BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= psy12064
(148 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|3SWH|A Chain A, Munc13-1, Mun Domain, C-Terminal Module
pdb|3SWH|B Chain B, Munc13-1, Mun Domain, C-Terminal Module
Length = 341
Score = 104 bits (260), Expect = 2e-23, Method: Compositional matrix adjust.
Identities = 48/65 (73%), Positives = 58/65 (89%)
Query: 3 KSLSPKQCALLDASLDSIKNYFHAAGNGLKKTYLDKSPELASLRYALSLYTQTTDALIKT 62
KSL+PKQCA+++ +LD+IK YFHA G GLKKT+L+KSP+L SLRYALSLYTQ TD LIKT
Sbjct: 275 KSLTPKQCAVVELALDTIKQYFHAGGVGLKKTFLEKSPDLQSLRYALSLYTQATDLLIKT 334
Query: 63 FVQSQ 67
FVQ+Q
Sbjct: 335 FVQTQ 339
>pdb|2RIO|A Chain A, Structure Of The Dual Enzyme Ire1 Reveals The Basis For
Catalysis And Regulation Of Non-conventional Splicing
pdb|2RIO|B Chain B, Structure Of The Dual Enzyme Ire1 Reveals The Basis For
Catalysis And Regulation Of Non-conventional Splicing
Length = 434
Score = 30.0 bits (66), Expect = 0.45, Method: Compositional matrix adjust.
Identities = 15/49 (30%), Positives = 28/49 (57%), Gaps = 4/49 (8%)
Query: 104 VAVLQLKDIVEQVKHQICVKDYCFARDDRLVGVAV----LQLKDIVEQK 148
+A++++K + E H ++ YC DR + +A+ L L+D+VE K
Sbjct: 54 IALMEIKLLTESDDHPNVIRYYCSETTDRFLYIALELCNLNLQDLVESK 102
>pdb|3LJ0|A Chain A, Ire1 Complexed With Adp And Quercetin
pdb|3LJ0|B Chain B, Ire1 Complexed With Adp And Quercetin
pdb|3LJ1|A Chain A, Ire1 Complexed With Cdk12 INHIBITOR III
pdb|3LJ1|B Chain B, Ire1 Complexed With Cdk12 INHIBITOR III
pdb|3LJ2|A Chain A, Ire1 Complexed With Jak Inhibitor I
pdb|3LJ2|B Chain B, Ire1 Complexed With Jak Inhibitor I
Length = 434
Score = 30.0 bits (66), Expect = 0.47, Method: Compositional matrix adjust.
Identities = 15/49 (30%), Positives = 28/49 (57%), Gaps = 4/49 (8%)
Query: 104 VAVLQLKDIVEQVKHQICVKDYCFARDDRLVGVAV----LQLKDIVEQK 148
+A++++K + E H ++ YC DR + +A+ L L+D+VE K
Sbjct: 54 IALMEIKLLTESDDHPNVIRYYCSETTDRFLYIALELCNLNLQDLVESK 102
>pdb|2LJW|A Chain A, Solution Nmr Structure Of Alr2454 Protein From Nostoc
Sp. Strain Pcc 7120, Northeast Structural Genomics
Consortium Target Nsr264
Length = 110
Score = 30.0 bits (66), Expect = 0.49, Method: Compositional matrix adjust.
Identities = 16/52 (30%), Positives = 28/52 (53%), Gaps = 1/52 (1%)
Query: 1 MEKSLSPKQCALLDASLDSIKNYFHAAGNGLK-KTYLDKSPELASLRYALSL 51
+E++ P LDS+ NY HA G ++ KT++ ++ E L A+S+
Sbjct: 38 LEQASFPMNETEYQEHLDSVANYLHALGGAVQVKTFITQTKERPRLGKAVSI 89
>pdb|3SDJ|A Chain A, Structure Of Rnase-Inactive Point Mutant Of Oligomeric
KinaseRNASE Ire1
pdb|3SDJ|B Chain B, Structure Of Rnase-Inactive Point Mutant Of Oligomeric
KinaseRNASE Ire1
pdb|3SDJ|C Chain C, Structure Of Rnase-Inactive Point Mutant Of Oligomeric
KinaseRNASE Ire1
pdb|3SDJ|D Chain D, Structure Of Rnase-Inactive Point Mutant Of Oligomeric
KinaseRNASE Ire1
pdb|3SDJ|E Chain E, Structure Of Rnase-Inactive Point Mutant Of Oligomeric
KinaseRNASE Ire1
pdb|3SDJ|F Chain F, Structure Of Rnase-Inactive Point Mutant Of Oligomeric
KinaseRNASE Ire1
pdb|3SDJ|G Chain G, Structure Of Rnase-Inactive Point Mutant Of Oligomeric
KinaseRNASE Ire1
pdb|3SDJ|H Chain H, Structure Of Rnase-Inactive Point Mutant Of Oligomeric
KinaseRNASE Ire1
pdb|3SDJ|I Chain I, Structure Of Rnase-Inactive Point Mutant Of Oligomeric
KinaseRNASE Ire1
pdb|3SDJ|J Chain J, Structure Of Rnase-Inactive Point Mutant Of Oligomeric
KinaseRNASE Ire1
pdb|3SDJ|K Chain K, Structure Of Rnase-Inactive Point Mutant Of Oligomeric
KinaseRNASE Ire1
pdb|3SDJ|L Chain L, Structure Of Rnase-Inactive Point Mutant Of Oligomeric
KinaseRNASE Ire1
pdb|3SDJ|M Chain M, Structure Of Rnase-Inactive Point Mutant Of Oligomeric
KinaseRNASE Ire1
pdb|3SDJ|N Chain N, Structure Of Rnase-Inactive Point Mutant Of Oligomeric
KinaseRNASE Ire1
Length = 448
Score = 30.0 bits (66), Expect = 0.56, Method: Composition-based stats.
Identities = 15/49 (30%), Positives = 28/49 (57%), Gaps = 4/49 (8%)
Query: 104 VAVLQLKDIVEQVKHQICVKDYCFARDDRLVGVAV----LQLKDIVEQK 148
+A++++K + E H ++ YC DR + +A+ L L+D+VE K
Sbjct: 72 IALMEIKLLTESDDHPNVIRYYCSETTDRFLYIALELCNLNLQDLVESK 120
>pdb|3FBV|A Chain A, Crystal Structure Of The Oligomer Formed By The
Kinase-Ribonuclease Domain Of Ire1
pdb|3FBV|B Chain B, Crystal Structure Of The Oligomer Formed By The
Kinase-Ribonuclease Domain Of Ire1
pdb|3FBV|C Chain C, Crystal Structure Of The Oligomer Formed By The
Kinase-Ribonuclease Domain Of Ire1
pdb|3FBV|D Chain D, Crystal Structure Of The Oligomer Formed By The
Kinase-Ribonuclease Domain Of Ire1
pdb|3FBV|E Chain E, Crystal Structure Of The Oligomer Formed By The
Kinase-Ribonuclease Domain Of Ire1
pdb|3FBV|F Chain F, Crystal Structure Of The Oligomer Formed By The
Kinase-Ribonuclease Domain Of Ire1
pdb|3FBV|G Chain G, Crystal Structure Of The Oligomer Formed By The
Kinase-Ribonuclease Domain Of Ire1
pdb|3FBV|H Chain H, Crystal Structure Of The Oligomer Formed By The
Kinase-Ribonuclease Domain Of Ire1
pdb|3FBV|I Chain I, Crystal Structure Of The Oligomer Formed By The
Kinase-Ribonuclease Domain Of Ire1
pdb|3FBV|J Chain J, Crystal Structure Of The Oligomer Formed By The
Kinase-Ribonuclease Domain Of Ire1
pdb|3FBV|K Chain K, Crystal Structure Of The Oligomer Formed By The
Kinase-Ribonuclease Domain Of Ire1
pdb|3FBV|L Chain L, Crystal Structure Of The Oligomer Formed By The
Kinase-Ribonuclease Domain Of Ire1
pdb|3FBV|M Chain M, Crystal Structure Of The Oligomer Formed By The
Kinase-Ribonuclease Domain Of Ire1
pdb|3FBV|N Chain N, Crystal Structure Of The Oligomer Formed By The
Kinase-Ribonuclease Domain Of Ire1
pdb|3SDM|A Chain A, Structure Of Oligomeric KinaseRNASE IRE1 IN COMPLEX WITH
AN Oligonucleotide
pdb|3SDM|B Chain B, Structure Of Oligomeric KinaseRNASE IRE1 IN COMPLEX WITH
AN Oligonucleotide
pdb|3SDM|C Chain C, Structure Of Oligomeric KinaseRNASE IRE1 IN COMPLEX WITH
AN Oligonucleotide
pdb|3SDM|D Chain D, Structure Of Oligomeric KinaseRNASE IRE1 IN COMPLEX WITH
AN Oligonucleotide
pdb|3SDM|E Chain E, Structure Of Oligomeric KinaseRNASE IRE1 IN COMPLEX WITH
AN Oligonucleotide
pdb|3SDM|F Chain F, Structure Of Oligomeric KinaseRNASE IRE1 IN COMPLEX WITH
AN Oligonucleotide
pdb|3SDM|G Chain G, Structure Of Oligomeric KinaseRNASE IRE1 IN COMPLEX WITH
AN Oligonucleotide
Length = 448
Score = 29.6 bits (65), Expect = 0.57, Method: Composition-based stats.
Identities = 15/49 (30%), Positives = 28/49 (57%), Gaps = 4/49 (8%)
Query: 104 VAVLQLKDIVEQVKHQICVKDYCFARDDRLVGVAV----LQLKDIVEQK 148
+A++++K + E H ++ YC DR + +A+ L L+D+VE K
Sbjct: 72 IALMEIKLLTESDDHPNVIRYYCSETTDRFLYIALELCNLNLQDLVESK 120
>pdb|1F52|A Chain A, Crystal Structure Of Glutamine Synthetase From Salmonella
Typhimurium Co-Crystallized With Adp
pdb|1F52|B Chain B, Crystal Structure Of Glutamine Synthetase From Salmonella
Typhimurium Co-Crystallized With Adp
pdb|1F52|C Chain C, Crystal Structure Of Glutamine Synthetase From Salmonella
Typhimurium Co-Crystallized With Adp
pdb|1F52|D Chain D, Crystal Structure Of Glutamine Synthetase From Salmonella
Typhimurium Co-Crystallized With Adp
pdb|1F52|E Chain E, Crystal Structure Of Glutamine Synthetase From Salmonella
Typhimurium Co-Crystallized With Adp
pdb|1F52|F Chain F, Crystal Structure Of Glutamine Synthetase From Salmonella
Typhimurium Co-Crystallized With Adp
pdb|1F52|G Chain G, Crystal Structure Of Glutamine Synthetase From Salmonella
Typhimurium Co-Crystallized With Adp
pdb|1F52|H Chain H, Crystal Structure Of Glutamine Synthetase From Salmonella
Typhimurium Co-Crystallized With Adp
pdb|1F52|I Chain I, Crystal Structure Of Glutamine Synthetase From Salmonella
Typhimurium Co-Crystallized With Adp
pdb|1F52|J Chain J, Crystal Structure Of Glutamine Synthetase From Salmonella
Typhimurium Co-Crystallized With Adp
pdb|1F52|K Chain K, Crystal Structure Of Glutamine Synthetase From Salmonella
Typhimurium Co-Crystallized With Adp
pdb|1F52|L Chain L, Crystal Structure Of Glutamine Synthetase From Salmonella
Typhimurium Co-Crystallized With Adp
pdb|1F1H|A Chain A, Crystal Structure Of Glutamine Synthetase From Salmonella
Typhimurium With Thallium Ions
pdb|1F1H|B Chain B, Crystal Structure Of Glutamine Synthetase From Salmonella
Typhimurium With Thallium Ions
pdb|1F1H|C Chain C, Crystal Structure Of Glutamine Synthetase From Salmonella
Typhimurium With Thallium Ions
pdb|1F1H|D Chain D, Crystal Structure Of Glutamine Synthetase From Salmonella
Typhimurium With Thallium Ions
pdb|1F1H|E Chain E, Crystal Structure Of Glutamine Synthetase From Salmonella
Typhimurium With Thallium Ions
pdb|1F1H|F Chain F, Crystal Structure Of Glutamine Synthetase From Salmonella
Typhimurium With Thallium Ions
pdb|1F1H|G Chain G, Crystal Structure Of Glutamine Synthetase From Salmonella
Typhimurium With Thallium Ions
pdb|1F1H|H Chain H, Crystal Structure Of Glutamine Synthetase From Salmonella
Typhimurium With Thallium Ions
pdb|1F1H|I Chain I, Crystal Structure Of Glutamine Synthetase From Salmonella
Typhimurium With Thallium Ions
pdb|1F1H|J Chain J, Crystal Structure Of Glutamine Synthetase From Salmonella
Typhimurium With Thallium Ions
pdb|1F1H|K Chain K, Crystal Structure Of Glutamine Synthetase From Salmonella
Typhimurium With Thallium Ions
pdb|1F1H|L Chain L, Crystal Structure Of Glutamine Synthetase From Salmonella
Typhimurium With Thallium Ions
pdb|1FPY|A Chain A, Crystal Structure Of Glutamine Synthetase From Salmonella
Typhimurium With Inhibitor Phosphinothricin
pdb|1FPY|B Chain B, Crystal Structure Of Glutamine Synthetase From Salmonella
Typhimurium With Inhibitor Phosphinothricin
pdb|1FPY|C Chain C, Crystal Structure Of Glutamine Synthetase From Salmonella
Typhimurium With Inhibitor Phosphinothricin
pdb|1FPY|D Chain D, Crystal Structure Of Glutamine Synthetase From Salmonella
Typhimurium With Inhibitor Phosphinothricin
pdb|1FPY|E Chain E, Crystal Structure Of Glutamine Synthetase From Salmonella
Typhimurium With Inhibitor Phosphinothricin
pdb|1FPY|F Chain F, Crystal Structure Of Glutamine Synthetase From Salmonella
Typhimurium With Inhibitor Phosphinothricin
pdb|1FPY|G Chain G, Crystal Structure Of Glutamine Synthetase From Salmonella
Typhimurium With Inhibitor Phosphinothricin
pdb|1FPY|H Chain H, Crystal Structure Of Glutamine Synthetase From Salmonella
Typhimurium With Inhibitor Phosphinothricin
pdb|1FPY|I Chain I, Crystal Structure Of Glutamine Synthetase From Salmonella
Typhimurium With Inhibitor Phosphinothricin
pdb|1FPY|J Chain J, Crystal Structure Of Glutamine Synthetase From Salmonella
Typhimurium With Inhibitor Phosphinothricin
pdb|1FPY|K Chain K, Crystal Structure Of Glutamine Synthetase From Salmonella
Typhimurium With Inhibitor Phosphinothricin
pdb|1FPY|L Chain L, Crystal Structure Of Glutamine Synthetase From Salmonella
Typhimurium With Inhibitor Phosphinothricin
pdb|1LGR|A Chain A, Interactions Of Nucleotides With Fully Unadenylylated
Glutamine Synthetase From Salmonella Typhimurium
pdb|1LGR|B Chain B, Interactions Of Nucleotides With Fully Unadenylylated
Glutamine Synthetase From Salmonella Typhimurium
pdb|1LGR|C Chain C, Interactions Of Nucleotides With Fully Unadenylylated
Glutamine Synthetase From Salmonella Typhimurium
pdb|1LGR|D Chain D, Interactions Of Nucleotides With Fully Unadenylylated
Glutamine Synthetase From Salmonella Typhimurium
pdb|1LGR|E Chain E, Interactions Of Nucleotides With Fully Unadenylylated
Glutamine Synthetase From Salmonella Typhimurium
pdb|1LGR|F Chain F, Interactions Of Nucleotides With Fully Unadenylylated
Glutamine Synthetase From Salmonella Typhimurium
pdb|1LGR|G Chain G, Interactions Of Nucleotides With Fully Unadenylylated
Glutamine Synthetase From Salmonella Typhimurium
pdb|1LGR|H Chain H, Interactions Of Nucleotides With Fully Unadenylylated
Glutamine Synthetase From Salmonella Typhimurium
pdb|1LGR|I Chain I, Interactions Of Nucleotides With Fully Unadenylylated
Glutamine Synthetase From Salmonella Typhimurium
pdb|1LGR|J Chain J, Interactions Of Nucleotides With Fully Unadenylylated
Glutamine Synthetase From Salmonella Typhimurium
pdb|1LGR|K Chain K, Interactions Of Nucleotides With Fully Unadenylylated
Glutamine Synthetase From Salmonella Typhimurium
pdb|1LGR|L Chain L, Interactions Of Nucleotides With Fully Unadenylylated
Glutamine Synthetase From Salmonella Typhimurium
pdb|2LGS|A Chain A, Feedback Inhibition Of Fully Unadenylylated Glutamine
Synthetase From Salmonella Typhimurium By Glycine,
Alanine, And Serine
pdb|2LGS|B Chain B, Feedback Inhibition Of Fully Unadenylylated Glutamine
Synthetase From Salmonella Typhimurium By Glycine,
Alanine, And Serine
pdb|2LGS|C Chain C, Feedback Inhibition Of Fully Unadenylylated Glutamine
Synthetase From Salmonella Typhimurium By Glycine,
Alanine, And Serine
pdb|2LGS|D Chain D, Feedback Inhibition Of Fully Unadenylylated Glutamine
Synthetase From Salmonella Typhimurium By Glycine,
Alanine, And Serine
pdb|2LGS|E Chain E, Feedback Inhibition Of Fully Unadenylylated Glutamine
Synthetase From Salmonella Typhimurium By Glycine,
Alanine, And Serine
pdb|2LGS|F Chain F, Feedback Inhibition Of Fully Unadenylylated Glutamine
Synthetase From Salmonella Typhimurium By Glycine,
Alanine, And Serine
pdb|2LGS|G Chain G, Feedback Inhibition Of Fully Unadenylylated Glutamine
Synthetase From Salmonella Typhimurium By Glycine,
Alanine, And Serine
pdb|2LGS|H Chain H, Feedback Inhibition Of Fully Unadenylylated Glutamine
Synthetase From Salmonella Typhimurium By Glycine,
Alanine, And Serine
pdb|2LGS|I Chain I, Feedback Inhibition Of Fully Unadenylylated Glutamine
Synthetase From Salmonella Typhimurium By Glycine,
Alanine, And Serine
pdb|2LGS|J Chain J, Feedback Inhibition Of Fully Unadenylylated Glutamine
Synthetase From Salmonella Typhimurium By Glycine,
Alanine, And Serine
pdb|2LGS|K Chain K, Feedback Inhibition Of Fully Unadenylylated Glutamine
Synthetase From Salmonella Typhimurium By Glycine,
Alanine, And Serine
pdb|2LGS|L Chain L, Feedback Inhibition Of Fully Unadenylylated Glutamine
Synthetase From Salmonella Typhimurium By Glycine,
Alanine, And Serine
Length = 468
Score = 26.9 bits (58), Expect = 4.6, Method: Composition-based stats.
Identities = 18/44 (40%), Positives = 22/44 (50%), Gaps = 3/44 (6%)
Query: 2 EKSLSPKQC--ALLDASLDSIKNYFHAAGNGLKKTYLDKSPELA 43
+ + +P C ALL A LD IKN H G + K D PE A
Sbjct: 362 DPAANPYLCFAALLMAGLDGIKNKIH-PGEPMDKNLYDLPPEEA 404
>pdb|2GLS|A Chain A, Refined Atomic Model Of Glutamine Synthetase At 3.5
Angstroms Resolution
pdb|2GLS|B Chain B, Refined Atomic Model Of Glutamine Synthetase At 3.5
Angstroms Resolution
pdb|2GLS|C Chain C, Refined Atomic Model Of Glutamine Synthetase At 3.5
Angstroms Resolution
pdb|2GLS|D Chain D, Refined Atomic Model Of Glutamine Synthetase At 3.5
Angstroms Resolution
pdb|2GLS|E Chain E, Refined Atomic Model Of Glutamine Synthetase At 3.5
Angstroms Resolution
pdb|2GLS|F Chain F, Refined Atomic Model Of Glutamine Synthetase At 3.5
Angstroms Resolution
pdb|2GLS|G Chain G, Refined Atomic Model Of Glutamine Synthetase At 3.5
Angstroms Resolution
pdb|2GLS|H Chain H, Refined Atomic Model Of Glutamine Synthetase At 3.5
Angstroms Resolution
pdb|2GLS|I Chain I, Refined Atomic Model Of Glutamine Synthetase At 3.5
Angstroms Resolution
pdb|2GLS|J Chain J, Refined Atomic Model Of Glutamine Synthetase At 3.5
Angstroms Resolution
pdb|2GLS|K Chain K, Refined Atomic Model Of Glutamine Synthetase At 3.5
Angstroms Resolution
pdb|2GLS|L Chain L, Refined Atomic Model Of Glutamine Synthetase At 3.5
Angstroms Resolution
Length = 469
Score = 26.9 bits (58), Expect = 4.6, Method: Composition-based stats.
Identities = 18/44 (40%), Positives = 22/44 (50%), Gaps = 3/44 (6%)
Query: 2 EKSLSPKQC--ALLDASLDSIKNYFHAAGNGLKKTYLDKSPELA 43
+ + +P C ALL A LD IKN H G + K D PE A
Sbjct: 363 DPAANPYLCFAALLMAGLDGIKNKIH-PGEPMDKNLYDLPPEEA 405
>pdb|2WSM|A Chain A, Crystal Structure Of Hydrogenase Maturation Factor Hypb
From Archaeoglobus Fulgidus
pdb|2WSM|B Chain B, Crystal Structure Of Hydrogenase Maturation Factor Hypb
From Archaeoglobus Fulgidus
Length = 221
Score = 25.8 bits (55), Expect = 9.1, Method: Compositional matrix adjust.
Identities = 12/36 (33%), Positives = 22/36 (61%)
Query: 112 IVEQVKHQICVKDYCFARDDRLVGVAVLQLKDIVEQ 147
++E V + IC D+ + R+V V+V + D+VE+
Sbjct: 113 LIENVGNLICPVDFDLGENYRVVMVSVTEGDDVVEK 148
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.322 0.137 0.395
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 4,130,811
Number of Sequences: 62578
Number of extensions: 155847
Number of successful extensions: 267
Number of sequences better than 100.0: 14
Number of HSP's better than 100.0 without gapping: 3
Number of HSP's successfully gapped in prelim test: 11
Number of HSP's that attempted gapping in prelim test: 263
Number of HSP's gapped (non-prelim): 15
length of query: 148
length of database: 14,973,337
effective HSP length: 90
effective length of query: 58
effective length of database: 9,341,317
effective search space: 541796386
effective search space used: 541796386
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 47 (22.7 bits)