Query         psy12033
Match_columns 79
No_of_seqs    100 out of 272
Neff          5.9 
Searched_HMMs 46136
Date          Fri Aug 16 16:56:20 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy12033.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/12033hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF03556 Cullin_binding:  Culli 100.0 7.8E-30 1.7E-34  166.7   2.3   70    2-79     23-92  (117)
  2 KOG3077|consensus               99.9 1.9E-24 4.1E-29  157.1   4.5   69    2-79    156-224 (260)
  3 KOG3077|consensus               85.3    0.86 1.9E-05   33.8   2.7   66    4-79     83-148 (260)
  4 PF13720 Acetyltransf_11:  Udp   63.1      21 0.00046   21.6   4.2   36   22-66     48-83  (83)
  5 PF08671 SinI:  Anti-repressor   56.0      16 0.00036   18.5   2.4   28   48-77      3-30  (30)
  6 PF07864 DUF1651:  Protein of u  52.7     8.3 0.00018   22.8   1.1   22   19-40     47-68  (75)
  7 PRK05289 UDP-N-acetylglucosami  46.3      37 0.00081   24.3   3.9   20   44-66    240-259 (262)
  8 PF02671 PAH:  Paired amphipath  45.0      47   0.001   17.5   3.4   31   19-54     16-46  (47)
  9 cd01053 AOX Alternative oxidas  42.7      12 0.00026   26.1   0.8   17   17-33    119-137 (168)
 10 KOG2873|consensus               42.0      46   0.001   25.1   3.8   40   17-57    213-252 (284)
 11 PRK12461 UDP-N-acetylglucosami  40.1      58  0.0012   23.5   4.1   36   21-65    219-254 (255)
 12 PF12588 PSDC:  Phophatidylseri  34.9      20 0.00044   24.1   1.0   22   45-67    104-125 (141)
 13 PF07346 DUF1477:  Protein of u  33.8      32 0.00069   22.7   1.7   56    1-57     39-95  (118)
 14 smart00386 HAT HAT (Half-A-TPR  28.7      50  0.0011   14.7   1.6   13   64-76     19-31  (33)
 15 PF12512 DUF3717:  Protein of u  25.5      44 0.00094   20.2   1.2   16   22-37      7-22  (71)
 16 cd03207 GST_C_8 GST_C family,   24.7      32  0.0007   20.2   0.5   25   43-67     79-103 (103)
 17 PF11772 EpuA:  DNA-directed RN  22.4      71  0.0015   17.7   1.6   18   60-77     28-45  (47)
 18 PF10827 DUF2552:  Protein of u  22.4      41  0.0009   20.6   0.7   23   48-70     15-46  (79)

No 1  
>PF03556 Cullin_binding:  Cullin binding;  InterPro: IPR005176 The eukaryotic defective in cullin neddylation (DCN) protein family, may contribute to neddylation of cullin components of SCF-type E3 ubiquitin ligase complexes. These multi-protein complexes are required for polyubiquitination and subsequent degradation of target proteins by the 26S proteasome []. Proteins in the DCN family include:  Yeast DCN1. Vertebrate DCN1-like protein 1. Vertebrate DCN1-like protein 2. Vertebrate DCN1-like protein 4.   This entry represents a domain found within DCN family proteins. Its function is unknown but it has been suggested that it has the features of a basic helix-loop-helix leucine zipper (bHLH-ZIP) domain [].It is often found in association with a UBA-like domain (IPR009060 from INTERPRO).; PDB: 3TDI_A 2IS9_A 3O6B_E 3O2P_A 3BQ3_A 3TDZ_A 3TDU_B.
Probab=99.95  E-value=7.8e-30  Score=166.66  Aligned_cols=70  Identities=43%  Similarity=0.881  Sum_probs=62.0

Q ss_pred             CceeeeeccccccccCCCccccHHHHHHHHhhhhcccccCCchhhHHHHHHHHhhcCCcccCCChhhhhHHHHHHhcC
Q psy12033          2 PFFSKFTFRFGLDSSCGQRILPIDMAIILWKLVFSIRVSCDESFILTAWLNFLSQHTHVVRGIPRDTWNMFLTFYDTI   79 (79)
Q Consensus         2 k~~Y~ftF~f~~~~~~gqK~L~~e~Ai~~W~lll~~~~~~~~~~~l~~W~~FL~~~~~~~k~IskD~W~~~l~F~~~i   79 (79)
                      |+||+|||+|+|+  +|||+|++|+||+||+|||+++.    +++++.|++||+++  ++|+||||+|+|+++|+++|
T Consensus        23 ~~~Y~f~F~~~~~--~~qr~l~~e~Ai~~W~llf~~~~----~~~l~~w~~Fl~~~--~~k~IskD~W~~~l~F~~~~   92 (117)
T PF03556_consen   23 KKFYRFTFDFARE--EGQRSLPLETAIAYWRLLFSGRF----FPLLDSWIEFLEEK--YKKAISKDTWNQFLDFFKTV   92 (117)
T ss_dssp             HHHHHHHHHHHS---TT-SSEEHHHHHHHHHHHTTTTS----SCCHHHHHHHHHHC--T-SEEEHHHHHHHHHHHHH-
T ss_pred             HHHHHHHHHHhCC--cccCCCCHHHHHHHHHHHcCCCC----cHHHHHHHHHHHHc--CCcCcChhHHHHHHHHHHhc
Confidence            5799999999999  99999999999999999998772    69999999999985  88999999999999999875


No 2  
>KOG3077|consensus
Probab=99.90  E-value=1.9e-24  Score=157.10  Aligned_cols=69  Identities=39%  Similarity=0.777  Sum_probs=65.2

Q ss_pred             CceeeeeccccccccCCCccccHHHHHHHHhhhhcccccCCchhhHHHHHHHHhhcCCcccCCChhhhhHHHHHHhcC
Q psy12033          2 PFFSKFTFRFGLDSSCGQRILPIDMAIILWKLVFSIRVSCDESFILTAWLNFLSQHTHVVRGIPRDTWNMFLTFYDTI   79 (79)
Q Consensus         2 k~~Y~ftF~f~~~~~~gqK~L~~e~Ai~~W~lll~~~~~~~~~~~l~~W~~FL~~~~~~~k~IskD~W~~~l~F~~~i   79 (79)
                      |++|+|||+||+|  +|||+|++++||+||+|||+.+     +|+|++|++||+.+  +++.||||||+|+|+|+++|
T Consensus       156 k~iY~faf~fa~e--~~qk~Ld~~~ai~~w~ll~~~~-----~pll~~w~~FL~~~--~~~~~~KDtW~~~l~Fs~~i  224 (260)
T KOG3077|consen  156 KSIYRFAFNFAKE--PGQKSLDLETAISLWKLLFGQT-----PPLLDQWIQFLKDS--PNRAISKDTWNLLLDFSKTI  224 (260)
T ss_pred             hHHHHhhhhhccC--cCcCcCCHHHHHHHHHHHhCCC-----CchHHHHHHHHHhC--cCcccCcccHHHHHHHHHhc
Confidence            6899999999999  9999999999999999999777     79999999999996  88999999999999999865


No 3  
>KOG3077|consensus
Probab=85.25  E-value=0.86  Score=33.75  Aligned_cols=66  Identities=15%  Similarity=0.089  Sum_probs=51.4

Q ss_pred             eeeeeccccccccCCCccccHHHHHHHHhhhhcccccCCchhhHHHHHHHHhhcCCcccCCChhhhhHHHHHHhcC
Q psy12033          4 FSKFTFRFGLDSSCGQRILPIDMAIILWKLVFSIRVSCDESFILTAWLNFLSQHTHVVRGIPRDTWNMFLTFYDTI   79 (79)
Q Consensus         4 ~Y~ftF~f~~~~~~gqK~L~~e~Ai~~W~lll~~~~~~~~~~~l~~W~~FL~~~~~~~k~IskD~W~~~l~F~~~i   79 (79)
                      .|...+.|+.|  =|....++.++|--|+|- +++     ...+..|+-+-+-  ..-..+|-|+|.+.|+|.+++
T Consensus        83 ~~dgi~~fc~d--lg~~p~~i~~LvlAwkl~-A~~-----m~~Fsr~ef~~g~--~~l~~dS~d~lq~~l~~l~~~  148 (260)
T KOG3077|consen   83 GPDGIEKFCED--LGVEPEDISVLVLAWKLG-AAT-----MCEFSREEFLKGM--TALGCDSIDKLQQRLDFLRSV  148 (260)
T ss_pred             ChHHHHHHHHH--hCCCchhHHHHHHHHHhc-cch-----hhhhhHHHHHHHH--HHcCCCcHHHHHHHHHHHHHH
Confidence            35567788888  899999999999999999 766     5667666544322  245689999999999998753


No 4  
>PF13720 Acetyltransf_11:  Udp N-acetylglucosamine O-acyltransferase; Domain 2; PDB: 3I3A_A 3I3X_A 3HSQ_B 2JF2_A 1LXA_A 2AQ9_A 2QIV_X 2QIA_A 2JF3_A 4EQY_F ....
Probab=63.10  E-value=21  Score=21.59  Aligned_cols=36  Identities=22%  Similarity=0.268  Sum_probs=20.6

Q ss_pred             ccHHHHHHHHhhhhcccccCCchhhHHHHHHHHhhcCCcccCCCh
Q psy12033         22 LPIDMAIILWKLVFSIRVSCDESFILTAWLNFLSQHTHVVRGIPR   66 (79)
Q Consensus        22 L~~e~Ai~~W~lll~~~~~~~~~~~l~~W~~FL~~~~~~~k~Isk   66 (79)
                      +.++.|++--.-..+.      .|.+..-++|+++   .+|+|-|
T Consensus        48 ~~~~~a~~~l~~~~~~------~~~v~~~~~Fi~~---S~RGi~R   83 (83)
T PF13720_consen   48 LTLEEALEELEEEYPD------SPEVREIVDFIRN---SKRGICR   83 (83)
T ss_dssp             S-HHHHHHHHHHHTTS------CHHHHHHHHHHHH---TSS-B--
T ss_pred             CCHHHHHHHHHHhccC------CHHHHHHHHHHHh---CCCCCcC
Confidence            4555555443333332      5889999999986   4577753


No 5  
>PF08671 SinI:  Anti-repressor SinI;  InterPro: IPR010981 The SinR repressor is part of a group of Sin (sporulation inhibition) proteins in Bacillus subtilis that regulate the commitment to sporulation in response to extreme adversity []. SinR is a tetrameric repressor protein that binds to the promoters of genes essential for entry into sporulation and prevents their transcription. This repression is overcome through the activity of SinI, which disrupts the SinR tetramer through the formation of a SinI-SinR heterodimer, thereby allowing sporulation to proceed. The SinR structure consists of two domains: a dimerisation domain stabilised by a hydrophobic core, and a DNA-binding domain that is identical to domains of the bacteriophage 434 CI and Cro proteins that regulate prophage induction. The dimerisation domain is a four-helical bundle formed from two helices from the C-terminal residues of SinR and two helices from the central residues of SinI. These regions in SinR and SinI are similar in both structure and sequence. The interaction of SinR monomers to form tetramers is weaker than between SinR and SinI, since SinI can effectively disrupt SinR tetramers. This entry represents the dimerisation domain in both SinI and SinR proteins.; GO: 0005488 binding, 0006355 regulation of transcription, DNA-dependent; PDB: 1B0N_A 2YAL_A.
Probab=56.04  E-value=16  Score=18.47  Aligned_cols=28  Identities=18%  Similarity=0.565  Sum_probs=20.7

Q ss_pred             HHHHHHHhhcCCcccCCChhhhhHHHHHHh
Q psy12033         48 TAWLNFLSQHTHVVRGIPRDTWNMFLTFYD   77 (79)
Q Consensus        48 ~~W~~FL~~~~~~~k~IskD~W~~~l~F~~   77 (79)
                      ..|++.+.+-  ..-+||++.=..||+|.+
T Consensus         3 ~EW~~Li~eA--~~~Gls~eeir~FL~~~k   30 (30)
T PF08671_consen    3 EEWVELIKEA--KESGLSKEEIREFLEFNK   30 (30)
T ss_dssp             HHHHHHHHHH--HHTT--HHHHHHHHHHHH
T ss_pred             HHHHHHHHHH--HHcCCCHHHHHHHHHhCC
Confidence            4699998774  567999999999998863


No 6  
>PF07864 DUF1651:  Protein of unknown function (DUF1651);  InterPro: IPR012447  The proteins in this entry have not been characterised.
Probab=52.71  E-value=8.3  Score=22.83  Aligned_cols=22  Identities=27%  Similarity=0.259  Sum_probs=18.9

Q ss_pred             CccccHHHHHHHHhhhhccccc
Q psy12033         19 QRILPIDMAIILWKLVFSIRVS   40 (79)
Q Consensus        19 qK~L~~e~Ai~~W~lll~~~~~   40 (79)
                      .|-|.++.|++.|+-|+...|.
T Consensus        47 rr~l~~~~A~e~W~~L~~~GW~   68 (75)
T PF07864_consen   47 RRRLTREEARELWKELQKTGWR   68 (75)
T ss_pred             EEEEEHHHHHHHHHHHHHcCCE
Confidence            4789999999999999987654


No 7  
>PRK05289 UDP-N-acetylglucosamine acyltransferase; Provisional
Probab=46.30  E-value=37  Score=24.29  Aligned_cols=20  Identities=35%  Similarity=0.449  Sum_probs=15.2

Q ss_pred             hhhHHHHHHHHhhcCCcccCCCh
Q psy12033         44 SFILTAWLNFLSQHTHVVRGIPR   66 (79)
Q Consensus        44 ~~~l~~W~~FL~~~~~~~k~Isk   66 (79)
                      .|.+...++|+++   .+|+|.+
T Consensus       240 ~~~~~~~~~f~~~---~~rg~~~  259 (262)
T PRK05289        240 SPEVKEILDFIES---SKRGIIR  259 (262)
T ss_pred             CHHHHHHHHHHhc---CCCCCCC
Confidence            5778899999976   4677754


No 8  
>PF02671 PAH:  Paired amphipathic helix repeat;  InterPro: IPR003822 This family contains the paired amphipathic helix (PAH) repeat. The family contains the eukaryotic Sin3 proteins, which have at least three PAH domains (PAH1, PAH2, and PAH3). Sin3 proteins are components of a co-repressor complex that silences transcription, playing important roles in the transition between proliferation and differentiation. Sin3 proteins are recruited to the DNA by various DNA-binding transcription factors such as the Mad family of repressors, Mnt/Rox, PLZF, MeCP2, p53, REST/NRSF, MNFbeta, Sp1, TGIF and Ume6 []. Sin3 acts as a scaffold protein that in turn recruits histone-binding proteins RbAp46/RbAp48 and histone deacetylases HDAC1/HDAC2, which deacetylate the core histones resulting in a repressed state of the chromatin []. The PAH domains are protein-protein interaction domains through which Sin3 fulfils its role as a scaffold. The PAH2 domain of Sin3 can interact with a wide range of unrelated and structurally diverse transcription factors that bind using different interaction motifs. For example, the Sin3 PAH2 domain can interact with the unrelated Mad and HBP1 factors using alternative interaction motifs that involve binding in opposite helical orientations [].; GO: 0006355 regulation of transcription, DNA-dependent, 0005634 nucleus; PDB: 1S5Q_B 2L9S_B 1G1E_B 1S5R_B 2CR7_A 2CZY_A 2LD7_B 2RMR_A 2RMS_A 1PD7_A ....
Probab=45.04  E-value=47  Score=17.47  Aligned_cols=31  Identities=13%  Similarity=0.055  Sum_probs=24.0

Q ss_pred             CccccHHHHHHHHhhhhcccccCCchhhHHHHHHHH
Q psy12033         19 QRILPIDMAIILWKLVFSIRVSCDESFILTAWLNFL   54 (79)
Q Consensus        19 qK~L~~e~Ai~~W~lll~~~~~~~~~~~l~~W~~FL   54 (79)
                      ++.++.+..++--.-||.+.     ..+++.+..||
T Consensus        16 ~~~~~~~~v~~~v~~Ll~~h-----pdLl~~F~~Fl   46 (47)
T PF02671_consen   16 KGRISRSEVIEEVSELLRGH-----PDLLEEFNRFL   46 (47)
T ss_dssp             CTCSCHHHHHHHHHHHTTT------HHHHHHHHHHS
T ss_pred             hcCCCHHHHHHHHHHHHccC-----HHHHHHHHhhC
Confidence            35677788888888899887     68888888886


No 9  
>cd01053 AOX Alternative oxidase, ferritin-like diiron-binding domain. Alternative oxidase (AOX) is a mitochondrial ubiquinol oxidase found in plants and some fungi and protists. AOX is a member of the ferritin-like diiron-carboxylate superfamily. The plant mitochondrial protein alternative oxidase catalyses dioxygen dependent ubiquinol oxidation to yield ubiquinone and water. AOX is a cyanide-resistant, salicylhydroxamic acid-sensitive oxidase that transfers electrons from ubiquinol to oxygen, bypassing the cytochrome chain. AOX has been proposed to contain a hydroxo-bridged diiron center within a four-helix bundle and a proximal redox-active tyrosine residue. AOX is proposed to be peripherally associated with the matrix side of the inner mitochondrial membrane. Fungal and protozoan AOXs generally exist as monomers. In plants, AOX is dimeric. Pyruvate is an allosteric activator of plant AOX involved in the reversible inactivation of the enzyme though the formation of an intermolecular 
Probab=42.67  E-value=12  Score=26.09  Aligned_cols=17  Identities=35%  Similarity=0.616  Sum_probs=13.1

Q ss_pred             CCCc-cccH-HHHHHHHhh
Q psy12033         17 CGQR-ILPI-DMAIILWKL   33 (79)
Q Consensus        17 ~gqK-~L~~-e~Ai~~W~l   33 (79)
                      .|.+ +++. ++|++||++
T Consensus       119 ~g~~~~~paP~iAi~Yw~l  137 (168)
T cd01053         119 EGLKPDLPAPEIAIEYYRL  137 (168)
T ss_pred             ccccCCCCCCHHHHHHhCC
Confidence            5666 6655 999999994


No 10 
>KOG2873|consensus
Probab=41.96  E-value=46  Score=25.08  Aligned_cols=40  Identities=23%  Similarity=0.235  Sum_probs=28.8

Q ss_pred             CCCccccHHHHHHHHhhhhcccccCCchhhHHHHHHHHhhc
Q psy12033         17 CGQRILPIDMAIILWKLVFSIRVSCDESFILTAWLNFLSQH   57 (79)
Q Consensus        17 ~gqK~L~~e~Ai~~W~lll~~~~~~~~~~~l~~W~~FL~~~   57 (79)
                      +|==+=|-..|+++|+-||.++ +++...+|+.=++|++.+
T Consensus       213 eG~l~dD~vLA~alWRnlF~~r-~~~D~~hle~vV~YvR~q  252 (284)
T KOG2873|consen  213 EGFLSDDRVLATALWRNLFSGR-GNVDLVHLEAVVRYVRSQ  252 (284)
T ss_pred             ccccccchHHHHHHHHHHhCCC-CCcCHHHHHHHHHHHHHH
Confidence            3333334488999999999976 234457888989998764


No 11 
>PRK12461 UDP-N-acetylglucosamine acyltransferase; Provisional
Probab=40.12  E-value=58  Score=23.46  Aligned_cols=36  Identities=22%  Similarity=0.205  Sum_probs=23.5

Q ss_pred             cccHHHHHHHHhhhhcccccCCchhhHHHHHHHHhhcCCcccCCC
Q psy12033         21 ILPIDMAIILWKLVFSIRVSCDESFILTAWLNFLSQHTHVVRGIP   65 (79)
Q Consensus        21 ~L~~e~Ai~~W~lll~~~~~~~~~~~l~~W~~FL~~~~~~~k~Is   65 (79)
                      .++++.|++--+-.++.      .|.+...++|+++   .+|.|-
T Consensus       219 ~~~~~~~~~~~~~~~~~------~~~~~~~~~f~~~---s~rg~~  254 (255)
T PRK12461        219 GLSVQQAVAELELQQFE------SPEVEELIDFIKA---SKRGIV  254 (255)
T ss_pred             CCCHHHHHHHHHHhccC------CHHHHHHHHHHHc---cCCCCC
Confidence            45666666554443333      4778999999976   567764


No 12 
>PF12588 PSDC:  Phophatidylserine decarboxylase ;  InterPro: IPR022237  This domain family is found in bacteria and eukaryotes, and is approximately 140 amino acids in length. The family is found in association with PF02666 from PFAM. Phosphatidylserine decarboxylase (PSD) is an important enzyme in the synthesis of phosphatidylethanolamine in both prokaryotes and eukaryotes. 
Probab=34.87  E-value=20  Score=24.11  Aligned_cols=22  Identities=32%  Similarity=0.415  Sum_probs=16.2

Q ss_pred             hhHHHHHHHHhhcCCcccCCChh
Q psy12033         45 FILTAWLNFLSQHTHVVRGIPRD   67 (79)
Q Consensus        45 ~~l~~W~~FL~~~~~~~k~IskD   67 (79)
                      ..|+.|.+||.+. .+..+++.|
T Consensus       104 ~ILn~W~~fL~sp-~S~~vL~~~  125 (141)
T PF12588_consen  104 KILNEWGEFLSSP-ASRSVLNTD  125 (141)
T ss_pred             HHHHHHHHHcCCh-hhhccccCC
Confidence            6799999999875 445566644


No 13 
>PF07346 DUF1477:  Protein of unknown function (DUF1477);  InterPro: IPR009946 This entry is represented by Autographa californica nuclear polyhedrosis virus (AcMNPV), Orf19; it is a family of uncharacterised viral proteins.
Probab=33.77  E-value=32  Score=22.67  Aligned_cols=56  Identities=18%  Similarity=0.261  Sum_probs=37.3

Q ss_pred             CCceeeeeccccccccCCCccccHHHHHHHHhhhhccccc-CCchhhHHHHHHHHhhc
Q psy12033          1 MPFFSKFTFRFGLDSSCGQRILPIDMAIILWKLVFSIRVS-CDESFILTAWLNFLSQH   57 (79)
Q Consensus         1 ~k~~Y~ftF~f~~~~~~gqK~L~~e~Ai~~W~lll~~~~~-~~~~~~l~~W~~FL~~~   57 (79)
                      ++-||..|+.|.+.. -.+.++.++|+..+-+.+...... =.....|+--+.||-.+
T Consensus        39 ~~~Fy~~c~~~v~~~-~~~~~~~l~Tl~~lfD~II~~Er~~F~kS~vLn~lV~FLi~~   95 (118)
T PF07346_consen   39 HRLFYNLCISFVTKL-VTGNSLALNTLKNLFDKIIETERNVFNKSRVLNFLVNFLIAH   95 (118)
T ss_pred             hhHHHHHHHHHHHHH-hcCCcchHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHc
Confidence            356899999999772 277778888877777666652100 00147788899998664


No 14 
>smart00386 HAT HAT (Half-A-TPR) repeats. Present in several RNA-binding proteins. Structurally and sequentially thought to be similar to TPRs.
Probab=28.68  E-value=50  Score=14.70  Aligned_cols=13  Identities=15%  Similarity=0.401  Sum_probs=7.6

Q ss_pred             CChhhhhHHHHHH
Q psy12033         64 IPRDTWNMFLTFY   76 (79)
Q Consensus        64 IskD~W~~~l~F~   76 (79)
                      -+.+.|.++++|.
T Consensus        19 ~~~~~W~~y~~~e   31 (33)
T smart00386       19 KSVELWLKYAEFE   31 (33)
T ss_pred             CChHHHHHHHHHH
Confidence            4556666666554


No 15 
>PF12512 DUF3717:  Protein of unknown function (DUF3717) ;  InterPro: IPR022191  This family of proteins is found in bacteria. Proteins in this family are typically between 75 and 117 amino acids in length. There is a conserved AIN sequence motif. There are two completely conserved residues (L and Y) that may be functionally important. 
Probab=25.54  E-value=44  Score=20.19  Aligned_cols=16  Identities=25%  Similarity=0.358  Sum_probs=13.2

Q ss_pred             ccHHHHHHHHhhhhcc
Q psy12033         22 LPIDMAIILWKLVFSI   37 (79)
Q Consensus        22 L~~e~Ai~~W~lll~~   37 (79)
                      -++|-||-||+--=|.
T Consensus         7 ~dIE~AIN~WR~r~Ps   22 (71)
T PF12512_consen    7 TDIEAAINYWRARSPS   22 (71)
T ss_pred             HHHHHHHHHHHhcCCC
Confidence            3689999999987764


No 16 
>cd03207 GST_C_8 GST_C family, unknown subfamily 8; composed of uncharacterized bacterial proteins with similarity to GSTs. GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins, and products of oxidative stress. GSTs also show GSH peroxidase activity and are involved in the synthesis of prostaglandins and leukotrienes. The GST fold contains an N-terminal thioredoxin-fold domain and a C-terminal alpha helical domain, with an active site located in a cleft between the two domains. GSH binds to the N-terminal domain while the hydrophobic substrate occupies a pocket in the C-terminal domain.
Probab=24.74  E-value=32  Score=20.17  Aligned_cols=25  Identities=16%  Similarity=0.232  Sum_probs=17.4

Q ss_pred             chhhHHHHHHHHhhcCCcccCCChh
Q psy12033         43 ESFILTAWLNFLSQHTHVVRGIPRD   67 (79)
Q Consensus        43 ~~~~l~~W~~FL~~~~~~~k~IskD   67 (79)
                      .+|.+..|++-+++.+..+++..+|
T Consensus        79 ~~p~l~~w~~~~~~~p~~~~~~~~~  103 (103)
T cd03207          79 ERPAFDAYIARITDRPAFQRAAAID  103 (103)
T ss_pred             CChHHHHHHHHHHcCHHHHHHhccC
Confidence            4799999999998764444444443


No 17 
>PF11772 EpuA:  DNA-directed RNA polymerase subunit beta;  InterPro: IPR024596 DNA-directed RNA polymerases 2.7.7.6 from EC (also known as DNA-dependent RNA polymerases) are responsible for the polymerisation of ribonucleotides into a sequence complementary to the template DNA. In eukaryotes, there are three different forms of DNA-directed RNA polymerases transcribing different sets of genes. Most RNA polymerases are multimeric enzymes and are composed of a variable number of subunits. The core RNA polymerase complex consists of five subunits (two alpha, one beta, one beta-prime and one omega) and is sufficient for transcription elongation and termination but is unable to initiate transcription. Transcription initiation from promoter elements requires a sixth, dissociable subunit called a sigma factor, which reversibly associates with the core RNA polymerase complex to form a holoenzyme []. The core RNA polymerase complex forms a "crab claw"-like structure with an internal channel running along the full length []. The key functional sites of the enzyme, as defined by mutational and cross-linking analysis, are located on the inner wall of this channel. RNA synthesis follows after the attachment of RNA polymerase to a specific site, the promoter, on the template DNA strand. The RNA synthesis process continues until a termination sequence is reached. The RNA product, which is synthesised in the 5' to 3'direction, is known as the primary transcript. Eukaryotic nuclei contain three distinct types of RNA polymerases that differ in the RNA they synthesise:  RNA polymerase I: located in the nucleoli, synthesises precursors of most ribosomal RNAs. RNA polymerase II: occurs in the nucleoplasm, synthesises mRNA precursors.  RNA polymerase III: also occurs in the nucleoplasm, synthesises the precursors of 5S ribosomal RNA, the tRNAs, and a variety of other small nuclear and cytosolic RNAs.   Eukaryotic cells are also known to contain separate mitochondrial and chloroplast RNA polymerases. Eukaryotic RNA polymerases, whose molecular masses vary in size from 500 to 700 kDa, contain two non-identical large (>100 kDa) subunits and an array of up to 12 different small (less than 50 kDa) subunits. This entry represents the short 60-residue long bacterial family that is the beta subunit of the DNA-directed RNA polymerase, likely to be 2.7.7.6 from EC It is membrane-bound and is referred to by the name EpuA.
Probab=22.39  E-value=71  Score=17.67  Aligned_cols=18  Identities=22%  Similarity=0.591  Sum_probs=14.4

Q ss_pred             cccCCChhhhhHHHHHHh
Q psy12033         60 VVRGIPRDTWNMFLTFYD   77 (79)
Q Consensus        60 ~~k~IskD~W~~~l~F~~   77 (79)
                      .....|.|||+-+.+|..
T Consensus        28 p~~vf~~~tW~hi~d~~~   45 (47)
T PF11772_consen   28 PFDVFSPDTWQHIIDFFT   45 (47)
T ss_pred             HHHhCCHHHHHHHHHHHc
Confidence            345789999999998864


No 18 
>PF10827 DUF2552:  Protein of unknown function (DUF2552) ;  InterPro: IPR020157 This entry contains proteins with no known function.
Probab=22.37  E-value=41  Score=20.61  Aligned_cols=23  Identities=22%  Similarity=0.710  Sum_probs=15.6

Q ss_pred             HHHHHHHhhcC---------CcccCCChhhhh
Q psy12033         48 TAWLNFLSQHT---------HVVRGIPRDTWN   70 (79)
Q Consensus        48 ~~W~~FL~~~~---------~~~k~IskD~W~   70 (79)
                      .-|..||.++.         ....++.||.|-
T Consensus        15 kTWvSFl~~NhPYsLLHWSi~G~~~~~kDVWL   46 (79)
T PF10827_consen   15 KTWVSFLNNNHPYSLLHWSIAGAESVKKDVWL   46 (79)
T ss_pred             chHHHhhcCCCCceeeeeeeccccccccceEE
Confidence            46999998762         122367888884


Done!