where + represents a charged residue and X any residue. FYVE-type domains are divided into two known classes: FYVE domains that specifically bind to phosphatidylinositol 3-phosphate in lipid bilayers and FYVE-related domains of undetermined function []. Those that bind to phosphatidylinositol 3-phosphate are often found in proteins targeted to lipid membranes that are involved in regulating membrane traffic [, , ]. Most FYVE domains target proteins to endosomes by binding specifically to phosphatidylinositol-3-phosphate at the membrane surface. By contrast, the CARP2 FYVE-like domain is not optimized to bind to phosphoinositides or insert into lipid bilayers. FYVE domains are distinguished from other zinc fingers by three signature sequences: an N-terminal WxxD motif, a basic R(R/K)HHCR patch, and a C-terminal RVC motif. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0046872 metal ion binding; PDB: 1HYI_A 1JOC_B 1HYJ_A 1DVP_A 3ZYQ_A 4AVX_A 1VFY_A 3T7L_A 1X4U_A 1WFK_A ....
Probab=44.54  E-value=13  Score=22.52  Aligned_cols=11  Identities=36%  Similarity=1.238  Sum_probs=3.9

Q ss_pred             eeccccccccc
Q psy12030         70 FECQVCGKRYK   80 (245)
Q Consensus        70 ~~C~~C~~~f~   80 (245)
                      -.|..|++.|.
T Consensus        10 ~~C~~C~~~F~   20 (69)
T PF01363_consen   10 SNCMICGKKFS   20 (69)
T ss_dssp             SB-TTT--B-B
T ss_pred             CcCcCcCCcCC
Confidence            35666666663


No 185
>PF08792 A2L_zn_ribbon:  A2L zinc ribbon domain;  InterPro: IPR014900 This zinc ribbon protein is found associated with some viral A2L transcription factors []. 
Probab=44.44  E-value=9.5  Score=19.63  Aligned_cols=11  Identities=0%  Similarity=-0.713  Sum_probs=5.1

Q ss_pred             CCCCCCCCccc
Q psy12030        233 ILPPQEGRVWT  243 (245)
Q Consensus       233 ~~~C~~C~~~f  243 (245)
                      -+.|..||..|
T Consensus        21 ~~~C~~Cg~~~   31 (33)
T PF08792_consen   21 YEVCIFCGSSF   31 (33)
T ss_pred             eEEcccCCcEe
Confidence            34455555444


No 186
>KOG2593|consensus
Probab=44.03  E-value=19  Score=30.55  Aligned_cols=33  Identities=18%  Similarity=0.390  Sum_probs=15.5

Q ss_pred             CcccCCCcccCCChHHHHHhHhhhCCCCCCCCCCCC
Q psy12030        205 KYQCPHCPHKAKHKANLKTHIAIKHSDRILPPQEGR  240 (245)
Q Consensus       205 ~~~C~~C~~~f~~~~~l~~H~~~~~~~~~~~C~~C~  240 (245)
                      .|.|+.|.+.|+....++.   .-....-|.|..|+
T Consensus       128 ~Y~Cp~C~kkyt~Lea~~L---~~~~~~~F~C~~C~  160 (436)
T KOG2593|consen  128 GYVCPNCQKKYTSLEALQL---LDNETGEFHCENCG  160 (436)
T ss_pred             cccCCccccchhhhHHHHh---hcccCceEEEecCC
Confidence            4555555555555444432   11223345555554


No 187
>PHA02998 RNA polymerase subunit; Provisional
Probab=43.96  E-value=3.3  Score=30.43  Aligned_cols=11  Identities=27%  Similarity=0.655  Sum_probs=6.8

Q ss_pred             cccCCCcccCC
Q psy12030        206 YQCPHCPHKAK  216 (245)
Q Consensus       206 ~~C~~C~~~f~  216 (245)
                      |.|..||+.|.
T Consensus       172 YkC~~CG~~wk  182 (195)
T PHA02998        172 HACRDCKKHFK  182 (195)
T ss_pred             EEcCCCCCccC
Confidence            56666666554


No 188
>smart00661 RPOL9 RNA polymerase subunit 9.
Probab=43.12  E-value=10  Score=21.44  Aligned_cols=13  Identities=15%  Similarity=0.606  Sum_probs=8.5

Q ss_pred             CcccCCCcccCCC
Q psy12030        205 KYQCPHCPHKAKH  217 (245)
Q Consensus       205 ~~~C~~C~~~f~~  217 (245)
                      .|.|+.||..+..
T Consensus        20 ~~vC~~Cg~~~~~   32 (52)
T smart00661       20 RFVCRKCGYEEPI   32 (52)
T ss_pred             EEECCcCCCeEEC
Confidence            5777777765543


No 189
>smart00064 FYVE Protein present in Fab1, YOTB, Vac1, and EEA1. The FYVE zinc finger is named after four proteins where it was first found: Fab1, YOTB/ZK632.12, Vac1, and EEA1. The FYVE finger has been shown to bind two Zn2+ ions. The FYVE finger has eight potential zinc coordinating cysteine positions. The FYVE finger is structurally related to the PF03107 C1_2:  C1 domain;  InterPro: IPR004146 This short domain is rich in cysteines and histidines. The pattern of conservation is similar to that found in DAG_PE-bind (IPR002219 from INTERPRO), therefore we have termed this domain DC1 for divergent C1 domain. This domain probably also binds to two zinc ions. The function of proteins with this domain is uncertain, however this domain may bind to molecules such as diacylglycerol. This family are found in plant proteins.
Probab=42.90  E-value=18  Score=17.98  Aligned_cols=7  Identities=29%  Similarity=1.156  Sum_probs=3.2

Q ss_pred             eeCCCCC
Q psy12030        177 FACNVCG  183 (245)
Q Consensus       177 ~~C~~C~  183 (245)
                      |.|..|+
T Consensus        16 Y~C~~c~   22 (30)
T PF03107_consen   16 YHCSECC   22 (30)
T ss_pred             EEeCCCC
Confidence            4444444


No 191
>KOG1280|consensus
Probab=42.86  E-value=22  Score=29.30  Aligned_cols=36  Identities=25%  Similarity=0.444  Sum_probs=27.7

Q ss_pred             eeCCCCCCccCChhHHHHHHhHHhCCCCCc--ccCCCcc
Q psy12030        177 FACNVCGKGYRYKTGLYRHKREECGQEPKY--QCPHCPH  213 (245)
Q Consensus       177 ~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~--~C~~C~~  213 (245)
                      |.|++|+..=.+...|..|....|. +-++  .|++|+-
T Consensus        80 ftCPyC~~~Gfte~~f~~Hv~s~Hp-da~~~~icp~c~~  117 (381)
T KOG1280|consen   80 FTCPYCGIMGFTERQFGTHVLSQHP-EASTSVICPLCAA  117 (381)
T ss_pred             ccCCcccccccchhHHHHHhhhcCc-ccCcceeeecccc
Confidence            8999999888888889999888777 4443  4677753


No 192
>PF14311 DUF4379:  Domain of unknown function (DUF4379)
Probab=42.75  E-value=20  Score=20.68  Aligned_cols=15  Identities=20%  Similarity=0.780  Sum_probs=8.8

Q ss_pred             eeCCCCCCccCChhH
Q psy12030        177 FACNVCGKGYRYKTG  191 (245)
Q Consensus       177 ~~C~~C~~~f~~~~~  191 (245)
                      ++|+.||..|.....
T Consensus        29 W~C~~Cgh~w~~~v~   43 (55)
T PF14311_consen   29 WKCPKCGHEWKASVN   43 (55)
T ss_pred             EECCCCCCeeEccHh
Confidence            666666666554433


No 193
>PF07282 OrfB_Zn_ribbon:  Putative transposase DNA-binding domain;  InterPro: IPR010095 This entry represents a region of a sequence similarity between a family of putative transposases of Thermoanaerobacter tengcongensis, smaller related proteins from Bacillus anthracis, putative transposes described by IPR001959 from INTERPRO, and other proteins. More information about these proteins can be found at Protein of the Month: Transposase [].
Probab=42.43  E-value=15  Score=22.28  Aligned_cols=28  Identities=21%  Similarity=0.666  Sum_probs=16.2

Q ss_pred             eCCCCCCccCChhHHHHHHhHHhCCCCCcccCCCcccCC
Q psy12030        178 ACNVCGKGYRYKTGLYRHKREECGQEPKYQCPHCPHKAK  216 (245)
Q Consensus       178 ~C~~C~~~f~~~~~l~~H~~~h~~~~~~~~C~~C~~~f~  216 (245)
                      .|+.||..-..           ....+.|.|+.||....
T Consensus        30 ~C~~CG~~~~~-----------~~~~r~~~C~~Cg~~~~   57 (69)
T PF07282_consen   30 TCPRCGHRNKK-----------RRSGRVFTCPNCGFEMD   57 (69)
T ss_pred             CccCccccccc-----------ccccceEEcCCCCCEEC
Confidence            46667655443           12255677777776643


No 194
>PF05191 ADK_lid:  Adenylate kinase, active site lid;  InterPro: IPR007862 Adenylate kinases (ADK; 2.7.4.3 from EC) are phosphotransferases that catalyse the Mg-dependent reversible conversion of ATP and AMP to two molecules of ADP, an essential reaction for many processes in living cells. In large variants of adenylate kinase, the AMP and ATP substrates are buried in a domain that undergoes conformational changes from an open to a closed state when bound to substrate; the ligand is then contained within a highly specific environment required for catalysis. Adenylate kinase is a 3-domain protein consisting of a large central CORE domain flanked by a LID domain on one side and the AMP-binding NMPbind domain on the other []. The LID domain binds ATP and covers the phosphates at the active site. The substrates first bind the CORE domain, followed by closure of the active site by the LID and NMPbind domains. Comparisons of adenylate kinases have revealed a particular divergence in the active site lid. In some organisms, particularly the Gram-positive bacteria, residues in the lid domain have been mutated to cysteines and these cysteine residues (two CX(n)C motifs) are responsible for the binding of a zinc ion. The bound zinc ion in the lid domain is clearly structurally homologous to Zinc-finger domains. However, it is unclear whether the adenylate kinase lid is a novel zinc-finger DNA/RNA binding domain, or that the lid bound zinc serves a purely structural function [].; GO: 0004017 adenylate kinase activity; PDB: 3BE4_A 2OSB_B 2ORI_A 2EU8_A 3DL0_A 1P3J_A 2QAJ_A 2OO7_A 2P3S_A 3DKV_A ....
Probab=41.48  E-value=20  Score=18.82  Aligned_cols=11  Identities=36%  Similarity=0.923  Sum_probs=7.2

Q ss_pred             eeccccccccc
Q psy12030         70 FECQVCGKRYK   80 (245)
Q Consensus        70 ~~C~~C~~~f~   80 (245)
                      +.|+.||.+|.
T Consensus         2 r~C~~Cg~~Yh   12 (36)
T PF05191_consen    2 RICPKCGRIYH   12 (36)
T ss_dssp             EEETTTTEEEE
T ss_pred             cCcCCCCCccc
Confidence            45777777764


No 195
>KOG3408|consensus
Probab=41.16  E-value=13  Score=25.51  Aligned_cols=23  Identities=26%  Similarity=0.509  Sum_probs=15.4

Q ss_pred             CcccCCCcccCCChHHHHHhHhh
Q psy12030        205 KYQCPHCPHKAKHKANLKTHIAI  227 (245)
Q Consensus       205 ~~~C~~C~~~f~~~~~l~~H~~~  227 (245)
                      .|-|-.|.+-|.+...|..|.++
T Consensus        57 qfyCi~CaRyFi~~~~l~~H~kt   79 (129)
T KOG3408|consen   57 QFYCIECARYFIDAKALKTHFKT   79 (129)
T ss_pred             eeehhhhhhhhcchHHHHHHHhc
Confidence            46677777777777777776654


No 196
>COG0068 HypF Hydrogenase maturation factor [Posttranslational modification, protein turnover, chaperones]
Probab=40.32  E-value=18  Score=32.96  Aligned_cols=40  Identities=5%  Similarity=-0.057  Sum_probs=21.0

Q ss_pred             ccccceeeeeecccCcceeeeeccCCCCCCcccccccccC
Q psy12030         16 MPVCLYAMFVEKSTNTKMEFIAIRNSNVDKSLNTNVLNAH   55 (245)
Q Consensus        16 ~~~c~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~   55 (245)
                      |..||.+|...+.+.=..+...+.....|..|.+.+.+..
T Consensus       126 CT~CGPRfTIi~alPYDR~nTsM~~F~lC~~C~~EY~dP~  165 (750)
T COG0068         126 CTNCGPRFTIIEALPYDRENTSMADFPLCPFCDKEYKDPL  165 (750)
T ss_pred             cCCCCcceeeeccCCCCcccCccccCcCCHHHHHHhcCcc
Confidence            4555555555555555555555555555555554444433


No 197
>KOG4377|consensus
Probab=39.64  E-value=23  Score=29.93  Aligned_cols=101  Identities=17%  Similarity=0.405  Sum_probs=63.6

Q ss_pred             ccc--CcCCCccCchhHHHhHHhhhcCCC-----------CCccCC--CCCCcCCChHHHHhhhcCCCCc---------e
Q psy12030        122 FAC--DVCGKEYKYKRGLYRHKKFECGQE-----------PKYQCP--HCPHRAKHKANLKTHIAPQLGV---------F  177 (245)
Q Consensus       122 ~~C--~~C~~~f~~~~~l~~H~~~h~~~~-----------~~~~C~--~C~~~f~~~~~l~~H~~~h~~~---------~  177 (245)
                      |.|  ..|+..+.++..+.+|..+|...+           ..|.|.  .|.+   +-++...|..-|+..         |
T Consensus       272 yhcl~e~C~ykr~~k~DvirH~~~hkkrdnsL~dgf~rfs~syhC~~~~C~k---sTsdV~~h~nFht~~~n~Gfrrthf  348 (480)
T KOG4377|consen  272 YHCLNEYCFYKRGQKNDVIRHVEIHKKRDNSLIDGFHRFSNSYHCTGQICEK---STSDVLLHDNFHTDKRNNGFRRTHF  348 (480)
T ss_pred             hcccCccccccccchhhhHHHHHHHhhcccccccchhhcCccchhhhcccCc---ccccccccCccccccccCceeccee
Confidence            555  359888888999999988885422           225564  4877   444555665555542         7


Q ss_pred             eCCCCC--CccCChhHHHHHHhHHhCC---------------CC------------CcccCC--CcccCCChHHHHHhHh
Q psy12030        178 ACNVCG--KGYRYKTGLYRHKREECGQ---------------EP------------KYQCPH--CPHKAKHKANLKTHIA  226 (245)
Q Consensus       178 ~C~~C~--~~f~~~~~l~~H~~~h~~~---------------~~------------~~~C~~--C~~~f~~~~~l~~H~~  226 (245)
                      .|..+|  .+|.    ...|...|-.+               +-            .+-|..  |+..+.+.+.+..|.+
T Consensus       349 hC~r~gCTdtfK----~~khk~yh~kdda~~~dGfkkf~k~e~cay~gCkys~~cnhfhc~r~Gc~~tl~s~sqm~shkr  424 (480)
T KOG4377|consen  349 HCQRIGCTDTFK----DSKHKPYHYKDDAGEIDGFKKFFKDENCAYTGCKYSGICNHFHCDRLGCEATLYSVSQMASHKR  424 (480)
T ss_pred             EEeccCCccccc----cccccccccCcchhhhhhhhhhhccccCCccCcccccceeeeeecccCCceEEEehhhhhhhhh
Confidence            788877  5555    33444333110               11            134533  8999999999999988


Q ss_pred             hhC
Q psy12030        227 IKH  229 (245)
Q Consensus       227 ~~~  229 (245)
                      .|-
T Consensus       425 khe  427 (480)
T KOG4377|consen  425 KHE  427 (480)
T ss_pred             hhh
Confidence            774


No 198
>KOG3352|consensus
Probab=39.45  E-value=15  Score=26.25  Aligned_cols=12  Identities=33%  Similarity=0.844  Sum_probs=6.1

Q ss_pred             CCcccCCCcccC
Q psy12030        204 PKYQCPHCPHKA  215 (245)
Q Consensus       204 ~~~~C~~C~~~f  215 (245)
                      ++.+|++||..|
T Consensus       132 e~~rc~eCG~~f  143 (153)
T KOG3352|consen  132 ETQRCPECGHYF  143 (153)
T ss_pred             CcccCCcccceE
Confidence            344555555444


No 199
>KOG4124|consensus
Probab=39.35  E-value=9.4  Score=31.34  Aligned_cols=42  Identities=21%  Similarity=0.374  Sum_probs=28.9

Q ss_pred             CCCcccCC--CcccCCChHHHHHhHhhhC-------------------CCCCCCCCCCCcccc
Q psy12030        203 EPKYQCPH--CPHKAKHKANLKTHIAIKH-------------------SDRILPPQEGRVWTR  244 (245)
Q Consensus       203 ~~~~~C~~--C~~~f~~~~~l~~H~~~~~-------------------~~~~~~C~~C~~~f~  244 (245)
                      .++|+|++  |.+.+.....|..|...-|                   ..|+|+|++|.++.+
T Consensus       347 ~~~~~~~vp~~~~~~~n~ng~~~~~~~~h~s~i~~~s~~~~ph~~~~~~nk~~r~~i~~~~~k  409 (442)
T KOG4124|consen  347 DKPYKCPVPNCDKAYKNQNGLKYHKLHGHCSPITTPTPAPIPHQGFVVENKPYRCEVCSKRYK  409 (442)
T ss_pred             cCCCCCCCCcchhhcccCcceeeccccCcCCCCCCCCCCCCCcceeeeccCcccChhhhhhhc
Confidence            45677744  7777777667776654333                   358899999988764


No 200
>COG1655 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=38.77  E-value=8.4  Score=29.68  Aligned_cols=9  Identities=22%  Similarity=0.733  Sum_probs=6.8

Q ss_pred             eeCCCCCCc
Q psy12030        177 FACNVCGKG  185 (245)
Q Consensus       177 ~~C~~C~~~  185 (245)
                      +.|+.|+.+
T Consensus        63 vvCP~C~yA   71 (267)
T COG1655          63 VVCPICYYA   71 (267)
T ss_pred             EEcchhhHH
Confidence            678888864


No 201
>PF03833 PolC_DP2:  DNA polymerase II large subunit DP2;  InterPro: IPR016033 DP2 is the large subunit of a two-subunit novel archaebacterial replicative DNA polymerase first characterised for Pyrococcus furiosus. The structure of DP2 appears to be organised as a ~950 residue component separated from a ~300 residue component by a ~150 residue intein. The other subunit, DP1, has sequence similarity to the eukaryotic DNA polymerase delta small subunit. This entry represents the N-terminal ~950 residue component of DP2.; GO: 0003887 DNA-directed DNA polymerase activity; PDB: 3O59_X.
Probab=37.92  E-value=11  Score=34.99  Aligned_cols=12  Identities=50%  Similarity=1.226  Sum_probs=0.0

Q ss_pred             CCCcccCCCccc
Q psy12030        203 EPKYQCPHCPHK  214 (245)
Q Consensus       203 ~~~~~C~~C~~~  214 (245)
                      +.-|.|+.|+..
T Consensus       678 ~~~~~Cp~C~~~  689 (900)
T PF03833_consen  678 EPVYVCPDCGIE  689 (900)
T ss_dssp             ------------
T ss_pred             ccceeccccccc
Confidence            344566666544


No 202
>PRK05580 primosome assembly protein PriA; Validated
Probab=37.82  E-value=20  Score=32.91  Aligned_cols=20  Identities=20%  Similarity=0.479  Sum_probs=13.8

Q ss_pred             CccCCCCcccccChHHHHHhcCCccccCcCCCcc
Q psy12030         98 KYQCPQCKDSFFSWSAFHKNLSGMFACDVCGKEY  131 (245)
Q Consensus        98 ~~~C~~C~~~f~~~~~l~~h~~~~~~C~~C~~~f  131 (245)
                      ...|..||..              ..|+.|+..+
T Consensus       381 ~~~C~~Cg~~--------------~~C~~C~~~l  400 (679)
T PRK05580        381 FLLCRDCGWV--------------AECPHCDASL  400 (679)
T ss_pred             ceEhhhCcCc--------------cCCCCCCCce
Confidence            4667778776              5777787643


No 203
>TIGR01206 lysW lysine biosynthesis protein LysW. This very small, poorly characterized protein has been shown essential in Thermus thermophilus for an unusual pathway of Lys biosynthesis from aspartate by way of alpha-aminoadipate (AAA) rather than diaminopimelate. It is found also in Deinococcus radiodurans and Pyrococcus horikoshii, which appear to share the AAA pathway.
Probab=36.97  E-value=16  Score=21.30  Aligned_cols=10  Identities=50%  Similarity=1.212  Sum_probs=4.9

Q ss_pred             eecccccccc
Q psy12030         70 FECQVCGKRY   79 (245)
Q Consensus        70 ~~C~~C~~~f   79 (245)
                      +.|+.||..+
T Consensus         3 ~~CP~CG~~i   12 (54)
T TIGR01206         3 FECPDCGAEI   12 (54)
T ss_pred             cCCCCCCCEE
Confidence            3455555544


No 204
>PF10013 DUF2256:  Uncharacterized protein conserved in bacteria (DUF2256);  InterPro: IPR017136 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function.
Probab=36.65  E-value=30  Score=18.89  Aligned_cols=12  Identities=33%  Similarity=1.223  Sum_probs=5.7

Q ss_pred             eCCCCCCccCCh
Q psy12030        178 ACNVCGKGYRYK  189 (245)
Q Consensus       178 ~C~~C~~~f~~~  189 (245)
                      .|.+||+.|...
T Consensus        10 ~C~~C~rpf~WR   21 (42)
T PF10013_consen   10 ICPVCGRPFTWR   21 (42)
T ss_pred             cCcccCCcchHH
Confidence            344555555443


No 205
>PF01215 COX5B:  Cytochrome c oxidase subunit Vb This family consists of chains F and S ;  InterPro: IPR002124 Cytochrome c oxidase (1.9.3.1 from EC) is an oligomeric enzymatic complex which is a component of the respiratory chain complex and is involved in the transfer of electrons from cytochrome c to oxygen []. In eukaryotes this enzyme complex is located in the mitochondrial inner membrane; in aerobic prokaryotes it is found in the plasma membrane.  In eukaryotes, in addition to the three large subunits, I, II and III, that form the catalytic centre of the enzyme complex, there are a variable number of small polypeptidic subunits. One of these subunits, which is known as Vb in mammals, V in Dictyostelium discoideum (Slime mold) and IV in yeast, binds a zinc atom. The sequence of subunit Vb is well conserved and includes three conserved cysteines that coordinate the zinc ion [, ]. Two of these cysteines are clustered in the C-terminal section of the subunit.; GO: 0004129 cytochrome-c oxidase activity, 0005740 mitochondrial envelope; PDB: 2EIL_S 2ZXW_S 3ASN_S 1OCO_S 3AG4_S 3ABK_S 1OCZ_S 1OCC_F 3ASO_S 3ABL_S ....
Probab=36.56  E-value=6.3  Score=27.84  Aligned_cols=13  Identities=23%  Similarity=0.626  Sum_probs=8.6

Q ss_pred             CCCcccCCCcccC
Q psy12030        203 EPKYQCPHCPHKA  215 (245)
Q Consensus       203 ~~~~~C~~C~~~f  215 (245)
                      .+|.+|+.||..|
T Consensus       110 g~~~RCpeCG~~f  122 (136)
T PF01215_consen  110 GKPQRCPECGQVF  122 (136)
T ss_dssp             TSEEEETTTEEEE
T ss_pred             CCccCCCCCCeEE
Confidence            3467777777655


No 206
>PF06220 zf-U1:  U1 zinc finger;  InterPro: IPR013085 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  C2H2-type (classical) zinc fingers (Znf) were the first class to be characterised. They contain a short beta hairpin and an alpha helix (beta/beta/alpha structure), where a single zinc atom is held in place by Cys(2)His(2) (C2H2) residues in a tetrahedral array. C2H2 Znf's can be divided into three groups based on the number and pattern of fingers: triple-C2H2 (binds single ligand), multiple-adjacent-C2H2 (binds multiple ligands), and separated paired-C2H2 []. C2H2 Znf's are the most common DNA-binding motifs found in eukaryotic transcription factors, and have also been identified in prokaryotes []. Transcription factors usually contain several Znf's (each with a conserved beta/beta/alpha structure) capable of making multiple contacts along the DNA, where the C2H2 Znf motifs recognise DNA sequences by binding to the major groove of DNA via a short alpha-helix in the Znf, the Znf spanning 3-4 bases of the DNA []. C2H2 Znf's can also bind to RNA and protein targets []. This entry represents a C2H2-type zinc finger motif found in several U1 small nuclear ribonucleoprotein C (U1-C) proteins. Some proteins contain multiple copies of this motif. The U1 small nuclear ribonucleoprotein (U1 snRNP) binds to the pre-mRNA 5' splice site at early stages of spliceosome assembly. Recruitment of U1 to a class of weak 5' splice site is promoted by binding of the protein TIA-1 to uridine-rich sequences immediately downstream from the 5' splice site. Binding of TIA-1 in the vicinity of a 5' splice site helps to stabilise U1 snRNP recruitment, at least in part, via a direct interaction with U1-C, thus providing one molecular mechanism for the function of this splicing regulator []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 2VRD_A.
Probab=36.46  E-value=33  Score=18.25  Aligned_cols=21  Identities=24%  Similarity=0.458  Sum_probs=8.3

Q ss_pred             CcccCCCcccCC-Ch-HHHHHhH
Q psy12030        205 KYQCPHCPHKAK-HK-ANLKTHI  225 (245)
Q Consensus       205 ~~~C~~C~~~f~-~~-~~l~~H~  225 (245)
                      .|-|++|...|+ +. +.-+.|.
T Consensus         3 ryyCdyC~~~~~~d~~~~Rk~H~   25 (38)
T PF06220_consen    3 RYYCDYCKKYLTHDSPSIRKQHE   25 (38)
T ss_dssp             S-B-TTT--B-S--SHHHHHHHT
T ss_pred             CeecccccceecCCChHHHHHhh
Confidence            477888887773 33 3335554


No 207
>PF01155 HypA:  Hydrogenase expression/synthesis hypA family;  InterPro: IPR000688 Bacterial membrane-bound nickel-dependent hydrogenases requires a number of accessory proteins which are involved in their maturation. The exact role of these proteins is not yet clear, but some seem to be required for the incorporation of the nickel ions []. One of these proteins is generally known as hypA. It is a protein of about 12 to 14 kDa that contains, in its C-terminal region, four conserved cysteines that form a zinc-finger like motif. Escherichia coli has two proteins that belong to this family, hypA and hybF. A homologue, MJ0214, has also been found in a number of archaeal species, including the genome of Methanocaldococcus jannaschii (Methanococcus jannaschii).; GO: 0016151 nickel ion binding, 0006464 protein modification process; PDB: 2KDX_A 3A44_D 3A43_B.
Probab=36.31  E-value=11  Score=25.63  Aligned_cols=12  Identities=25%  Similarity=0.730  Sum_probs=6.8

Q ss_pred             eeCCCCCCccCC
Q psy12030        177 FACNVCGKGYRY  188 (245)
Q Consensus       177 ~~C~~C~~~f~~  188 (245)
                      ..|..||..|..
T Consensus        71 ~~C~~Cg~~~~~   82 (113)
T PF01155_consen   71 ARCRDCGHEFEP   82 (113)
T ss_dssp             EEETTTS-EEEC
T ss_pred             EECCCCCCEEec
Confidence            566666666653


No 208
>PF13453 zf-TFIIB:  Transcription factor zinc-finger
Probab=36.23  E-value=18  Score=19.42  Aligned_cols=14  Identities=29%  Similarity=0.752  Sum_probs=5.7

Q ss_pred             ccCCCCcccccChH
Q psy12030         99 YQCPQCKDSFFSWS  112 (245)
Q Consensus        99 ~~C~~C~~~f~~~~  112 (245)
                      ..|+.|+..+.+..
T Consensus        20 d~C~~C~G~W~d~~   33 (41)
T PF13453_consen   20 DVCPSCGGIWFDAG   33 (41)
T ss_pred             EECCCCCeEEccHH
Confidence            33444444443333


No 209
>KOG0978|consensus
Probab=35.69  E-value=22  Score=32.41  Aligned_cols=20  Identities=20%  Similarity=0.511  Sum_probs=12.8

Q ss_pred             CcccCCCcccCCChHHHHHh
Q psy12030        205 KYQCPHCPHKAKHKANLKTH  224 (245)
Q Consensus       205 ~~~C~~C~~~f~~~~~l~~H  224 (245)
                      .-+||.||..|....-+..|
T Consensus       678 qRKCP~Cn~aFganDv~~I~  697 (698)
T KOG0978|consen  678 QRKCPKCNAAFGANDVHRIH  697 (698)
T ss_pred             cCCCCCCCCCCCcccccccC
Confidence            34777787777766555444


No 210
>KOG0782|consensus
Probab=35.50  E-value=4.1  Score=35.71  Aligned_cols=51  Identities=24%  Similarity=0.423  Sum_probs=28.4

Q ss_pred             HHhcchhcccCCCCCccCCCCcccccChHHHHHhcCCccccCcCCCccCchh
Q psy12030         84 GLHRHKQDECGQEPKYQCPQCKDSFFSWSAFHKNLSGMFACDVCGKEYKYKR  135 (245)
Q Consensus        84 ~l~~H~~~h~~~~~~~~C~~C~~~f~~~~~l~~h~~~~~~C~~C~~~f~~~~  135 (245)
                      .|.+|--.|.. ...-+|..||+.|..+..++.-......|+.|-..|..+.
T Consensus       240 ~fvrHHWVHrr-RqeGkC~~CgKgFQQKf~FhsKEivAisCSWCKqayH~Kv  290 (1004)
T KOG0782|consen  240 GFVRHHWVHRR-RQEGKCNTCGKGFQQKFFFHSKEIVAISCSWCKQAYHLKV  290 (1004)
T ss_pred             cchHHhHhhHh-hhccccchhhhhhhhheeeccccEEEEEehHHHHHhhcch
Confidence            34444444433 3345677777777666665554444566666666665543


No 211
>PF01927 Mut7-C:  Mut7-C RNAse domain;  InterPro: IPR002782 This prokaryotic family of proteins have no known function. The proteins contain four conserved cysteines that may be involved in metal binding or disulphide bridges.
Probab=35.31  E-value=41  Score=24.08  Aligned_cols=17  Identities=29%  Similarity=0.532  Sum_probs=10.6

Q ss_pred             eeCCCCCCccCChhHHH
Q psy12030        177 FACNVCGKGYRYKTGLY  193 (245)
Q Consensus       177 ~~C~~C~~~f~~~~~l~  193 (245)
                      |.|+.||+.|-.-+++.
T Consensus       125 ~~C~~C~kiyW~GsH~~  141 (147)
T PF01927_consen  125 WRCPGCGKIYWEGSHWR  141 (147)
T ss_pred             EECCCCCCEecccccHH
Confidence            66777777666555443


No 212
>TIGR01384 TFS_arch transcription factor S, archaeal. There has been an apparent duplication event in the Halobacteriaceae lineage (Haloarcula, Haloferax, Haloquadratum, Halobacterium and Natromonas). There appears to be a separate duplication in Methanosphaera stadtmanae.
Probab=35.01  E-value=4.3  Score=27.13  Aligned_cols=11  Identities=9%  Similarity=-0.239  Sum_probs=6.2

Q ss_pred             CCCCCCCcccc
Q psy12030        234 LPPQEGRVWTR  244 (245)
Q Consensus       234 ~~C~~C~~~f~  244 (245)
                      |.|..||+.++
T Consensus        91 y~C~~C~~~w~  101 (104)
T TIGR01384        91 YKCTKCGYVWR  101 (104)
T ss_pred             EEeCCCCCeeE
Confidence            55655655544


No 213
>PF08790 zf-LYAR:  LYAR-type C2HC zinc finger ;  InterPro: IPR014898 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This C2HC zinc finger domain is found in LYAR proteins such as Q08288 from SWISSPROT, which are involved in cell growth regulation.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 1WJV_A.
Probab=34.60  E-value=7.8  Score=19.13  Aligned_cols=9  Identities=33%  Similarity=1.006  Sum_probs=4.7

Q ss_pred             eCCCCCCcc
Q psy12030        178 ACNVCGKGY  186 (245)
Q Consensus       178 ~C~~C~~~f  186 (245)
                      .|-.|++.|
T Consensus         2 sCiDC~~~F   10 (28)
T PF08790_consen    2 SCIDCSKDF   10 (28)
T ss_dssp             EETTTTEEE
T ss_pred             eeecCCCCc
Confidence            455555555


No 214
>PF07975 C1_4:  TFIIH C1-like domain;  InterPro: IPR004595 All proteins in this domain for which functions are known are components of the TFIIH complex which is involved in the initiation of transcription and nucleotide excision repair. It includes the yeast transcription factor Ssl1 (Suppressor of stem-loop protein 1) that is essential for translation initiation and affects UV resistance. The C-terminal region is essential for transcription activity. This regions binds three zinc atoms through two independent domain. The first contains a C4 zinc finger motif, whereas the second is characterised by a CX(2)CX(2-4)FCADCD motif. The solution structure of the second C-terminal domain revealed homology with the regulatory domain of protein kinase C [].; GO: 0006281 DNA repair, 0005634 nucleus; PDB: 1Z60_A.
Probab=34.48  E-value=23  Score=20.37  Aligned_cols=22  Identities=23%  Similarity=0.563  Sum_probs=7.7

Q ss_pred             ccCCCCCCcCCChHHHHhhhcC
Q psy12030        151 YQCPHCPHRAKHKANLKTHIAP  172 (245)
Q Consensus       151 ~~C~~C~~~f~~~~~l~~H~~~  172 (245)
                      |.|+.|+..|-..-.+..|...
T Consensus        22 y~C~~C~~~FC~dCD~fiHE~L   43 (51)
T PF07975_consen   22 YRCPKCKNHFCIDCDVFIHETL   43 (51)
T ss_dssp             E--TTTT--B-HHHHHTTTTTS
T ss_pred             EECCCCCCccccCcChhhhccc
Confidence            4444444444444444444333


No 215
>PF04216 FdhE:  Protein involved in formate dehydrogenase formation;  InterPro: IPR006452 This family of sequences describe an accessory protein required for the assembly of formate dehydrogenase of certain proteobacteria although not present in the final complex []. The exact nature of the function of FdhE in the assembly of the complex is unknown, but considering the presence of selenocysteine, molybdopterin, iron-sulphur clusters and cytochrome b556, it is likely to be involved in the insertion of cofactors. ; GO: 0005737 cytoplasm; PDB: 2FIY_B.
Probab=34.20  E-value=4.4  Score=32.81  Aligned_cols=8  Identities=38%  Similarity=1.074  Sum_probs=4.1

Q ss_pred             eeCCCCCC
Q psy12030        177 FACNVCGK  184 (245)
Q Consensus       177 ~~C~~C~~  184 (245)
                      +.|..|+.
T Consensus       239 e~C~~C~~  246 (290)
T PF04216_consen  239 EVCESCGS  246 (290)
T ss_dssp             EEETTTTE
T ss_pred             EECCcccc
Confidence            45555553


No 216
>PF04780 DUF629:  Protein of unknown function (DUF629);  InterPro: IPR006865 This domain represents a region of several plant proteins of unknown function. A C2H2 zinc finger is predicted in this region in some family members, but the spacing between the cysteine residues is not conserved throughout the family.
Probab=34.12  E-value=29  Score=30.08  Aligned_cols=26  Identities=23%  Similarity=0.579  Sum_probs=20.0

Q ss_pred             CcccCCCcccCCChHHHHHhHhhhCC
Q psy12030        205 KYQCPHCPHKAKHKANLKTHIAIKHS  230 (245)
Q Consensus       205 ~~~C~~C~~~f~~~~~l~~H~~~~~~  230 (245)
                      -+.|+.|.+.|.+...+..|+...|.
T Consensus        57 FWiCp~CskkF~d~~~~~~H~~~eH~   82 (466)
T PF04780_consen   57 FWICPRCSKKFSDAESCLSHMEQEHP   82 (466)
T ss_pred             EeeCCcccceeCCHHHHHHHHHHhhh
Confidence            36688888888888888888876654


No 217
>KOG3408|consensus
Probab=33.88  E-value=21  Score=24.57  Aligned_cols=27  Identities=19%  Similarity=0.396  Sum_probs=23.3

Q ss_pred             CCCceecccccccccChhHHhcchhcc
Q psy12030         66 YSKGFECQVCGKRYKYKRGLHRHKQDE   92 (245)
Q Consensus        66 ~~~~~~C~~C~~~f~~~~~l~~H~~~h   92 (245)
                      +-..|.|-.|.+-|.+...|+.|.++.
T Consensus        54 G~GqfyCi~CaRyFi~~~~l~~H~ktK   80 (129)
T KOG3408|consen   54 GGGQFYCIECARYFIDAKALKTHFKTK   80 (129)
T ss_pred             CCceeehhhhhhhhcchHHHHHHHhcc
Confidence            445699999999999999999998753


No 218
>PF14445 Prok-RING_2:  Prokaryotic RING finger family 2
Probab=33.79  E-value=14  Score=21.02  Aligned_cols=10  Identities=30%  Similarity=0.886  Sum_probs=4.3

Q ss_pred             cccCCCcccC
Q psy12030        206 YQCPHCPHKA  215 (245)
Q Consensus       206 ~~C~~C~~~f  215 (245)
                      |.|..|+.+|
T Consensus         8 y~CDLCn~~~   17 (57)
T PF14445_consen    8 YSCDLCNSSH   17 (57)
T ss_pred             HhHHhhcccC
Confidence            4444444433


No 219
>COG1779 C4-type Zn-finger protein [General function prediction only]
Probab=33.75  E-value=16  Score=27.50  Aligned_cols=12  Identities=25%  Similarity=0.429  Sum_probs=7.2

Q ss_pred             eeCCCCCCccCC
Q psy12030        177 FACNVCGKGYRY  188 (245)
Q Consensus       177 ~~C~~C~~~f~~  188 (245)
                      +.|..||+.+..
T Consensus        44 ~~C~~CgYR~~D   55 (201)
T COG1779          44 GVCERCGYRSTD   55 (201)
T ss_pred             EEccccCCcccc
Confidence            556666665554


No 220
>KOG0717|consensus
Probab=33.51  E-value=24  Score=30.36  Aligned_cols=22  Identities=27%  Similarity=0.431  Sum_probs=18.5

Q ss_pred             cccCCCcccCCChHHHHHhHhh
Q psy12030        206 YQCPHCPHKAKHKANLKTHIAI  227 (245)
Q Consensus       206 ~~C~~C~~~f~~~~~l~~H~~~  227 (245)
                      +-|.+|+++|.+...|..|..+
T Consensus       293 lyC~vCnKsFKseKq~kNHEnS  314 (508)
T KOG0717|consen  293 LYCVVCNKSFKSEKQLKNHENS  314 (508)
T ss_pred             eEEeeccccccchHHHHhhHHH
Confidence            7888888888888888888764


No 221
>COG1656 Uncharacterized conserved protein [Function unknown]
Probab=33.13  E-value=53  Score=24.07  Aligned_cols=16  Identities=31%  Similarity=0.679  Sum_probs=9.2

Q ss_pred             eeCCCCCCccCChhHH
Q psy12030        177 FACNVCGKGYRYKTGL  192 (245)
Q Consensus       177 ~~C~~C~~~f~~~~~l  192 (245)
                      |.|+.||+.|-.-+++
T Consensus       131 ~~C~~CgkiYW~GsHw  146 (165)
T COG1656         131 YRCPKCGKIYWKGSHW  146 (165)
T ss_pred             eECCCCcccccCchHH
Confidence            5566666666554444


No 222
>KOG1280|consensus
Probab=32.93  E-value=38  Score=27.95  Aligned_cols=37  Identities=22%  Similarity=0.522  Sum_probs=28.5

Q ss_pred             CCCccCCCCCCcCCChHHHHhhhcCCCCc----eeCCCCCC
Q psy12030        148 EPKYQCPHCPHRAKHKANLKTHIAPQLGV----FACNVCGK  184 (245)
Q Consensus       148 ~~~~~C~~C~~~f~~~~~l~~H~~~h~~~----~~C~~C~~  184 (245)
                      ...|.|+.|+.+-.+...|..|+...+..    ..|++|+.
T Consensus        77 ~qSftCPyC~~~Gfte~~f~~Hv~s~Hpda~~~~icp~c~~  117 (381)
T KOG1280|consen   77 PQSFTCPYCGIMGFTERQFGTHVLSQHPEASTSVICPLCAA  117 (381)
T ss_pred             cccccCCcccccccchhHHHHHhhhcCcccCcceeeecccc
Confidence            44699999999999999999997544332    67888764


No 223
>PF01428 zf-AN1:  AN1-like Zinc finger;  InterPro: IPR000058 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents the AN1-type zinc finger domain, which has a dimetal (zinc)-bound alpha/beta fold. This domain was first identified as a zinc finger at the C terminus of AN1 Q91889 from SWISSPROT, a ubiquitin-like protein in Xenopus laevis []. The AN1-type zinc finger contains six conserved cysteines and two histidines that could potentially coordinate 2 zinc atoms. Certain stress-associated proteins (SAP) contain AN1 domain, often in combination with A20 zinc finger domains (SAP8) or C2H2 domains (SAP16) []. For example, the human protein Znf216 has an A20 zinc-finger at the N terminus and an AN1 zinc-finger at the C terminus, acting to negatively regulate the NFkappaB activation pathway and to interact with components of the immune response like RIP, IKKgamma and TRAF6. The interact of Znf216 with IKK-gamma and RIP is mediated by the A20 zinc-finger domain, while its interaction with TRAF6 is mediated by the AN1 zinc-finger domain; therefore, both zinc-finger domains are involved in regulating the immune response []. The AN1 zinc finger domain is also found in proteins containing a ubiquitin-like domain, which are involved in the ubiquitination pathway []. Proteins containing an AN1-type zinc finger include:   Ascidian posterior end mark 6 (pem-6) protein []. Human AWP1 protein (associated with PRK1), which is expressed during early embryogenesis []. Human immunoglobulin mu binding protein 2 (SMUBP-2), mutations in which cause muscular atrophy with respiratory distress type 1 [].   More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 1WFP_A 1WYS_A 1WG2_A 1WFH_A 1X4W_A 1WFE_A 1WFL_A 1X4V_A.
Probab=32.67  E-value=13  Score=20.37  Aligned_cols=15  Identities=27%  Similarity=0.609  Sum_probs=9.0

Q ss_pred             CCcccCCCcccCCCh
Q psy12030        204 PKYQCPHCPHKAKHK  218 (245)
Q Consensus       204 ~~~~C~~C~~~f~~~  218 (245)
                      .|+.|+.|+..|=..
T Consensus        12 ~~~~C~~C~~~FC~~   26 (43)
T PF01428_consen   12 LPFKCKHCGKSFCLK   26 (43)
T ss_dssp             SHEE-TTTS-EE-TT
T ss_pred             CCeECCCCCcccCcc
Confidence            468888888887655


No 224
>KOG0782|consensus
Probab=32.14  E-value=4.7  Score=35.34  Aligned_cols=54  Identities=20%  Similarity=0.381  Sum_probs=38.1

Q ss_pred             ccCCCCCccccccCCCceecccccccccChhHHhcchhcccCCCCCccCCCCcccccChH
Q psy12030         53 NAHGFNIWPLVQQYSKGFECQVCGKRYKYKRGLHRHKQDECGQEPKYQCPQCKDSFFSWS  112 (245)
Q Consensus        53 ~~~~~~~~~~~~~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~~C~~C~~~f~~~~  112 (245)
                      ....+..|..+|.....=+|..||+.|..+..+      |..+.....|.+|...|..+.
T Consensus       237 rE~~fvrHHWVHrrRqeGkC~~CgKgFQQKf~F------hsKEivAisCSWCKqayH~Kv  290 (1004)
T KOG0782|consen  237 RESGFVRHHWVHRRRQEGKCNTCGKGFQQKFFF------HSKEIVAISCSWCKQAYHLKV  290 (1004)
T ss_pred             ccccchHHhHhhHhhhccccchhhhhhhhheee------ccccEEEEEehHHHHHhhcch
Confidence            334666677777655556899999999766543      333245688999999997765


No 225
>KOG2636|consensus
Probab=31.68  E-value=31  Score=29.48  Aligned_cols=29  Identities=17%  Similarity=0.336  Sum_probs=23.4

Q ss_pred             hHHhCCCCCcccCCCc-ccCCChHHHHHhHh
Q psy12030        197 REECGQEPKYQCPHCP-HKAKHKANLKTHIA  226 (245)
Q Consensus       197 ~~h~~~~~~~~C~~C~-~~f~~~~~l~~H~~  226 (245)
                      +.|.- ...|.|.+|| +++..+..+.+|..
T Consensus       394 KLHGL-~~ey~CEICGNy~Y~GrkaF~RHF~  423 (497)
T KOG2636|consen  394 KLHGL-DIEYNCEICGNYVYKGRKAFDRHFN  423 (497)
T ss_pred             hhcCC-CcccceeeccCccccCcHHHHHHhH
Confidence            45544 7789999998 89999999999964


No 226
>KOG1842|consensus
Probab=31.64  E-value=20  Score=30.60  Aligned_cols=29  Identities=28%  Similarity=0.421  Sum_probs=25.4

Q ss_pred             CceecccccccccChhHHhcchhcccCCC
Q psy12030         68 KGFECQVCGKRYKYKRGLHRHKQDECGQE   96 (245)
Q Consensus        68 ~~~~C~~C~~~f~~~~~l~~H~~~h~~~~   96 (245)
                      +.|.|++|...|.+...|..|....|+++
T Consensus        14 egflCPiC~~dl~~~~~L~~H~d~eH~~e   42 (505)
T KOG1842|consen   14 EGFLCPICLLDLPNLSALNDHLDVEHFEE   42 (505)
T ss_pred             hcccCchHhhhhhhHHHHHHHHhhhcccc
Confidence            56999999999999999999998877643


No 227
>PF14205 Cys_rich_KTR:  Cysteine-rich KTR
Probab=31.47  E-value=17  Score=21.07  Aligned_cols=8  Identities=13%  Similarity=-0.126  Sum_probs=4.0

Q ss_pred             CCCCCCCC
Q psy12030        233 ILPPQEGR  240 (245)
Q Consensus       233 ~~~C~~C~  240 (245)
                      |.-|++|.
T Consensus        28 PlyCpKCK   35 (55)
T PF14205_consen   28 PLYCPKCK   35 (55)
T ss_pred             cccCCCCC
Confidence            44455554


No 228
>PF05129 Elf1:  Transcription elongation factor Elf1 like;  InterPro: IPR007808 This family of uncharacterised, mostly short, proteins contain a putative zinc binding domain with four conserved cysteines.; PDB: 1WII_A.
Probab=31.31  E-value=5.1  Score=25.54  Aligned_cols=10  Identities=40%  Similarity=1.109  Sum_probs=3.1

Q ss_pred             CCceeccccc
Q psy12030         67 SKGFECQVCG   76 (245)
Q Consensus        67 ~~~~~C~~C~   76 (245)
                      ++.|.|+.|+
T Consensus        20 ~~~F~CPfC~   29 (81)
T PF05129_consen   20 PKVFDCPFCN   29 (81)
T ss_dssp             SS----TTT-
T ss_pred             CceEcCCcCC
Confidence            4557777776


No 229
>KOG2272|consensus
Probab=31.30  E-value=48  Score=26.07  Aligned_cols=19  Identities=21%  Similarity=0.553  Sum_probs=13.6

Q ss_pred             eecccccccccChhHHhcc
Q psy12030         70 FECQVCGKRYKYKRGLHRH   88 (245)
Q Consensus        70 ~~C~~C~~~f~~~~~l~~H   88 (245)
                      |.|++|++...+...+...
T Consensus       100 F~Cd~Cn~~Lad~gf~rnq  118 (332)
T KOG2272|consen  100 FRCDLCNKHLADQGFYRNQ  118 (332)
T ss_pred             chhHHHHHHHhhhhhHhhc
Confidence            7888888877776665543


No 230
>PTZ00448 hypothetical protein; Provisional
Probab=31.16  E-value=36  Score=28.44  Aligned_cols=24  Identities=17%  Similarity=0.351  Sum_probs=19.9

Q ss_pred             CcccCCCcccCCChHHHHHhHhhh
Q psy12030        205 KYQCPHCPHKAKHKANLKTHIAIK  228 (245)
Q Consensus       205 ~~~C~~C~~~f~~~~~l~~H~~~~  228 (245)
                      .|.|..|+..|.+....+.|+++-
T Consensus       314 ~~tC~~C~v~F~~~~~qR~H~KSD  337 (373)
T PTZ00448        314 MLLCRKCNIQLMDHNAFKQHYRSE  337 (373)
T ss_pred             CccccccccccCCHHHHHHHhhhh
Confidence            588999999998888888888753


No 231
>KOG3507|consensus
Probab=31.15  E-value=17  Score=21.38  Aligned_cols=31  Identities=23%  Similarity=0.555  Sum_probs=19.9

Q ss_pred             ceeCCCCCCccCChhHHHHHHhHHhCCCCCcccCCCcccCCCh
Q psy12030        176 VFACNVCGKGYRYKTGLYRHKREECGQEPKYQCPHCPHKAKHK  218 (245)
Q Consensus       176 ~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~~C~~C~~~f~~~  218 (245)
                      .|.|..|+..-.    |.       . .-.++|.+||....++
T Consensus        20 iYiCgdC~~en~----lk-------~-~D~irCReCG~RIlyK   50 (62)
T KOG3507|consen   20 IYICGDCGQENT----LK-------R-GDVIRCRECGYRILYK   50 (62)
T ss_pred             EEEecccccccc----cc-------C-CCcEehhhcchHHHHH
Confidence            488988885422    11       1 4468899998765544


No 232
>PTZ00043 cytochrome c oxidase subunit; Provisional
Probab=30.14  E-value=29  Score=26.74  Aligned_cols=13  Identities=23%  Similarity=0.526  Sum_probs=6.6

Q ss_pred             CCCcccCCCcccC
Q psy12030        203 EPKYQCPHCPHKA  215 (245)
Q Consensus       203 ~~~~~C~~C~~~f  215 (245)
                      .++.+|+.||..|
T Consensus       179 GkpqRCpECGqVF  191 (268)
T PTZ00043        179 GFLYRCGECDQIF  191 (268)
T ss_pred             CCCccCCCCCcEE
Confidence            3455555555443


No 233
>PRK00420 hypothetical protein; Validated
Probab=29.85  E-value=51  Score=22.48  Aligned_cols=11  Identities=45%  Similarity=0.767  Sum_probs=5.7

Q ss_pred             ceeCCCCCCcc
Q psy12030        176 VFACNVCGKGY  186 (245)
Q Consensus       176 ~~~C~~C~~~f  186 (245)
                      ...|+.||...
T Consensus        40 ~~~Cp~Cg~~~   50 (112)
T PRK00420         40 EVVCPVHGKVY   50 (112)
T ss_pred             ceECCCCCCee
Confidence            35555555543


No 234
>KOG0402|consensus
Probab=29.19  E-value=22  Score=22.57  Aligned_cols=31  Identities=26%  Similarity=0.692  Sum_probs=17.7

Q ss_pred             CccCCCCCCcCCChHHHHhhhcCCCCceeCCCCCCccCC
Q psy12030        150 KYQCPHCPHRAKHKANLKTHIAPQLGVFACNVCGKGYRY  188 (245)
Q Consensus       150 ~~~C~~C~~~f~~~~~l~~H~~~h~~~~~C~~C~~~f~~  188 (245)
                      .|.|+.||+.-..        +.-.+.|.|..|.+.+.-
T Consensus        36 ky~CsfCGK~~vK--------R~AvGiW~C~~C~kv~ag   66 (92)
T KOG0402|consen   36 KYTCSFCGKKTVK--------RKAVGIWKCGSCKKVVAG   66 (92)
T ss_pred             hhhhhhcchhhhh--------hhceeEEecCCccceecc
Confidence            3677777765432        223345777777766543


No 235
>COG4896 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=29.15  E-value=26  Score=20.78  Aligned_cols=7  Identities=29%  Similarity=1.341  Sum_probs=3.6

Q ss_pred             ecccccc
Q psy12030         71 ECQVCGK   77 (245)
Q Consensus        71 ~C~~C~~   77 (245)
                      +|-+|++
T Consensus         4 kCiiCd~   10 (68)
T COG4896           4 KCIICDR   10 (68)
T ss_pred             eEEEecc
Confidence            4555554


No 236
>KOG2071|consensus
Probab=29.12  E-value=39  Score=30.06  Aligned_cols=27  Identities=19%  Similarity=0.445  Sum_probs=23.7

Q ss_pred             CCCcccCCCcccCCChHHHHHhHhhhC
Q psy12030        203 EPKYQCPHCPHKAKHKANLKTHIAIKH  229 (245)
Q Consensus       203 ~~~~~C~~C~~~f~~~~~l~~H~~~~~  229 (245)
                      ..|..|..||.+|........||..|-
T Consensus       416 ~~pnqC~~CG~R~~~~ee~sk~md~H~  442 (579)
T KOG2071|consen  416 DSPNQCKSCGLRFDDSEERSKHMDIHD  442 (579)
T ss_pred             CCcchhcccccccccchhhhhHhhhhh
Confidence            667899999999999999999888775


No 237
>CHL00174 accD acetyl-CoA carboxylase beta subunit; Reviewed
Probab=28.98  E-value=43  Score=27.23  Aligned_cols=33  Identities=21%  Similarity=0.274  Sum_probs=21.2

Q ss_pred             eeCCCCCCccCChhHHHHHHhHHhCCCCCcccCCCcccCCChH
Q psy12030        177 FACNVCGKGYRYKTGLYRHKREECGQEPKYQCPHCPHKAKHKA  219 (245)
Q Consensus       177 ~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~~C~~C~~~f~~~~  219 (245)
                      .+|+.|+.....+. |.         +..+.|+.|+.-|.-..
T Consensus        39 ~kc~~C~~~~~~~~-l~---------~~~~vcp~c~~h~rltA   71 (296)
T CHL00174         39 VQCENCYGLNYKKF-LK---------SKMNICEQCGYHLKMSS   71 (296)
T ss_pred             eECCCccchhhHHH-HH---------HcCCCCCCCCCCcCCCH
Confidence            67888887654332 21         33578999988776543


No 238
>COG0068 HypF Hydrogenase maturation factor [Posttranslational modification, protein turnover, chaperones]
Probab=28.83  E-value=13  Score=33.70  Aligned_cols=78  Identities=21%  Similarity=0.373  Sum_probs=49.5

Q ss_pred             ceecccccccccChhHHhcchhcccCCCCCccCCCCcccccChHHHHH-----hcCCccccCcCCCccCchhHHHhHHhh
Q psy12030         69 GFECQVCGKRYKYKRGLHRHKQDECGQEPKYQCPQCKDSFFSWSAFHK-----NLSGMFACDVCGKEYKYKRGLYRHKKF  143 (245)
Q Consensus        69 ~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~~C~~C~~~f~~~~~l~~-----h~~~~~~C~~C~~~f~~~~~l~~H~~~  143 (245)
                      .-.|+.|-+-+.+.++-.-+       =+-..|..||-.|+--..|--     -|..--.|+.|.+.+.+..+-+-    
T Consensus       101 ~a~C~~Cl~Ei~dp~~rrY~-------YPF~~CT~CGPRfTIi~alPYDR~nTsM~~F~lC~~C~~EY~dP~nRRf----  169 (750)
T COG0068         101 AATCEDCLEEIFDPNSRRYL-------YPFINCTNCGPRFTIIEALPYDRENTSMADFPLCPFCDKEYKDPLNRRF----  169 (750)
T ss_pred             hhhhHHHHHHhcCCCCccee-------ccccccCCCCcceeeeccCCCCcccCccccCcCCHHHHHHhcCcccccc----
Confidence            35788887766655442221       123458889999987777722     22333458999888887776333    


Q ss_pred             hcCCCCCccCCCCCCcC
Q psy12030        144 ECGQEPKYQCPHCPHRA  160 (245)
Q Consensus       144 h~~~~~~~~C~~C~~~f  160 (245)
                      |   -.+..|+.||-..
T Consensus       170 H---AQp~aCp~CGP~~  183 (750)
T COG0068         170 H---AQPIACPKCGPHL  183 (750)
T ss_pred             c---cccccCcccCCCe
Confidence            3   3467899998643


No 239
>PF10263 SprT-like:  SprT-like family;  InterPro: IPR006640 This is a family of uncharacterised bacterial proteins which includes Escherichia coli SprT (P39902 from SWISSPROT). SprT is described as a regulator of bolA gene in stationary phase []. The majority of members contain the metallopeptidase zinc binding signature which has a HExxH motif, however there is no evidence for them being metallopeptidases. 
Probab=28.73  E-value=24  Score=25.33  Aligned_cols=10  Identities=40%  Similarity=1.394  Sum_probs=6.1

Q ss_pred             eeCCCCCCcc
Q psy12030        177 FACNVCGKGY  186 (245)
Q Consensus       177 ~~C~~C~~~f  186 (245)
                      |.|..|+..+
T Consensus       124 ~~C~~C~~~~  133 (157)
T PF10263_consen  124 YRCPSCGREY  133 (157)
T ss_pred             EEcCCCCCEe
Confidence            6666666554


No 240
>COG2879 Uncharacterized small protein [Function unknown]
Probab=28.58  E-value=72  Score=19.15  Aligned_cols=18  Identities=28%  Similarity=0.364  Sum_probs=12.1

Q ss_pred             CChHHHHHhHhhhCCCCC
Q psy12030        216 KHKANLKTHIAIKHSDRI  233 (245)
Q Consensus       216 ~~~~~l~~H~~~~~~~~~  233 (245)
                      .+-.++..||+.+|.++|
T Consensus        23 pdYdnYVehmr~~hPd~p   40 (65)
T COG2879          23 PDYDNYVEHMRKKHPDKP   40 (65)
T ss_pred             CcHHHHHHHHHHhCcCCC
Confidence            345566777777777766


No 241
>smart00731 SprT SprT homologues. Predicted to have roles in transcription elongation. Contains a conserved HExxH motif, indicating a metalloprotease function.
Probab=27.36  E-value=41  Score=24.02  Aligned_cols=11  Identities=36%  Similarity=1.132  Sum_probs=6.5

Q ss_pred             eeCCCCCCccC
Q psy12030        177 FACNVCGKGYR  187 (245)
Q Consensus       177 ~~C~~C~~~f~  187 (245)
                      |.|..|+..+.
T Consensus       113 y~C~~C~~~~~  123 (146)
T smart00731      113 YRCTGCGQRYL  123 (146)
T ss_pred             EECCCCCCCCc
Confidence            66666665543


No 242
>PF15135 UPF0515:  Uncharacterised protein UPF0515
Probab=27.08  E-value=39  Score=26.51  Aligned_cols=14  Identities=21%  Similarity=0.795  Sum_probs=8.7

Q ss_pred             CCCceecccccccc
Q psy12030         66 YSKGFECQVCGKRY   79 (245)
Q Consensus        66 ~~~~~~C~~C~~~f   79 (245)
                      ....|.|..|...+
T Consensus       109 ~drqFaC~~Cd~~W  122 (278)
T PF15135_consen  109 VDRQFACSSCDHMW  122 (278)
T ss_pred             cceeeeccccchHH
Confidence            34567777776543


No 243
>KOG3362|consensus
Probab=26.92  E-value=21  Score=25.33  Aligned_cols=21  Identities=29%  Similarity=0.621  Sum_probs=14.9

Q ss_pred             eeCCCCCCccCChhHHHHHHh
Q psy12030        177 FACNVCGKGYRYKTGLYRHKR  197 (245)
Q Consensus       177 ~~C~~C~~~f~~~~~l~~H~~  197 (245)
                      |.|.-||-.+-+..-|..|..
T Consensus       130 ysC~~CG~kyCsv~C~~~Hne  150 (156)
T KOG3362|consen  130 YSCVNCGTKYCSVRCLKTHNE  150 (156)
T ss_pred             hHHHhcCCceeechhhhhccc
Confidence            667778777777777776654


No 244
>PF10276 zf-CHCC:  Zinc-finger domain;  InterPro: IPR019401 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.   This entry represents a short conserved zinc-finger domain. It contains the sequence motif Cx8Hx14Cx2C. ; PDB: 2JVM_A 2JRR_A 2JZ8_A.
Probab=26.24  E-value=22  Score=19.20  Aligned_cols=11  Identities=27%  Similarity=0.721  Sum_probs=7.2

Q ss_pred             CcccCCCcccC
Q psy12030        205 KYQCPHCPHKA  215 (245)
Q Consensus       205 ~~~C~~C~~~f  215 (245)
                      +-.|++||..|
T Consensus        29 ~~~CpYCg~~y   39 (40)
T PF10276_consen   29 PVVCPYCGTRY   39 (40)
T ss_dssp             EEEETTTTEEE
T ss_pred             eEECCCCCCEE
Confidence            46677777655


No 245
>COG1326 Uncharacterized archaeal Zn-finger protein [General function prediction only]
Probab=25.95  E-value=62  Score=24.41  Aligned_cols=13  Identities=31%  Similarity=0.718  Sum_probs=6.8

Q ss_pred             CCCcccCCCcccC
Q psy12030        203 EPKYQCPHCPHKA  215 (245)
Q Consensus       203 ~~~~~C~~C~~~f  215 (245)
                      +..+.|..||..+
T Consensus        28 ~~lvrC~eCG~V~   40 (201)
T COG1326          28 EPLVRCEECGTVH   40 (201)
T ss_pred             ceEEEccCCCcEe
Confidence            3445555555554


No 246
>KOG4118|consensus
Probab=25.69  E-value=40  Score=20.32  Aligned_cols=30  Identities=27%  Similarity=0.501  Sum_probs=18.2

Q ss_pred             cccCCCcccCCChHHHHHhHhhhCCCCCCC
Q psy12030        206 YQCPHCPHKAKHKANLKTHIAIKHSDRILP  235 (245)
Q Consensus       206 ~~C~~C~~~f~~~~~l~~H~~~~~~~~~~~  235 (245)
                      |+|.+|-..-.....+..|....|...|++
T Consensus        39 ~kCtVC~~~mpdpktfkqhfe~kHpk~~~P   68 (74)
T KOG4118|consen   39 HKCTVCMVQMPDPKTFKQHFENKHPKEPLP   68 (74)
T ss_pred             hhhHhhHhhCCCCchHHHHHhhcCCCCCCC
Confidence            566666666666666666666666555543


No 247
>KOG0227|consensus
Probab=25.69  E-value=39  Score=25.29  Aligned_cols=27  Identities=19%  Similarity=0.445  Sum_probs=19.0

Q ss_pred             hcCCCCceeCCCCCCccCChhHHHHHH
Q psy12030        170 IAPQLGVFACNVCGKGYRYKTGLYRHK  196 (245)
Q Consensus       170 ~~~h~~~~~C~~C~~~f~~~~~l~~H~  196 (245)
                      ++.|.|.|.|..|.-.-.+..+..+|.
T Consensus        47 mkNh~G~yeCkLClT~H~ne~Syl~Ht   73 (222)
T KOG0227|consen   47 MKNHLGKYECKLCLTLHNNEGSYLAHT   73 (222)
T ss_pred             hhccCcceeehhhhhhhcchhhhhhhh
Confidence            466777788888876666666666664


No 248
>COG4306 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=25.54  E-value=42  Score=23.19  Aligned_cols=44  Identities=16%  Similarity=0.225  Sum_probs=22.7

Q ss_pred             eecccccccccChhHHhcchhcccCCCCCccCCCCcccccChHH
Q psy12030         70 FECQVCGKRYKYKRGLHRHKQDECGQEPKYQCPQCKDSFFSWSA  113 (245)
Q Consensus        70 ~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~~C~~C~~~f~~~~~  113 (245)
                      -.|+.|+....-.....-=+-.-+.-+.|.-|..||..|.+...
T Consensus        40 ~qcp~csasirgd~~vegvlglg~dye~psfchncgs~fpwter   83 (160)
T COG4306          40 TQCPICSASIRGDYYVEGVLGLGGDYEPPSFCHNCGSRFPWTER   83 (160)
T ss_pred             hcCCccCCcccccceeeeeeccCCCCCCcchhhcCCCCCCcHHH
Confidence            45666665544332222212222223566777778877776544


No 249
>PF04423 Rad50_zn_hook:  Rad50 zinc hook motif;  InterPro: IPR007517 The Mre11 complex (Mre11 Rad50 Nbs1) is central to chromosomal maintenance and functions in homologous recombination, telomere maintenance and sister chromatid association. The Rad50 coiled-coil region contains a dimer interface at the apex of the coiled coils in which pairs of conserved Cys-X-X-Cys motifs form interlocking hooks that bind one Zn ion. This alignment includes the zinc hook motif and a short stretch of coiled-coil on either side.; GO: 0004518 nuclease activity, 0005524 ATP binding, 0008270 zinc ion binding, 0006281 DNA repair; PDB: 1L8D_B.
Probab=25.41  E-value=28  Score=20.00  Aligned_cols=13  Identities=23%  Similarity=0.759  Sum_probs=7.1

Q ss_pred             ecccccccccChh
Q psy12030         71 ECQVCGKRYKYKR   83 (245)
Q Consensus        71 ~C~~C~~~f~~~~   83 (245)
                      .|++|++.|....
T Consensus        22 ~CPlC~r~l~~e~   34 (54)
T PF04423_consen   22 CCPLCGRPLDEEH   34 (54)
T ss_dssp             E-TTT--EE-HHH
T ss_pred             cCCCCCCCCCHHH
Confidence            8999999887653


No 250
>KOG0717|consensus
Probab=25.33  E-value=44  Score=28.86  Aligned_cols=22  Identities=27%  Similarity=0.668  Sum_probs=18.3

Q ss_pred             eeCCCCCCccCChhHHHHHHhH
Q psy12030        177 FACNVCGKGYRYKTGLYRHKRE  198 (245)
Q Consensus       177 ~~C~~C~~~f~~~~~l~~H~~~  198 (245)
                      +-|.+|+++|.+...|..|..+
T Consensus       293 lyC~vCnKsFKseKq~kNHEnS  314 (508)
T KOG0717|consen  293 LYCVVCNKSFKSEKQLKNHENS  314 (508)
T ss_pred             eEEeeccccccchHHHHhhHHH
Confidence            7788899999988888888664


No 251
>KOG1701|consensus
Probab=24.86  E-value=6.1  Score=33.33  Aligned_cols=37  Identities=14%  Similarity=0.389  Sum_probs=19.8

Q ss_pred             ccCCCCCCcCCChHHHHhhhc-------CCCCceeCCCCCCccC
Q psy12030        151 YQCPHCPHRAKHKANLKTHIA-------PQLGVFACNVCGKGYR  187 (245)
Q Consensus       151 ~~C~~C~~~f~~~~~l~~H~~-------~h~~~~~C~~C~~~f~  187 (245)
                      =+|.+|++-..=+..-..-++       -|..=|+|+.||....
T Consensus       395 PrCs~C~~PI~P~~G~~etvRvvamdr~fHv~CY~CEDCg~~LS  438 (468)
T KOG1701|consen  395 PRCSVCGNPILPRDGKDETVRVVAMDRDFHVNCYKCEDCGLLLS  438 (468)
T ss_pred             cchhhccCCccCCCCCcceEEEEEccccccccceehhhcCcccc
Confidence            357777765544333222222       2333388888887655


No 252
>PRK12496 hypothetical protein; Provisional
Probab=24.84  E-value=56  Score=24.00  Aligned_cols=26  Identities=27%  Similarity=0.535  Sum_probs=16.9

Q ss_pred             eeCCCCCCccCChhHHHHHHhHHhCCCCCcccCCCcccC
Q psy12030        177 FACNVCGKGYRYKTGLYRHKREECGQEPKYQCPHCPHKA  215 (245)
Q Consensus       177 ~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~~C~~C~~~f  215 (245)
                      |.|..|++.|..            . ...-.|+.||...
T Consensus       128 ~~C~gC~~~~~~------------~-~~~~~C~~CG~~~  153 (164)
T PRK12496        128 KVCKGCKKKYPE------------D-YPDDVCEICGSPV  153 (164)
T ss_pred             EECCCCCccccC------------C-CCCCcCCCCCChh
Confidence            789889887751            1 1224599998553


No 253
>PF05495 zf-CHY:  CHY zinc finger;  InterPro: IPR008913 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  Pirh2 is an eukaryotic ubiquitin protein ligase, which has been shown to promote p53 degradation in mammals. Pirh2 physically interacts with p53 and promotes ubiquitination of p53 independently of MDM2. Like MDM2, Pirh2 is thought to participate in an autoregulatory feedback loop that controls p53 function. Pirh2 proteins contain three distinct zinc fingers, the CHY-type, the CTCHY-type which is C-terminal to the CHY-type zinc finger and a RING finger. The CHY-type zinc finger has no currently known function []. As well as Pirh2, the CHY-type zinc finger is also found in the following proteins:   Yeast helper of Tim protein 13. Hot13 may have a role in the assembly and recycling of the small Tims, a complex of the mitochondrial intermembrane space that participates in the TIM22 import pathway for assembly of the inner membrane [] Several plant hypothetical proteins that also contain haemerythrin cation binding domains Several protozoan hypothetical proteins that also contain a Myb domain   The solution structure of this zinc finger has been solved and binds 3 zinc atoms as shown in the following schematic representation:   ++---------+-----+ || | | CXHYxxxxxxxxxCCxxxxxCxxCHxxxxxHxxxxxxxxxxxCxxCxxxxxxxxxCxxC | | | | | | | | +-+-----------------+--+ +--+---------+--+ 'C': conserved cysteine involved in the binding of one zinc atom. 'H': conserved histidine involved in the binding of one zinc atom.  More information about these proteins can be found at Protein of the Month: Zinc Fingers []; GO: 0008270 zinc ion binding; PDB: 2DKT_A 2K2C_A.
Probab=24.80  E-value=22  Score=21.93  Aligned_cols=11  Identities=18%  Similarity=0.694  Sum_probs=4.3

Q ss_pred             CccCCCCcccc
Q psy12030         98 KYQCPQCKDSF  108 (245)
Q Consensus        98 ~~~C~~C~~~f  108 (245)
                      ...|..|+...
T Consensus        41 ~v~Cg~C~~~~   51 (71)
T PF05495_consen   41 RVICGKCRTEQ   51 (71)
T ss_dssp             EEEETTT--EE
T ss_pred             CeECCCCCCcc
Confidence            44455554443


No 254
>TIGR00310 ZPR1_znf ZPR1 zinc finger domain.
Probab=24.80  E-value=24  Score=26.63  Aligned_cols=9  Identities=33%  Similarity=0.829  Sum_probs=4.9

Q ss_pred             eeCCCCCCc
Q psy12030        177 FACNVCGKG  185 (245)
Q Consensus       177 ~~C~~C~~~  185 (245)
                      +.|+.||+.
T Consensus        31 f~C~~CGyr   39 (192)
T TIGR00310        31 TICEHCGYR   39 (192)
T ss_pred             EECCCCCCc
Confidence            555555544


No 255
>PRK14892 putative transcription elongation factor Elf1; Provisional
Probab=24.47  E-value=21  Score=23.78  Aligned_cols=33  Identities=21%  Similarity=0.518  Sum_probs=18.6

Q ss_pred             eeCCCCCCccCChhHHHHHHhHHhCCCCCcccCCCcccCCC
Q psy12030        177 FACNVCGKGYRYKTGLYRHKREECGQEPKYQCPHCPHKAKH  217 (245)
Q Consensus       177 ~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~~C~~C~~~f~~  217 (245)
                      |.|+.||. ..-...+.+      + .....|+.||..+..
T Consensus        22 f~CP~Cge-~~v~v~~~k------~-~~h~~C~~CG~y~~~   54 (99)
T PRK14892         22 FECPRCGK-VSISVKIKK------N-IAIITCGNCGLYTEF   54 (99)
T ss_pred             eECCCCCC-eEeeeecCC------C-cceEECCCCCCccCE
Confidence            88888883 222111211      2 445678888877654


No 256
>PRK11032 hypothetical protein; Provisional
Probab=24.39  E-value=32  Score=25.16  Aligned_cols=13  Identities=0%  Similarity=-0.207  Sum_probs=7.2

Q ss_pred             hCCCCCCCCCCCC
Q psy12030        228 KHSDRILPPQEGR  240 (245)
Q Consensus       228 ~~~~~~~~C~~C~  240 (245)
                      .+.+..-+|+.||
T Consensus       137 ~~p~~i~pCp~C~  149 (160)
T PRK11032        137 YTPEVLPLCPKCG  149 (160)
T ss_pred             cCCCcCCCCCCCC
Confidence            3445555666665


No 257
>PF06397 Desulfoferrod_N:  Desulfoferrodoxin, N-terminal domain;  InterPro: IPR004462 This domain is found as essentially the full length of desulforedoxin, a 37-residue homodimeric non-haem iron protein. It is also found as the N-terminal domain of desulfoferrodoxin (rbo), a homodimeric non-haem iron protein with 2 Fe atoms per monomer in different oxidation states. This domain binds the ferric rather than the ferrous Fe of desulfoferrodoxin. Neelaredoxin, a monomeric blue non-haem iron protein, lacks this domain.; GO: 0005506 iron ion binding; PDB: 1DFX_A 1VZI_B 2JI2_D 1VZH_B 2JI3_C 2JI1_C 1VZG_A 1CFW_A 2LK5_B 1DHG_B ....
Probab=24.14  E-value=32  Score=18.14  Aligned_cols=10  Identities=40%  Similarity=1.065  Sum_probs=4.8

Q ss_pred             CcccCCCccc
Q psy12030        205 KYQCPHCPHK  214 (245)
Q Consensus       205 ~~~C~~C~~~  214 (245)
                      -|+|..||-.
T Consensus         6 ~YkC~~CGni   15 (36)
T PF06397_consen    6 FYKCEHCGNI   15 (36)
T ss_dssp             EEE-TTT--E
T ss_pred             EEEccCCCCE
Confidence            4778777754


No 258
>PF14787 zf-CCHC_5:  GAG-polyprotein viral zinc-finger; PDB: 1CL4_A 1DSV_A.
Probab=23.94  E-value=44  Score=17.56  Aligned_cols=10  Identities=0%  Similarity=-0.679  Sum_probs=5.2

Q ss_pred             CCCCCCCccc
Q psy12030        234 LPPQEGRVWT  243 (245)
Q Consensus       234 ~~C~~C~~~f  243 (245)
                      -.|+.|++.|
T Consensus         3 ~~CprC~kg~   12 (36)
T PF14787_consen    3 GLCPRCGKGF   12 (36)
T ss_dssp             -C-TTTSSSC
T ss_pred             ccCcccCCCc
Confidence            3566777665


No 259
>COG5216 Uncharacterized conserved protein [Function unknown]
Probab=23.70  E-value=44  Score=19.69  Aligned_cols=10  Identities=40%  Similarity=1.514  Sum_probs=6.3

Q ss_pred             eeccccccccc
Q psy12030         70 FECQVCGKRYK   80 (245)
Q Consensus        70 ~~C~~C~~~f~   80 (245)
                      |.|+ ||..|.
T Consensus        23 yPCP-CGDRFe   32 (67)
T COG5216          23 YPCP-CGDRFE   32 (67)
T ss_pred             ecCC-CCCEeE
Confidence            5565 777665


No 260
>PF11781 RRN7:  RNA polymerase I-specific transcription initiation factor Rrn7;  InterPro: IPR021752  Rrn7 is a transcription binding factor that associates strongly with both Rrn6 and Rrn11 to form a complex which itself binds the TATA-binding protein and is required for transcription by the core domain of the RNA PolI promoter [],[]. 
Probab=23.56  E-value=62  Score=16.95  Aligned_cols=9  Identities=44%  Similarity=1.058  Sum_probs=4.6

Q ss_pred             ccCCCCCCc
Q psy12030        151 YQCPHCPHR  159 (245)
Q Consensus       151 ~~C~~C~~~  159 (245)
                      +.|++|+..
T Consensus         9 ~~C~~C~~~   17 (36)
T PF11781_consen    9 EPCPVCGSR   17 (36)
T ss_pred             CcCCCCCCe
Confidence            345555544


No 261
>PF11789 zf-Nse:  Zinc-finger of the MIZ type in Nse subunit; PDB: 2YU4_A 3HTK_C.
Probab=23.43  E-value=31  Score=20.25  Aligned_cols=12  Identities=17%  Similarity=0.562  Sum_probs=5.3

Q ss_pred             ceeCCCCCCccC
Q psy12030        176 VFACNVCGKGYR  187 (245)
Q Consensus       176 ~~~C~~C~~~f~  187 (245)
                      |+....||-+|.
T Consensus        24 PV~s~~C~H~fe   35 (57)
T PF11789_consen   24 PVKSKKCGHTFE   35 (57)
T ss_dssp             EEEESSS--EEE
T ss_pred             CcCcCCCCCeec
Confidence            455555655554


No 262
>PF04780 DUF629:  Protein of unknown function (DUF629);  InterPro: IPR006865 This domain represents a region of several plant proteins of unknown function. A C2H2 zinc finger is predicted in this region in some family members, but the spacing between the cysteine residues is not conserved throughout the family.
Probab=23.26  E-value=69  Score=27.90  Aligned_cols=25  Identities=20%  Similarity=0.442  Sum_probs=21.9

Q ss_pred             eeCCCCCCccCChhHHHHHHhHHhC
Q psy12030        177 FACNVCGKGYRYKTGLYRHKREECG  201 (245)
Q Consensus       177 ~~C~~C~~~f~~~~~l~~H~~~h~~  201 (245)
                      |.|+.|.+.|.....+..|+..-|.
T Consensus        58 WiCp~CskkF~d~~~~~~H~~~eH~   82 (466)
T PF04780_consen   58 WICPRCSKKFSDAESCLSHMEQEHP   82 (466)
T ss_pred             eeCCcccceeCCHHHHHHHHHHhhh
Confidence            8899999999999999999986554


No 263
>KOG1842|consensus
Probab=22.98  E-value=46  Score=28.50  Aligned_cols=20  Identities=25%  Similarity=0.652  Sum_probs=10.3

Q ss_pred             ccCCCCCCcCCChHHHHhhh
Q psy12030        151 YQCPHCPHRAKHKANLKTHI  170 (245)
Q Consensus       151 ~~C~~C~~~f~~~~~l~~H~  170 (245)
                      |.|++|...|.+-..|..|.
T Consensus        16 flCPiC~~dl~~~~~L~~H~   35 (505)
T KOG1842|consen   16 FLCPICLLDLPNLSALNDHL   35 (505)
T ss_pred             ccCchHhhhhhhHHHHHHHH
Confidence            44555555555555555554


No 264
>KOG1994|consensus
Probab=22.46  E-value=48  Score=25.63  Aligned_cols=23  Identities=35%  Similarity=0.687  Sum_probs=20.1

Q ss_pred             CCceecccccccccChhHHhcch
Q psy12030         67 SKGFECQVCGKRYKYKRGLHRHK   89 (245)
Q Consensus        67 ~~~~~C~~C~~~f~~~~~l~~H~   89 (245)
                      ..-|-|-+||..|.+...|..|-
T Consensus       237 ~eh~YC~fCG~~y~~~edl~ehC  259 (268)
T KOG1994|consen  237 SEHYYCFFCGIKYKDEEDLYEHC  259 (268)
T ss_pred             ccceEEEEeccccCCHHHHHHhC
Confidence            44599999999999999998883


No 265
>PF09963 DUF2197:  Uncharacterized protein conserved in bacteria (DUF2197);  InterPro: IPR019241  This family represents various hypothetical bacterial proteins with no known function. 
Probab=22.36  E-value=26  Score=20.53  Aligned_cols=9  Identities=33%  Similarity=1.014  Sum_probs=5.3

Q ss_pred             ecccccccc
Q psy12030         71 ECQVCGKRY   79 (245)
Q Consensus        71 ~C~~C~~~f   79 (245)
                      +|-.|++.+
T Consensus         4 kC~lCdk~~   12 (56)
T PF09963_consen    4 KCILCDKKE   12 (56)
T ss_pred             EEEecCCEE
Confidence            566666653


No 266
>PF03145 Sina:  Seven in absentia protein family;  InterPro: IPR018121 The seven in absentia (sina) gene was first identified in Drosophila. The Drosophila Sina protein is essential for the determination of the R7 pathway in photoreceptor cell development: the loss of functional Sina results in the transformation of the R7 precursor cell to a non-neuronal cell type. The Sina protein contains an N-terminal RING finger domain C3HC4-type. Through this domain, Sina binds E2 ubiquitin-conjugating enzymes (UbcD1) Sina also interacts with Tramtrack (TTK88) via PHYL. Tramtrack is a transcriptional repressor that blocks photoreceptor determination, while PHYL down-regulates the activity of TTK88. In turn, the activity of PHYL requires the activation of the Sevenless receptor tyrosine kinase, a process essential for R7 determination. It is thought that Sina targets TTK88 for degradation, therefore promoting the R7 pathway. Murine and human homologues of Sina have also been identified. The human homologue Siah-1 [] also binds E2 enzymes (UbcH5) and through a series of physical interactions, targets beta-catenin for ubiquitin degradation. Siah-1 expression is enhanced by p53, itself promoted by DNA damage. Thus this pathway links DNA damage to beta-catenin degradation [, ]. Sina proteins, therefore, physically interact with a variety of proteins. The N-terminal RING finger domain that binds ubiquitin conjugating enzymes is a C3HC4-type, and does not form part of the alignment for this family. The remainder C-terminal part is involved in interactions with other proteins, and is included in this alignment. In addition to the Drosophila protein and mammalian homologues, whose similarity was noted previously, this family also includes putative homologues from Caenorhabditis elegans, Arabidopsis thaliana.; GO: 0006511 ubiquitin-dependent protein catabolic process, 0007275 multicellular organismal development, 0005634 nucleus; PDB: 2A25_A 1K2F_B 2AN6_C.
Probab=22.10  E-value=59  Score=24.52  Aligned_cols=46  Identities=24%  Similarity=0.381  Sum_probs=19.3

Q ss_pred             CCCccCChhHHHHHHhHHhCCCCCcccCC----CcccCCChHHHHHhHhhhCCC
Q psy12030        182 CGKGYRYKTGLYRHKREECGQEPKYQCPH----CPHKAKHKANLKTHIAIKHSD  231 (245)
Q Consensus       182 C~~~f~~~~~l~~H~~~h~~~~~~~~C~~----C~~~f~~~~~l~~H~~~~~~~  231 (245)
                      |...+. ......|.... . -+||.||.    |+..= ....|..|+...|++
T Consensus        24 C~~~~~-~~~~~~HE~~C-~-~~p~~CP~~~~~C~~~G-~~~~l~~Hl~~~H~~   73 (198)
T PF03145_consen   24 CTETFP-YSEKREHEEEC-P-FRPCSCPFPGSGCDWQG-SYKELLDHLRDKHSW   73 (198)
T ss_dssp             ---EE--GGGHHHHHHT--T-TSEEE-SSSSTT---EE-ECCCHHHHHHHHTTT
T ss_pred             Cccccc-ccChhhHhccC-C-CcCCcCCCCCCCccccC-CHHHHHHHHHHHCCC
Confidence            555433 33455555544 2 45666665    54332 234566666666655


No 267
>PRK00762 hypA hydrogenase nickel incorporation protein; Provisional
Probab=22.09  E-value=43  Score=23.27  Aligned_cols=15  Identities=27%  Similarity=0.494  Sum_probs=9.0

Q ss_pred             CCceecccccccccCh
Q psy12030         67 SKGFECQVCGKRYKYK   82 (245)
Q Consensus        67 ~~~~~C~~C~~~f~~~   82 (245)
                      +-.+.| .||..|...
T Consensus        68 p~~~~C-~Cg~~~~~~   82 (124)
T PRK00762         68 PVEIEC-ECGYEGVVD   82 (124)
T ss_pred             CeeEEe-eCcCccccc
Confidence            334677 777666543


No 268
>KOG2636|consensus
Probab=21.71  E-value=61  Score=27.84  Aligned_cols=22  Identities=23%  Similarity=0.519  Sum_probs=16.0

Q ss_pred             CCCccCCCCC-CcCCChHHHHhh
Q psy12030        148 EPKYQCPHCP-HRAKHKANLKTH  169 (245)
Q Consensus       148 ~~~~~C~~C~-~~f~~~~~l~~H  169 (245)
                      ...|.|.+|| +++..+..+.+|
T Consensus       399 ~~ey~CEICGNy~Y~GrkaF~RH  421 (497)
T KOG2636|consen  399 DIEYNCEICGNYVYKGRKAFDRH  421 (497)
T ss_pred             CcccceeeccCccccCcHHHHHH
Confidence            4557777777 777777777777


No 269
>PF12773 DZR:  Double zinc ribbon
Probab=21.52  E-value=65  Score=17.90  Aligned_cols=25  Identities=28%  Similarity=0.668  Sum_probs=15.0

Q ss_pred             eCCCCCCccCChhHHHHHHhHHhCCCCCcccCCCccc
Q psy12030        178 ACNVCGKGYRYKTGLYRHKREECGQEPKYQCPHCPHK  214 (245)
Q Consensus       178 ~C~~C~~~f~~~~~l~~H~~~h~~~~~~~~C~~C~~~  214 (245)
                      .|+.||....            ........|+.||..
T Consensus        14 fC~~CG~~l~------------~~~~~~~~C~~Cg~~   38 (50)
T PF12773_consen   14 FCPHCGTPLP------------PPDQSKKICPNCGAE   38 (50)
T ss_pred             CChhhcCChh------------hccCCCCCCcCCcCC
Confidence            4777776655            111445778888764


No 270
>KOG2923|consensus
Probab=21.47  E-value=71  Score=19.24  Aligned_cols=10  Identities=40%  Similarity=1.524  Sum_probs=5.2

Q ss_pred             eeccccccccc
Q psy12030         70 FECQVCGKRYK   80 (245)
Q Consensus        70 ~~C~~C~~~f~   80 (245)
                      |.|+ ||..|.
T Consensus        23 yPCp-CGDrf~   32 (67)
T KOG2923|consen   23 YPCP-CGDRFQ   32 (67)
T ss_pred             cCCC-CCCeee
Confidence            4443 666654


No 271
>PRK04351 hypothetical protein; Provisional
Probab=21.14  E-value=48  Score=23.91  Aligned_cols=32  Identities=28%  Similarity=0.839  Sum_probs=17.3

Q ss_pred             ccccCcCCCccCchhHHHhHHhhhcCCCCCccCCCCCCcCC
Q psy12030        121 MFACDVCGKEYKYKRGLYRHKKFECGQEPKYQCPHCPHRAK  161 (245)
Q Consensus       121 ~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~~C~~C~~~f~  161 (245)
                      .|.|..||..+...       +.+ . ...|.|..|+-.+.
T Consensus       112 ~Y~C~~Cg~~~~r~-------Rr~-n-~~~yrCg~C~g~L~  143 (149)
T PRK04351        112 LYECQSCGQQYLRK-------RRI-N-TKRYRCGKCRGKLK  143 (149)
T ss_pred             EEECCCCCCEeeee-------eec-C-CCcEEeCCCCcEee
Confidence            36676677554321       112 2 35577777775554


No 272
>PF01286 XPA_N:  XPA protein N-terminal;  InterPro: IPR022652 Xeroderma pigmentosum (XP) [] is a human autosomal recessive disease, characterised by a high incidence of sunlight-induced skin cancer. Skin cells of individual's with this condition are hypersensitive to ultraviolet light, due to defects in the incision step of DNA excision repair. There are a minimum of seven genetic complementation groups involved in this pathway: XP-A to XP-G. XP-A is the most severe form of the disease and is due to defects in a 30 kDa nuclear protein called XPA (or XPAC) []. The sequence of the XPA protein is conserved from higher eukaryotes [] to yeast (gene RAD14) []. XPA is a hydrophilic protein of 247 to 296 amino-acid residues which has a C4-type zinc finger motif in its central section. This entry contains the zinc-finger containing region in the XPA protein. It is found N-terminal to PF05181 from PFAM ; PDB: 1D4U_A 1XPA_A.
Probab=21.09  E-value=35  Score=17.74  Aligned_cols=14  Identities=14%  Similarity=0.337  Sum_probs=7.0

Q ss_pred             cccCCCcccCCChH
Q psy12030        206 YQCPHCPHKAKHKA  219 (245)
Q Consensus       206 ~~C~~C~~~f~~~~  219 (245)
                      -.|..|++.|..+.
T Consensus         4 ~~C~eC~~~f~dSy   17 (34)
T PF01286_consen    4 PKCDECGKPFMDSY   17 (34)
T ss_dssp             EE-TTT--EES-SS
T ss_pred             chHhHhCCHHHHHH
Confidence            36888888887764


No 273
>COG4391 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=21.06  E-value=50  Score=19.72  Aligned_cols=43  Identities=16%  Similarity=0.274  Sum_probs=18.9

Q ss_pred             cccccCCCceecccccccccChhHHhcchhcccCCCCCccCCCCcccc
Q psy12030         61 PLVQQYSKGFECQVCGKRYKYKRGLHRHKQDECGQEPKYQCPQCKDSF  108 (245)
Q Consensus        61 ~~~~~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~~C~~C~~~f  108 (245)
                      ..+.....++.|+-=+..|.....+..     -+.+....|+.|+..|
T Consensus        16 ~~I~~~~~~l~C~g~~~p~~HPrV~L~-----mg~~gev~CPYC~t~y   58 (62)
T COG4391          16 ETIEIGDLPLMCPGPEPPNDHPRVFLD-----MGDEGEVVCPYCSTRY   58 (62)
T ss_pred             eEEEeCCeeEEcCCCCCCCCCCEEEEE-----cCCCCcEecCccccEE
Confidence            334444555666554444333222111     1334455555555554


No 274
>PF11672 DUF3268:  Protein of unknown function (DUF3268);  InterPro: IPR021686 This entry is represented by Listeria phage P100, Gp150. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches.
Probab=20.95  E-value=38  Score=22.66  Aligned_cols=7  Identities=43%  Similarity=1.312  Sum_probs=4.0

Q ss_pred             cccCCCc
Q psy12030        206 YQCPHCP  212 (245)
Q Consensus       206 ~~C~~C~  212 (245)
                      |.|..|+
T Consensus        32 y~C~~C~   38 (102)
T PF11672_consen   32 YVCTPCD   38 (102)
T ss_pred             EECCCCC
Confidence            5555554


No 275
>COG0846 SIR2 NAD-dependent protein deacetylases, SIR2 family [Transcription]
Probab=20.21  E-value=70  Score=25.34  Aligned_cols=12  Identities=33%  Similarity=0.869  Sum_probs=7.5

Q ss_pred             eeCCCCCCccCC
Q psy12030        177 FACNVCGKGYRY  188 (245)
Q Consensus       177 ~~C~~C~~~f~~  188 (245)
                      +.|..|+..+..
T Consensus       123 ~~C~~C~~~~~~  134 (250)
T COG0846         123 VRCSKCGNQYYD  134 (250)
T ss_pred             eEeCCCcCccch
Confidence            667777666553


No 276
>TIGR03830 CxxCG_CxxCG_HTH putative zinc finger/helix-turn-helix protein, YgiT family. This model describes a family of predicted regulatory proteins with a conserved zinc finger/HTH architecture. The amino-terminal region contains a novel domain, featuring two CXXC motifs and occuring in a number of small bacterial proteins as well as in the present family. The carboxyl-terminal region consists of a helix-turn-helix domain, modeled by pfam01381. The predicted function is DNA binding and transcriptional regulation.
Probab=20.08  E-value=73  Score=21.80  Aligned_cols=16  Identities=19%  Similarity=0.459  Sum_probs=8.7

Q ss_pred             eeCCCCCCccCChhHH
Q psy12030        177 FACNVCGKGYRYKTGL  192 (245)
Q Consensus       177 ~~C~~C~~~f~~~~~l  192 (245)
                      +.|+.||..+......
T Consensus        32 ~~C~~CGe~~~~~e~~   47 (127)
T TIGR03830        32 WYCPACGEELLDPEES   47 (127)
T ss_pred             eECCCCCCEEEcHHHH
Confidence            5566666655554433


Done!