Diaphorina citri psyllid: psy12060


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------940-------950-------960-------970-------98
MSLISSCLFIFVSFHSVFSQTIDELELRCPQHWVQYRDSCYRFVKSPLKTRNDAKLNCKSLDSDLANVNDADEHGFIMYQLFWQDPQRRKWYFGGTQQSPNLWVNEDGTNLNELDAAFLPEPADNVQRDYLAYSFSQSLKRWGFERVTGMEPLLFICEASIQKLHYLLNDDRTYQYGMDIENPDKIPRGPYFIKQPTDVVFDLSKRSILNDITLSCYAGGYPNPSYEWFKEDYVQDRLVANLIDPLSDKRFTLSGGNLIINDPRQVEDRGSYHCKASNKFGSIISESVQLAFGFIGEFNLKRAPEIGNQNWGKAMFCDPPTNYPGVNYYWARDYFPNFVEEDKRVFVSYDGALYFSALEQIDAGNYSCNVQSKVSDTGRNGPFFPLKVFPHSNFQQLKFPNNFPKTFPEAPKAGDKVRLECVAFGYPVPSYNWTRRGSPLPRNAYFENFNRILTIPNVKVEDQGEYICRASNDRSALESSVTISIQAEPNFTIPLTDKHMDNQADLTWTCEAFGVPDVTYSWFRNGELLNSETLPLEDQDRYFIQDNVLTIRYLNPERDPAMYQCRAKNQLKTRYSSAQLRVLTLKPSFKKRPLESETYAGEGGNVTIFCNPEAAPKPKFVWKKDGNIIGSGGRRKIFENGNLLISPVSRDDSGIYSCTATNVHGMDESKGRLIVLHGPSYYEQLPPKITIAAHRNLQLRCSAHTEELLDVAYIWTHNGVRIGNMDLNELETPNINIDGGLLEITNASFADAGEYECVVKSTVGKISTKTTVIVEGPPGLPGGVQVVEVHKTSATIQWTDGATNGRPITHYKIIARTNWNSTWFNVSEHVIGKEVDRYTGRKEASIENVLVPWSTYEFKVIAGNELGYGEPSSPSPQYNTPADKPYQAPSRIGGGGGKIGDLSISWEPLPREKQNAPNIYYKIFWRKKNDTEFQSETLKEYGNVGIAVVRIPSEFYYTEYEVKVQAINDVGPGPESEV
cccEEEEEEEEEEEcccccccccccccccccccEEccccEEEEECcccccccccccEEEEEcccCEEEcccccccEEEEEEECccccccccccccccccccEEECccccCEECccccccccccCEEECccEEEcccccccEEEEECccccccCEEEEEEEEcccEEEEccccCEEEEEEECcccccccccCEECccccCECccccccccccEEEEEEEEECcccEEEEEEccEEccccccCCcccccccEEEEEccEEEEEccccccccCEEEEEEECccccEEEEEEEEEEEEccccccccccCEEEccccEEEEccccccccccEEEEEEcccccccccccEEEEccccEEEEEEEcccccCEEEEEEECcccccEEEcccEEEEEccccccccccccccccccccccccccccEEEEEEEEECcccEEEEEEcccccccccEEEEcccEEEEccccccccEEEEEEEEEcccEEEEEEEEEEEEEcEEEcccccEEEcccccEEEEEEEEEEcccEEEEEEccEEcccccccccccccEEECccEEEEEEcccccccCEEEEEEEEccEEEEEEEEEEEEECcccccccccccEEEEECccEEEEEcccccccccEEEEEEccCEccccccEEEcccccEEEccccccccEEEEEEEEcccccCEEEEEEEEECcccCECcccccCEEEccccEEEEEEEEEcccccEEEEEEEccCECcccccccccccEEECcccEEEEEcccccccEEEEEEEEcccccCEEEEEEEEEccccccccCEEEEEEccEEEEEEEccccccccccEEEEEEECccccccEEEccccccCEEEEEcccccEEEEEcccccEEEEEEEEEEEccEEcccccccccEEccccccccccccCEEECccccCEEEEEECcccccccccccEEEEEEEEccccccEEEEEEEEccccCEEEEcccccccCEEEEEEEEEccccccccccc
**LISSCLFIFVSFHSVFSQTIDELELRCPQHWVQYRDSCYRFVKSPLKTRNDAKLNCKSLDSDLANVNDADEHGFIMYQLFWQDPQRRKWYFGGTQQSPNLWVNEDGTNLNELDAAFLPEPADNVQRDYLAYSFSQSLKRWGFERVTGMEPLLFICEASIQKLHYLLNDDRTYQYGMDIENPDKIPRGPYFIKQPTDVVFDLSKRSILNDITLSCYAGGYPNPSYEWFKEDYVQDRLVANLIDPLSDKRFTLSGGNLIINDPRQVEDRGSYHCKASNKFGSIISESVQLAFGFIGEFNLKRAPEIGNQNWGKAMFCDPPTNYPGVNYYWARDYFPNFVEEDKRVFVSYDGALYFSALEQIDAGNYSCNVQSKVSDTGRNGPFFPLKVFPHSNFQQLKFPNNFPKTFPEAPKAGDKVRLECVAFGYPVPSYNWTRRGSPLPRNAYFENFNRILTIPNVKVEDQGEYICRASNDRSALESSVTISIQAEPNFTIPLTDKHMDNQADLTWTCEAFGVPDVTYSWFRNGELLNSETLPLEDQDRYFIQDNVLTIRYLNPERDPAMYQCRAKNQLKTRYSSAQLRVLTLKPSFKKRPLESETYAGEGGNVTIFCNPEAAPKPKFVWKKDGNIIGSGGRRKIFENGNLLISPVSRDDSGIYSCTATNVHGMDESKGRLIVLHGPSYYEQLPPKITIAAHRNLQLRCSAHTEELLDVAYIWTHNGVRIGNMDLNELETPNINIDGGLLEITNASFADAGEYECVVKSTVGKISTKTTVIVEGPPGLPGGVQVVEVHKTSATIQWTDGATNGRPITHYKIIARTNWNSTWFNVSEHVIGKEVDRYTGRKEASIENVLVPWSTYEFKVIAGNELGYGEPSSP**********************GKIGDLSISWEPLPREKQNAPNIYYKIFWRKKNDTEFQSETLKEYGNVGIAVVRIPSEFYYTEYEVKVQAINDVGPGP****
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSLISSCLFIFVSFHSVFSQTIDELELRCPQHWVQYRDSCYRFVKSPLKTRNDAKLNCKSLDSDLANVNDADEHGFIMYQLFWQDPQRRKWYFGGTQQSPNLWVNEDGTNLNELDAAFLPEPADNVQRDYLAYSFSQSLKRWGFERVTGMEPLLFICEASIQKLHYLLNDDRTYQYGMDIENPDKIPRGPYFIKQPTDVVFDLSKRSILNDITLSCYAGGYPNPSYEWFKEDYVQDRLVANLIDPLSDKRFTLSGGNLIINDPRQVEDRGSYHCKASNKFGSIISESVQLAFGFIGEFNLKRAPEIGNQNWGKAMFCDPPTNYPGVNYYWARDYFPNFVEEDKRVFVSYDGALYFSALEQIDAGNYSCNVQSKVSDTGRNGPFFPLKVFPHSNFQQLKFPNNFPKTFPEAPKAGDKVRLECVAFGYPVPSYNWTRRGSPLPRNAYFENFNRILTIPNVKVEDQGEYICRASNDRSALESSVTISIQAEPNFTIPLTDKHMDNQADLTWTCEAFGVPDVTYSWFRNGELLNSETLPLEDQDRYFIQDNVLTIRYLNPERDPAMYQCRAKNQLKTRYSSAQLRVLTLKPSFKKRPLESETYAGEGGNVTIFCNPEAAPKPKFVWKKDGNIIGSGGRRKIFENGNLLISPVSRDDSGIYSCTATNVHGMDESKGRLIVLHGPSYYEQLPPKITIAAHRNLQLRCSAHTEELLDVAYIWTHNGVRIGNMDLNELETPNINIDGGLLEITNASFADAGEYECVVKSTVGKISTKTTVIVEGPPGLPGGVQVVEVHKTSATIQWTDGATNGRPITHYKIIARTNWNSTWFNVSEHVIGKEVDRYTGRKEASIENVLVPWSTYEFKVIAGNELGYGEPSSPSPQYNTPADKPYQAPSRIGGGGGKIGDLSISWEPLPREKQNAPNIYYKIFWRKKNDTEFQSETLKEYGNVGIAVVRIPSEFYYTEYEVKVQAINDVGPGPESEV

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Contactin Required for organization of septate junctions and paracellular barrier functions. Septate junctions, which are the equivalent of vertebrates tight junctions, are characterized by regular arrays of transverse structures that span the intermembrane space and form a physical barrier to diffusion.confidentQ9VN14
Contactin-4 Contactins mediate cell surface interactions during nervous system development. Has some neurite outgrowth-promoting activity. May be involved in synaptogenesis.confidentQ69Z26
Contactin-3 Contactins mediate cell surface interactions during nervous system development. Has some neurite outgrowth-promoting activity.confidentQ62682

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005919 [CC]pleated septate junctionprobableGO:0070160, GO:0005575, GO:0005911, GO:0043296, GO:0030054, GO:0005918
GO:0043209 [CC]myelin sheathprobableGO:0005575, GO:0044464, GO:0005623
GO:0019991 [BP]septate junction assemblyprobableGO:0022607, GO:0034330, GO:0016043, GO:0034329, GO:0008150, GO:0044085, GO:0007043, GO:0071840, GO:0045216, GO:0044763, GO:0009987, GO:0043297, GO:0044699
GO:0008366 [BP]axon ensheathmentprobableGO:0042391, GO:0019226, GO:0035637, GO:0050801, GO:0019228, GO:0042592, GO:0023052, GO:0001508, GO:0007272, GO:0007275, GO:0044699, GO:0065007, GO:0019725, GO:0065008, GO:0032502, GO:0032501, GO:0050877, GO:0009987, GO:0006873, GO:0008150, GO:0048731, GO:0007154, GO:0055082, GO:0003008, GO:0044700, GO:0044707, GO:0007399, GO:0048856, GO:0048878, GO:0044763
GO:0043025 [CC]neuronal cell bodyprobableGO:0005575, GO:0097458, GO:0044297, GO:0005623, GO:0044464
GO:0010646 [BP]regulation of cell communicationprobableGO:0008150, GO:0065007, GO:0050789, GO:0050794
GO:0044224 [CC]juxtaparanode region of axonprobableGO:0044304, GO:0044463, GO:0044464, GO:0005623, GO:0030424, GO:0005575, GO:0097458, GO:0043005, GO:0033267, GO:0042995
GO:0010954 [BP]positive regulation of protein processingprobableGO:0070613, GO:0010604, GO:0080090, GO:0060255, GO:0051246, GO:0051247, GO:0050789, GO:0065007, GO:0048518, GO:0008150, GO:0019222, GO:0010468, GO:0009893
GO:0048522 [BP]positive regulation of cellular processprobableGO:0048518, GO:0008150, GO:0065007, GO:0050789, GO:0050794
GO:0007160 [BP]cell-matrix adhesionprobableGO:0031589, GO:0009987, GO:0044763, GO:0007155, GO:0008150, GO:0022610, GO:0044699
GO:0045665 [BP]negative regulation of neuron differentiationprobableGO:0030154, GO:0050789, GO:0044699, GO:0050767, GO:0048869, GO:0060284, GO:0007275, GO:0045664, GO:0065007, GO:0048519, GO:0032502, GO:0032501, GO:0050793, GO:0009987, GO:0050794, GO:0045596, GO:0045595, GO:0008150, GO:0051239, GO:0022008, GO:0051093, GO:0048699, GO:0044707, GO:0007399, GO:0048856, GO:0044763, GO:0051960, GO:2000026, GO:0048731, GO:0048523
GO:0008076 [CC]voltage-gated potassium channel complexprobableGO:0043234, GO:0032991, GO:0044459, GO:0016021, GO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0034702, GO:0034705, GO:0071944, GO:0034703, GO:0005887, GO:0005886, GO:0044425, GO:0031226, GO:0031224
GO:0071206 [BP]establishment of protein localization to juxtaparanode region of axonprobableGO:0033036, GO:0008104, GO:0070727, GO:0034613, GO:0051179, GO:0045184, GO:0008150, GO:0044763, GO:0009987, GO:0051234, GO:0071205, GO:0044699, GO:0051641
GO:0023051 [BP]regulation of signalingprobableGO:0008150, GO:0065007, GO:0050789
GO:0001948 [MF]glycoprotein bindingprobableGO:0003674, GO:0005488, GO:0005515
GO:0010769 [BP]regulation of cell morphogenesis involved in differentiationprobableGO:0022604, GO:0022603, GO:0050793, GO:0060284, GO:0051128, GO:0045595, GO:0065007, GO:0008150, GO:0050794, GO:0050789
GO:0031623 [BP]receptor internalizationprobableGO:0051234, GO:0006898, GO:0006897, GO:0016192, GO:0044260, GO:0006810, GO:0044237, GO:0043170, GO:0071704, GO:0044765, GO:0008150, GO:0008152, GO:0009987, GO:0043112, GO:0051179, GO:0044699
GO:0030246 [MF]carbohydrate bindingprobableGO:0003674, GO:0005488
GO:0045202 [CC]synapseprobableGO:0005575
GO:0021682 [BP]nerve maturationprobableGO:0032502, GO:0032501, GO:0044707, GO:0007399, GO:0048856, GO:0044767, GO:0008150, GO:0044699, GO:0048731, GO:0021675, GO:0010259, GO:0007275, GO:0071695
GO:0007420 [BP]brain developmentprobableGO:0032502, GO:0032501, GO:0044707, GO:0007399, GO:0048856, GO:0044767, GO:0048513, GO:0008150, GO:0048731, GO:0007275, GO:0044699, GO:0007417
GO:0060857 [BP]establishment of glial blood-brain barrierprobableGO:0032502, GO:0048856, GO:0007399, GO:0021782, GO:0009987, GO:0048869, GO:0030154, GO:0048468, GO:0042063, GO:0044767, GO:0032501, GO:0044763, GO:0060856, GO:0010001, GO:0048731, GO:0008150, GO:0022008, GO:0007275, GO:0044699, GO:0044707
GO:0009986 [CC]cell surfaceprobableGO:0005575, GO:0044464, GO:0005623
GO:0010975 [BP]regulation of neuron projection developmentprobableGO:0030154, GO:0051128, GO:0050789, GO:0044699, GO:0050767, GO:0048869, GO:0060284, GO:0031344, GO:0045664, GO:0065007, GO:0032502, GO:0032501, GO:0050793, GO:0009987, GO:0050794, GO:0045595, GO:0044763, GO:0051239, GO:0048731, GO:0022008, GO:0048699, GO:0044707, GO:0007399, GO:0048856, GO:0051960, GO:2000026, GO:0007275, GO:0008150
GO:0005737 [CC]cytoplasmprobableGO:0044424, GO:0005575, GO:0044464, GO:0005623, GO:0005622
GO:0033268 [CC]node of RanvierprobableGO:0044304, GO:0044463, GO:0044464, GO:0005623, GO:0030424, GO:0005575, GO:0097458, GO:0043005, GO:0033267, GO:0042995
GO:0007158 [BP]neuron cell-cell adhesionprobableGO:0016337, GO:0009987, GO:0044763, GO:0007155, GO:0008150, GO:0022610, GO:0044699
GO:0007411 [BP]axon guidanceprobableGO:0032502, GO:0044707, GO:0030030, GO:0030154, GO:0048468, GO:0031175, GO:0009653, GO:0007275, GO:0044699, GO:0000904, GO:0000902, GO:0042330, GO:0048869, GO:0016043, GO:0032989, GO:0071840, GO:0048666, GO:0048667, GO:0032501, GO:0006935, GO:0030182, GO:0009987, GO:0044767, GO:0008150, GO:0007409, GO:0048731, GO:0042221, GO:0022008, GO:0048858, GO:0040011, GO:0048699, GO:0032990, GO:0009605, GO:0050896, GO:0048856, GO:0007399, GO:0048812, GO:0044763

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3V2A, chain R
Confidence level:very confident
Coverage over the Query: 302-490
View the alignment between query and template
View the model in PyMOL
Template: 3V2A, chain R
Confidence level:very confident
Coverage over the Query: 195-393
View the alignment between query and template
View the model in PyMOL
Template: 2NZI, chain A
Confidence level:very confident
Coverage over the Query: 586-829,840-882
View the alignment between query and template
View the model in PyMOL
Template: 2JLL, chain A
Confidence level:very confident
Coverage over the Query: 598-977
View the alignment between query and template
View the model in PyMOL
Template: 2XR6, chain A
Confidence level:very confident
Coverage over the Query: 28-160
View the alignment between query and template
View the model in PyMOL