Query         psy12064
Match_columns 148
No_of_seqs    92 out of 94
Neff          3.0 
Searched_HMMs 46136
Date          Fri Aug 16 17:45:35 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy12064.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/12064hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG1011|consensus              100.0 9.5E-64 2.1E-68  465.2   8.4  135    1-141  1030-1251(1283)
  2 PF10540 Membr_traf_MHD:  Munc1  99.9 8.4E-26 1.8E-30  171.4   3.1   62    2-63     76-137 (137)
  3 KOG1011|consensus               99.1 2.1E-11 4.6E-16  116.0   3.1   36  113-148  1192-1227(1283)
  4 cd08395 C2C_Munc13 C2 domain t  97.7 7.5E-05 1.6E-09   55.6   4.9   48   74-121    60-107 (120)
  5 KOG1328|consensus               94.9    0.03 6.6E-07   55.2   4.2   53   13-66    869-921 (1103)
  6 cd04010 C2B_RasA3 C2 domain se  94.7   0.051 1.1E-06   41.7   4.2   44   79-122    74-118 (148)
  7 cd04044 C2A_Tricalbin-like C2   94.0    0.11 2.4E-06   36.2   4.5   60   81-142    62-121 (124)
  8 cd08389 C2A_Synaptotagmin-14_1  94.0   0.066 1.4E-06   39.0   3.3   45   78-122    76-120 (124)
  9 cd04030 C2C_KIAA1228 C2 domain  93.9   0.063 1.4E-06   38.0   3.0   40   83-122    83-124 (127)
 10 cd08675 C2B_RasGAP C2 domain s  92.6     0.2 4.4E-06   37.3   4.2   44   79-122    73-116 (137)
 11 cd08390 C2A_Synaptotagmin-15-1  92.0    0.29 6.3E-06   34.4   4.1   39   84-122    81-119 (123)
 12 cd08395 C2C_Munc13 C2 domain t  91.6    0.24 5.2E-06   36.9   3.5   35  113-147    67-101 (120)
 13 cd08387 C2A_Synaptotagmin-8 C2  89.9    0.41 8.9E-06   34.0   3.3   43   81-123    79-121 (124)
 14 cd04049 C2_putative_Elicitor-r  88.7    0.91   2E-05   32.2   4.4   49   83-131    65-117 (124)
 15 cd04042 C2A_MCTP_PRT C2 domain  88.6    0.74 1.6E-05   32.6   3.8   55   84-141    61-117 (121)
 16 cd04025 C2B_RasA1_RasA4 C2 dom  88.4    0.63 1.4E-05   33.0   3.3   39   83-121    60-98  (123)
 17 cd04009 C2B_Munc13-like C2 dom  88.0    0.61 1.3E-05   34.0   3.2   33   82-114    86-118 (133)
 18 cd08386 C2A_Synaptotagmin-7 C2  88.0    0.67 1.5E-05   32.7   3.3   42   81-122    80-121 (125)
 19 cd08521 C2A_SLP C2 domain firs  87.6    0.67 1.4E-05   32.5   3.1   41   82-122    81-121 (123)
 20 cd08388 C2A_Synaptotagmin-4-11  87.5    0.78 1.7E-05   33.6   3.5   42   80-121    80-123 (128)
 21 cd04051 C2_SRC2_like C2 domain  85.7       1 2.3E-05   31.8   3.3   35   83-117    66-100 (125)
 22 cd08681 C2_fungal_Inn1p-like C  85.3     3.2 6.9E-05   29.0   5.5   56   82-141    61-116 (118)
 23 cd08682 C2_Rab11-FIP_classI C2  85.2     1.8   4E-05   30.9   4.4   34   80-113    61-94  (126)
 24 cd08373 C2A_Ferlin C2 domain f  84.5     1.9 4.2E-05   30.7   4.2   40   82-121    55-94  (127)
 25 cd04031 C2A_RIM1alpha C2 domai  84.3     1.5 3.2E-05   30.8   3.5   36   81-116    82-117 (125)
 26 cd08690 C2_Freud-1 C2 domain f  84.2     1.4 3.1E-05   34.6   3.6   50   85-137    79-129 (155)
 27 cd04026 C2_PKC_alpha_gamma C2   84.2     1.3 2.8E-05   31.7   3.2   32   84-115    80-111 (131)
 28 cd08391 C2A_C2C_Synaptotagmin_  84.0     1.9 4.1E-05   29.9   3.9   37   82-119    66-102 (121)
 29 cd08685 C2_RGS-like C2 domain   83.7     1.5 3.2E-05   31.9   3.4   38   85-122    79-117 (119)
 30 cd04047 C2B_Copine C2 domain s  83.7     2.2 4.7E-05   29.6   4.1   34   84-117    70-103 (110)
 31 cd08381 C2B_PI3K_class_II C2 d  83.0     1.5 3.3E-05   31.8   3.2   44   78-121    75-118 (122)
 32 cd04028 C2B_RIM1alpha C2 domai  82.9     2.4 5.2E-05   32.8   4.4   42   81-122    92-134 (146)
 33 cd08680 C2_Kibra C2 domain fou  82.5     1.3 2.7E-05   33.0   2.6   37   79-115    78-114 (124)
 34 cd04038 C2_ArfGAP C2 domain pr  81.6     4.1 8.8E-05   31.1   5.2   62   83-144    60-142 (145)
 35 cd08691 C2_NEDL1-like C2 domai  81.0     2.7 5.9E-05   31.9   4.0   44   85-130    74-120 (137)
 36 cd00275 C2_PLC_like C2 domain   81.0     4.1 8.8E-05   28.5   4.7   43   80-124    68-110 (128)
 37 cd04015 C2_plant_PLD C2 domain  79.6     2.9 6.3E-05   32.0   3.8   34   85-119    99-132 (158)
 38 cd08401 C2A_RasA2_RasA3 C2 dom  79.3     8.9 0.00019   27.7   6.1   39   83-121    61-99  (121)
 39 cd04021 C2_E3_ubiquitin_ligase  78.1     9.1  0.0002   27.7   5.9   47   85-131    62-110 (125)
 40 cd04039 C2_PSD C2 domain prese  77.2     3.1 6.8E-05   29.8   3.2   34   82-115    65-98  (108)
 41 cd04014 C2_PKC_epsilon C2 doma  76.1     4.6 9.9E-05   29.1   3.8   47   84-133    74-122 (132)
 42 cd04044 C2A_Tricalbin-like C2   74.9     4.2 9.2E-05   28.2   3.3   33  115-147    64-96  (124)
 43 cd08678 C2_C21orf25-like C2 do  73.7      16 0.00034   26.2   6.1   58   80-142    55-118 (126)
 44 cd08376 C2B_MCTP_PRT C2 domain  73.4     7.9 0.00017   26.9   4.4   40   83-122    60-99  (116)
 45 cd08393 C2A_SLP-1_2 C2 domain   73.1     4.4 9.5E-05   29.4   3.1   41   81-121    81-121 (125)
 46 cd04016 C2_Tollip C2 domain pr  72.9      12 0.00026   27.8   5.5   36   82-117    60-95  (121)
 47 cd04036 C2_cPLA2 C2 domain pre  72.4     6.1 0.00013   27.8   3.7   33   84-117    64-96  (119)
 48 cd04029 C2A_SLP-4_5 C2 domain   71.6     6.5 0.00014   28.6   3.8   40   82-121    82-121 (125)
 49 cd08688 C2_KIAA0528-like C2 do  71.1     5.8 0.00013   27.9   3.3   33   84-116    64-96  (110)
 50 cd08385 C2A_Synaptotagmin-1-5-  70.5     8.6 0.00019   27.1   4.1   40   82-121    80-119 (124)
 51 cd04054 C2A_Rasal1_RasA4 C2 do  69.7      15 0.00032   26.3   5.2   58   84-141    61-119 (121)
 52 cd04041 C2A_fungal C2 domain f  69.5       5 0.00011   28.2   2.7   34   83-116    68-101 (111)
 53 cd04033 C2_NEDD4_NEDD4L C2 dom  69.5     6.3 0.00014   28.0   3.2   46   83-128    66-114 (133)
 54 cd04011 C2B_Ferlin C2 domain s  69.2     8.3 0.00018   26.9   3.7   32   84-115    65-96  (111)
 55 cd00276 C2B_Synaptotagmin C2 d  68.9     6.1 0.00013   27.8   3.0   29   83-111    81-109 (134)
 56 cd04009 C2B_Munc13-like C2 dom  68.5       6 0.00013   28.8   3.0   32  115-146    87-118 (133)
 57 cd08392 C2A_SLP-3 C2 domain fi  68.5     4.7  0.0001   29.8   2.5   33   80-112    80-112 (128)
 58 cd04035 C2A_Rabphilin_Doc2 C2   67.2     9.8 0.00021   26.9   3.8   36   83-119    83-118 (123)
 59 cd08382 C2_Smurf-like C2 domai  67.2      22 0.00048   25.4   5.7   33   84-116    60-94  (123)
 60 cd04040 C2D_Tricalbin-like C2   67.0      10 0.00023   26.1   3.8   40   83-122    60-99  (115)
 61 cd08400 C2_Ras_p21A1 C2 domain  66.6      11 0.00024   27.3   4.0   35   85-119    63-97  (126)
 62 cd04030 C2C_KIAA1228 C2 domain  66.4     7.8 0.00017   27.3   3.2   32  115-146    83-116 (127)
 63 cd04037 C2E_Ferlin C2 domain f  66.1     9.4  0.0002   27.6   3.6   34   80-113    59-92  (124)
 64 cd04047 C2B_Copine C2 domain s  65.6      12 0.00026   25.8   3.9   32  115-146    69-100 (110)
 65 cd04051 C2_SRC2_like C2 domain  64.6     9.6 0.00021   26.9   3.3   33  115-147    66-98  (125)
 66 cd04024 C2A_Synaptotagmin-like  63.8      11 0.00023   26.4   3.4   30   85-114    65-94  (128)
 67 cd04049 C2_putative_Elicitor-r  63.7      12 0.00026   26.5   3.7   32  116-147    66-97  (124)
 68 cd04050 C2B_Synaptotagmin-like  62.2      14 0.00031   25.5   3.8   35   79-116    56-90  (105)
 69 cd08686 C2_ABR C2 domain in th  61.9      11 0.00025   28.6   3.5   30   82-111    56-92  (118)
 70 cd04052 C2B_Tricalbin-like C2   61.8     9.7 0.00021   26.8   2.9   36   79-115    49-84  (111)
 71 cd04048 C2A_Copine C2 domain f  60.5      17 0.00036   25.7   3.9   31   85-115    69-103 (120)
 72 cd08403 C2B_Synaptotagmin-3-5-  60.4     7.5 0.00016   28.0   2.2   29   82-110    80-108 (134)
 73 cd08389 C2A_Synaptotagmin-14_1  59.7      12 0.00027   27.0   3.3   32  113-144    79-110 (124)
 74 PF10929 DUF2811:  Protein of u  59.5     4.9 0.00011   27.9   1.0   20   33-52     15-37  (57)
 75 cd08390 C2A_Synaptotagmin-15-1  59.4      13 0.00028   26.0   3.2   32  115-146    80-111 (123)
 76 cd04020 C2B_SLP_1-2-3-4 C2 dom  59.0      12 0.00026   28.8   3.2   38   83-120    95-132 (162)
 77 cd08690 C2_Freud-1 C2 domain f  57.8      12 0.00026   29.4   3.1   37  109-145    71-108 (155)
 78 cd04022 C2A_MCTP_PRT_plant C2   57.7      16 0.00035   26.1   3.5   33   84-116    64-97  (127)
 79 cd04031 C2A_RIM1alpha C2 domai  57.4      16 0.00034   25.6   3.3   31  114-144    83-113 (125)
 80 cd08375 C2_Intersectin C2 doma  56.7      23  0.0005   26.3   4.3   32   83-114    75-106 (136)
 81 cd08377 C2C_MCTP_PRT C2 domain  56.0      41 0.00089   23.2   5.3   32   84-115    61-92  (119)
 82 PF01726 LexA_DNA_bind:  LexA D  55.8      11 0.00023   25.8   2.2   37    3-52      2-38  (65)
 83 cd04039 C2_PSD C2 domain prese  55.3      22 0.00049   25.4   3.9   32  116-147    67-98  (108)
 84 cd04025 C2B_RasA1_RasA4 C2 dom  55.2      17 0.00037   25.6   3.3   31  116-146    61-91  (123)
 85 cd04018 C2C_Ferlin C2 domain t  54.3      17 0.00038   28.0   3.4   34   83-116    75-108 (151)
 86 cd08409 C2B_Synaptotagmin-15 C  54.2      11 0.00025   27.8   2.3   32   79-110    77-108 (137)
 87 cd04032 C2_Perforin C2 domain   53.9      22 0.00047   26.7   3.8   39   81-119    86-124 (127)
 88 cd08394 C2A_Munc13 C2 domain f  53.7      14 0.00031   28.4   2.9   33   84-117    58-90  (127)
 89 cd08408 C2B_Synaptotagmin-14_1  51.3      14 0.00029   27.7   2.3   35   78-112    78-112 (138)
 90 cd08379 C2D_MCTP_PRT_plant C2   51.1      36 0.00078   25.5   4.6   35   85-119    64-104 (126)
 91 cd04045 C2C_Tricalbin-like C2   51.1      22 0.00047   25.7   3.3   31   85-115    63-93  (120)
 92 cd06560 PriL Archaeal/eukaryot  50.4      48   0.001   25.1   5.3   60   11-70     10-70  (166)
 93 cd08402 C2B_Synaptotagmin-1 C2  50.0      19 0.00041   26.0   2.9   29   83-111    82-110 (136)
 94 cd08386 C2A_Synaptotagmin-7 C2  50.0      23 0.00049   24.9   3.2   32  114-145    81-112 (125)
 95 cd04010 C2B_RasA3 C2 domain se  49.6      20 0.00043   27.5   3.1   31  116-146    79-109 (148)
 96 cd08680 C2_Kibra C2 domain fou  49.6      21 0.00046   26.4   3.2   32  113-144    80-111 (124)
 97 smart00239 C2 Protein kinase C  49.5      24 0.00053   22.0   3.0   34   83-116    63-96  (101)
 98 cd04042 C2A_MCTP_PRT C2 domain  49.1      22 0.00048   25.1   3.0   31  116-146    61-91  (121)
 99 cd04026 C2_PKC_alpha_gamma C2   48.5      32  0.0007   24.5   3.8   31  116-146    80-110 (131)
100 cd04011 C2B_Ferlin C2 domain s  48.3      20 0.00044   24.9   2.7   32  115-146    64-95  (111)
101 cd08373 C2A_Ferlin C2 domain f  46.8      31 0.00067   24.5   3.5   34  114-147    55-88  (127)
102 cd08691 C2_NEDL1-like C2 domai  46.5      25 0.00055   26.6   3.2   31  117-147    74-107 (137)
103 cd08681 C2_fungal_Inn1p-like C  46.3      30 0.00066   24.0   3.4   30  116-146    63-92  (118)
104 cd08391 C2A_C2C_Synaptotagmin_  45.5      29 0.00064   23.8   3.2   31  116-147    68-98  (121)
105 cd08675 C2B_RasGAP C2 domain s  45.2      31 0.00067   25.6   3.4   33  114-146    76-108 (137)
106 cd04041 C2A_fungal C2 domain f  44.4      31 0.00066   24.2   3.2   33  115-147    68-100 (111)
107 PF07495 Y_Y_Y:  Y_Y_Y domain;   43.6      14 0.00031   23.3   1.3   20   74-93     31-50  (66)
108 cd04033 C2_NEDD4_NEDD4L C2 dom  43.3      31 0.00066   24.5   3.0   30  117-146    68-97  (133)
109 PF08053 Tna_leader:  Tryptopha  43.3      23 0.00051   20.8   2.0   18   85-102     3-20  (24)
110 cd04014 C2_PKC_epsilon C2 doma  42.8      37  0.0008   24.4   3.4   33  114-146    72-104 (132)
111 PRK01305 arginyl-tRNA-protein   42.6      75  0.0016   26.9   5.7   62   52-128   104-175 (240)
112 cd08384 C2B_Rabphilin_Doc2 C2   42.4      22 0.00048   25.4   2.2   30   82-111    79-108 (133)
113 cd08688 C2_KIAA0528-like C2 do  41.5      36 0.00079   23.8   3.2   31  116-146    64-94  (110)
114 PRK09806 tryptophanase leader   41.4      28  0.0006   20.8   2.1   18   85-102     3-20  (26)
115 PLN03008 Phospholipase D delta  41.2      50  0.0011   33.2   5.0   32   85-117   118-149 (868)
116 PLN03008 Phospholipase D delta  40.4      36 0.00079   34.2   4.0   50   74-145    95-145 (868)
117 cd08521 C2A_SLP C2 domain firs  40.3      41 0.00089   23.4   3.3   30  115-144    82-111 (123)
118 cd04021 C2_E3_ubiquitin_ligase  40.1      43 0.00092   24.2   3.4   32  116-147    61-92  (125)
119 PF00168 C2:  C2 domain;  Inter  39.5      30 0.00065   21.5   2.3   20   86-105    65-84  (85)
120 cd04019 C2C_MCTP_PRT_plant C2   39.5      35 0.00077   25.9   3.1   30   85-114    63-92  (150)
121 cd08682 C2_Rab11-FIP_classI C2  38.1      64  0.0014   22.9   4.1   32  114-145    63-94  (126)
122 cd08677 C2A_Synaptotagmin-13 C  38.1      30 0.00064   26.3   2.4   40   79-119    73-113 (118)
123 PF06041 DUF924:  Bacterial pro  37.8      23  0.0005   28.5   1.9   73   11-83     84-179 (188)
124 cd04027 C2B_Munc13 C2 domain s  36.5 1.2E+02  0.0026   21.7   5.3   31   85-115    62-103 (127)
125 cd08382 C2_Smurf-like C2 domai  36.1      50  0.0011   23.6   3.2   32  116-147    60-93  (123)
126 cd08378 C2B_MCTP_PRT_plant C2   35.9      46   0.001   24.0   3.0   38   78-116    51-88  (121)
127 cd04043 C2_Munc13_fungal C2 do  35.8      51  0.0011   23.1   3.2   31   83-113    64-94  (126)
128 cd00275 C2_PLC_like C2 domain   35.6      49  0.0011   23.0   3.0   28  117-145    73-100 (128)
129 cd00276 C2B_Synaptotagmin C2 d  35.4      48   0.001   23.2   3.0   30  114-143    80-109 (134)
130 cd04015 C2_plant_PLD C2 domain  35.0      51  0.0011   25.1   3.3   29  117-146    99-127 (158)
131 PF04377 ATE_C:  Arginine-tRNA-  34.1 1.1E+02  0.0024   23.5   5.0   42   59-108     6-57  (128)
132 cd08405 C2B_Synaptotagmin-7 C2  33.1      38 0.00083   24.4   2.2   31   82-112    81-111 (136)
133 cd01249 PH_oligophrenin Oligop  32.5      51  0.0011   25.0   2.9   24  119-142    15-39  (104)
134 KOG1936|consensus               31.7      47   0.001   31.6   3.1   27    2-28     66-92  (518)
135 cd08387 C2A_Synaptotagmin-8 C2  31.1      73  0.0016   22.4   3.4   32  115-146    81-112 (124)
136 cd04028 C2B_RIM1alpha C2 domai  30.6      83  0.0018   24.3   3.8   32  113-144    92-124 (146)
137 TIGR00498 lexA SOS regulatory   29.9      47   0.001   25.7   2.4   19    3-21      2-20  (199)
138 cd00236 FinO_conjug_rep FinO b  28.9      62  0.0014   25.8   3.0   49   13-61     36-100 (146)
139 cd00030 C2 C2 domain. The C2 d  28.9      97  0.0021   18.8   3.3   31   83-113    60-90  (102)
140 cd08392 C2A_SLP-3 C2 domain fi  28.6      78  0.0017   23.3   3.3   31  114-144    82-112 (128)
141 cd08375 C2_Intersectin C2 doma  28.5      74  0.0016   23.6   3.2   31  116-146    76-106 (136)
142 cd08404 C2B_Synaptotagmin-4 C2  28.0      61  0.0013   23.4   2.6   29   83-111    82-110 (136)
143 cd08381 C2B_PI3K_class_II C2 d  28.0      85  0.0018   22.7   3.3   33  113-145    78-110 (122)
144 cd08403 C2B_Synaptotagmin-3-5-  27.2      78  0.0017   22.7   3.0   28  115-142    81-108 (134)
145 cd08400 C2_Ras_p21A1 C2 domain  26.8 1.2E+02  0.0027   21.8   4.0   31  116-146    62-92  (126)
146 PF12194 Ste5_C:  Protein kinas  26.7      27 0.00059   29.4   0.6   30  102-133   108-138 (191)
147 cd04018 C2C_Ferlin C2 domain t  26.1      85  0.0018   24.2   3.2   31  117-147    77-107 (151)
148 cd04037 C2E_Ferlin C2 domain f  25.9      99  0.0022   22.2   3.4   30  116-145    63-92  (124)
149 cd04035 C2A_Rabphilin_Doc2 C2   25.2      90   0.002   21.9   3.0   30  117-147    85-114 (123)
150 cd08393 C2A_SLP-1_2 C2 domain   25.1   1E+02  0.0022   22.2   3.3   31  114-144    82-112 (125)
151 cd08401 C2A_RasA2_RasA3 C2 dom  24.2 1.1E+02  0.0025   21.9   3.4   31  116-146    62-92  (121)
152 cd08686 C2_ABR C2 domain in th  23.7 1.1E+02  0.0025   23.2   3.4   30  114-143    56-92  (118)
153 cd08407 C2B_Synaptotagmin-13 C  23.7      59  0.0013   24.7   1.9   33   79-111    80-112 (138)
154 cd08388 C2A_Synaptotagmin-4-11  22.7 1.2E+02  0.0026   22.1   3.3   29  116-144    84-112 (128)
155 cd04045 C2C_Tricalbin-like C2   22.6 1.1E+02  0.0025   21.9   3.1   31  117-147    63-93  (120)
156 PF15418 DUF4625:  Domain of un  22.6      78  0.0017   24.4   2.4   19   74-92     99-117 (132)
157 COG3651 Uncharacterized protei  22.1      82  0.0018   24.9   2.4   16   58-73     48-63  (125)
158 cd04016 C2_Tollip C2 domain pr  22.0 1.8E+02  0.0039   21.5   4.2   28  116-143    62-89  (121)
159 cd08676 C2A_Munc13-like C2 dom  21.9 1.1E+02  0.0024   23.7   3.1   30   83-116   117-146 (153)
160 PF13170 DUF4003:  Protein of u  21.8 1.7E+02  0.0036   25.2   4.5   51   13-67    155-205 (297)
161 cd05023 S-100A11 S-100A11: S-1  21.4      83  0.0018   22.2   2.2   50   13-66      4-60  (89)
162 KOG0997|consensus               21.0      67  0.0015   30.7   2.0   55   16-70    146-225 (523)
163 cd04020 C2B_SLP_1-2-3-4 C2 dom  20.8 1.3E+02  0.0027   23.1   3.2   31  116-146    96-126 (162)
164 cd04029 C2A_SLP-4_5 C2 domain   20.5 1.4E+02  0.0031   21.6   3.3   32  114-145    82-113 (125)

No 1  
>KOG1011|consensus
Probab=100.00  E-value=9.5e-64  Score=465.19  Aligned_cols=135  Identities=61%  Similarity=1.025  Sum_probs=129.6

Q ss_pred             CCCCCCchhhHHHHHHHHHHHHhhhhcCCCccccccccCcchhhHHHHHhhhhhhhHHHHHHHHHhhcccC---------
Q psy12064          1 MEKSLSPKQCALLDASLDSIKNYFHAAGNGLKKTYLDKSPELASLRYALSLYTQTTDALIKTFVQSQCNEG---------   71 (148)
Q Consensus         1 ~~k~LtpkQCavld~aldtiK~yFhagg~GlKk~fLeks~~l~slryalsLytqtTd~LIk~fv~tQ~~qg---------   71 (148)
                      ++||||||||||||+|||||||||||||+||||+|||||||||||||||||||||||.|||+||++|..||         
T Consensus      1030 e~ksltpkqcavld~aldtikq~fhagg~glkktflekspdlqslryalslytqttd~liktfv~sq~~q~~gvedpvge 1109 (1283)
T KOG1011|consen 1030 EEKSLTPKQCAVLDLALDTIKQYFHAGGKGLKKTFLEKSPDLQSLRYALSLYTQTTDQLIKTFVTSQRQQGPGVEDPVGE 1109 (1283)
T ss_pred             HhccCCccceehhhhhHHHHHHHHhccCcchhhhHhhcCccHHHHHHHHHHHHhHHHHHHHHHHHhhhccCCCCCCCCce
Confidence            57999999999999999999999999999999999999999999999999999999999999999999984         


Q ss_pred             -------------------------Cc------------------------------------------------ccCCC
Q psy12064         72 -------------------------RD------------------------------------------------LIGNE   78 (148)
Q Consensus        72 -------------------------nd------------------------------------------------~lgne   78 (148)
                                               ||                                                +||||
T Consensus      1110 vsvqvdlfthpgtgehkvtvkvvaandlkwqtsgmFrPFVEV~ivGP~lsDKKRK~~TKtKsnnWaPKyNEtF~f~Lg~e 1189 (1283)
T KOG1011|consen 1110 VSVQVDLFTHPGTGEHKVTVKVVAANDLKWQTSGMFRPFVEVHIVGPHLSDKKRKFSTKTKSNNWAPKYNETFHFFLGNE 1189 (1283)
T ss_pred             EEEEEEeecCCCCCcceEEEEEEecccccchhccccccceEEEEecCcccchhhhccccccCCCcCcccCceeEEEeccC
Confidence                                     33                                                99999


Q ss_pred             CCCCceEEEeeeeceeeccCCeeeeeeeeeccchhccceeeeEEeceeeecCCce-----eEEEEEee
Q psy12064         79 EQLEFFELHICVKDYCFARDDRLVGVAVLQLKDIVEQVKHQICVKDYCFARDDRL-----VGVAVLQL  141 (148)
Q Consensus        79 ~~p~~yEL~~~VKDYCFar~Dr~vG~av~qL~~iAeKGScalcVKDyCf~r~dr~-----vG~~vlql  141 (148)
                      ++|++||||+||||||||||||+||||||||++++++|||+      ||.+.+|.     +|++++++
T Consensus      1190 ~~Pe~YEL~~~VKDYCFAReDRvvGl~VlqL~~va~kGS~a------~W~pLgrrihmDeTGLtiLRI 1251 (1283)
T KOG1011|consen 1190 GGPEHYELQFCVKDYCFAREDRVVGLAVLQLRSVADKGSCA------CWVPLGRRIHMDETGLTILRI 1251 (1283)
T ss_pred             CCCceEEEEEeehhheeecccceeeeeeeehhhHhhcCcee------EeeeccccccccccchhHHHH
Confidence            99999999999999999999999999999999999999999      99999988     78888775


No 2  
>PF10540 Membr_traf_MHD:  Munc13 (mammalian uncoordinated) homology domain;  InterPro: IPR019558  Mammalian uncoordinated homology 13 (Munc13) proteins constitute a family of three highly homologous molecules (Munc13-1, Munc13-2 and Munc13-3) with homology to Caenorhabditis elegans unc-13p. Munc13 proteins contain a phorbol ester-binding C1 domain and two C2 domains, which are Ca2+/phospholipid binding domains. Sequence analyses have uncovered two regions called Munc13 homology domains 1 (MHD1) and 2 (MHD2) that are arranged between two flanking C2 domains. MHD1 and MHD2 domains are present in a wide variety of proteins from Arabidopsis thaliana (Mouse-ear cress), C. elegans, Drosophila melanogaster (Fruit fly), Mus musculus (Mouse), Rattus norvegicus (Rat) and Homo sapiens (Human), some of which may function in a Munc13-like manner to regulate membrane trafficking. The MHD1 and MHD2 domains are predicted to be alpha-helical. ; PDB: 3SWH_A.
Probab=99.91  E-value=8.4e-26  Score=171.39  Aligned_cols=62  Identities=56%  Similarity=0.952  Sum_probs=42.0

Q ss_pred             CCCCCchhhHHHHHHHHHHHHhhhhcCCCccccccccCcchhhHHHHHhhhhhhhHHHHHHH
Q psy12064          2 EKSLSPKQCALLDASLDSIKNYFHAAGNGLKKTYLDKSPELASLRYALSLYTQTTDALIKTF   63 (148)
Q Consensus         2 ~k~LtpkQCavld~aldtiK~yFhagg~GlKk~fLeks~~l~slryalsLytqtTd~LIk~f   63 (148)
                      .|+|||+||++|+.+|++|++||||||+||++++|||||++|+|+|+++||+|+||+||++|
T Consensus        76 ~~~Lt~~q~~~l~~~L~~L~~FFhA~G~Gl~~~~L~ks~~yq~L~~~l~ly~~sT~~LI~~f  137 (137)
T PF10540_consen   76 QRPLTPKQCDRLFKWLDTLKDFFHAEGNGLPLEFLEKSPEYQSLRYILSLYDQSTDELIEEF  137 (137)
T ss_dssp             ------TCHHHHHHHHHHHHHHHHCCCTS--HHHHHC-HHHHHHHHHHHHT-----------
T ss_pred             CCCCCHHHHHHHHHHHHHHHHHHhCCCCCCCHHHHccCHHHHHHHHHHHHhcCCHHHHHhhC
Confidence            58999999999999999999999999999999999999999999999999999999999998


No 3  
>KOG1011|consensus
Probab=99.13  E-value=2.1e-11  Score=116.03  Aligned_cols=36  Identities=56%  Similarity=1.043  Sum_probs=33.5

Q ss_pred             hccceeeeEEeceeeecCCceeEEEEEeehhhhhcC
Q psy12064        113 VEQVKHQICVKDYCFARDDRLVGVAVLQLKDIVEQK  148 (148)
Q Consensus       113 AeKGScalcVKDyCf~r~dr~vG~~vlql~~i~~~~  148 (148)
                      .+..++++|||||||||+||+|||+||||++|+++|
T Consensus      1192 Pe~YEL~~~VKDYCFAReDRvvGl~VlqL~~va~kG 1227 (1283)
T KOG1011|consen 1192 PEHYELQFCVKDYCFAREDRVVGLAVLQLRSVADKG 1227 (1283)
T ss_pred             CceEEEEEeehhheeecccceeeeeeeehhhHhhcC
Confidence            455689999999999999999999999999999987


No 4  
>cd08395 C2C_Munc13 C2 domain third repeat in Munc13 (mammalian uncoordinated) proteins. C2-like domains are thought to be involved in phospholipid binding in a Ca2+ independent manner in both Unc13 and Munc13. Caenorabditis elegans Unc13 has a central domain with sequence similarity to PKC, which includes C1 and C2-related domains. Unc13 binds phorbol esters and DAG with high affinity in a phospholipid manner.  Mutations in Unc13 results in abnormal neuronal connections and impairment in cholinergic neurotransmission in the nematode.  Munc13 is the mammalian homolog which are expressed in the brain.  There are 3 isoforms (Munc13-1, -2, -3) and are thought to play a role in neurotransmitter release and are hypothesized to be high-affinity receptors for phorbol esters.  Unc13 and Munc13 contain both C1 and C2 domains.  There are two C2 related domains present, one central and one at the carboxyl end.  Munc13-1 contains a third C2-like domain.  Munc13 interacts with syntaxin, synaptobrevi
Probab=97.68  E-value=7.5e-05  Score=55.64  Aligned_cols=48  Identities=63%  Similarity=1.061  Sum_probs=42.5

Q ss_pred             ccCCCCCCCceEEEeeeeceeeccCCeeeeeeeeeccchhccceeeeE
Q psy12064         74 LIGNEEQLEFFELHICVKDYCFARDDRLVGVAVLQLKDIVEQVKHQIC  121 (148)
Q Consensus        74 ~lgne~~p~~yEL~~~VKDYCFar~Dr~vG~av~qL~~iAeKGScalc  121 (148)
                      -+.+++.|+...|+++|.||-|.+.|+++|-++++|+++...++...|
T Consensus        60 ~v~~~~~~~~~~L~~~V~D~d~~~~dd~IG~~~l~l~~~~~~~~~~~w  107 (120)
T cd08395          60 ILGNEDDPESYELHICVKDYCFARDDRLVGVTVLQLRDIAQAGSCACW  107 (120)
T ss_pred             EeeCcCCCceeEEEEEEEEecccCCCCEEEEEEEEHHHCcCCCcEEEE
Confidence            445666788899999999999999999999999999999999987744


No 5  
>KOG1328|consensus
Probab=94.90  E-value=0.03  Score=55.16  Aligned_cols=53  Identities=38%  Similarity=0.554  Sum_probs=47.3

Q ss_pred             HHHHHHHHHHhhhhcCCCccccccccCcchhhHHHHHhhhhhhhHHHHHHHHHh
Q psy12064         13 LDASLDSIKNYFHAAGNGLKKTYLDKSPELASLRYALSLYTQTTDALIKTFVQS   66 (148)
Q Consensus        13 ld~aldtiK~yFhagg~GlKk~fLeks~~l~slryalsLytqtTd~LIk~fv~t   66 (148)
                      |=-||..+-+||||+|.||--.-|.-.|++. |.-.|||+.-.||.||..|-..
T Consensus       869 l~eal~~Lv~FFHAeGqGL~le~L~t~~~~r-l~~~L~lhkt~T~~lIe~fY~d  921 (1103)
T KOG1328|consen  869 LFEALHVLVEFFHAEGQGLSLEALDTNPEHR-LVKILSLHKTPTEQLIEKFYKD  921 (1103)
T ss_pred             HHHHHHHHHHHHhccCCCcchHhhccCcHHH-HHHHHHhcCCCHHHHHHHHHHH
Confidence            3457788889999999999999999999998 9999999999999999998653


No 6  
>cd04010 C2B_RasA3 C2 domain second repeat present in RAS p21 protein activator 3 (RasA3). RasA3 are members of GTPase activating protein 1 (GAP1), a Ras-specific GAP, which suppresses Ras function by enhancing the GTPase activity of Ras proteins resulting in the inactive GDP-bound form of Ras.  In this way it can control cellular proliferation and differentiation.  RasA3 contains an N-terminal C2 domain,  a Ras-GAP domain, a plextrin homology (PH)-like domain, and a Bruton's Tyrosine Kinase (BTK) zinc binding domain. C2 domains fold into an 8-standed beta-sandwich that can adopt 2 structural arrangements: Type I and Type II, distinguished by a circular permutation involving their N- and C-terminal beta strands. Many C2 domains are Ca2+-dependent membrane-targeting modules that bind a wide variety of substances including bind phospholipids, inositol polyphosphates, and intracellular proteins.  Most C2 domain proteins are either signal transduction enzymes that contain a single C2 domain
Probab=94.67  E-value=0.051  Score=41.72  Aligned_cols=44  Identities=23%  Similarity=0.249  Sum_probs=36.5

Q ss_pred             CCCCceEEEeeeeceeeccCCeeeeeeeeeccchhcc-ceeeeEE
Q psy12064         79 EQLEFFELHICVKDYCFARDDRLVGVAVLQLKDIVEQ-VKHQICV  122 (148)
Q Consensus        79 ~~p~~yEL~~~VKDYCFar~Dr~vG~av~qL~~iAeK-GScalcV  122 (148)
                      ++++.-.|++.|+|+-..+.|.++|-+.++|+++.+. +....|+
T Consensus        74 ~~~~~~~L~i~V~d~~~~~~ddfLG~v~i~l~~l~~~~~~~~~W~  118 (148)
T cd04010          74 EDAEKLELRVDLWHASMGGGDVFLGEVRIPLRGLDLQAGSHQAWY  118 (148)
T ss_pred             ccccEEEEEEEEEcCCCCCCCceeEEEEEecccccccCCcCccee
Confidence            3455678999999999889999999999999999887 5655443


No 7  
>cd04044 C2A_Tricalbin-like C2 domain first repeat present in Tricalbin-like proteins. 5 to 6 copies of the C2 domain are present in Tricalbin, a yeast homolog of Synaptotagmin, which is involved in membrane trafficking and sorting.  C2 domains fold into an 8-standed beta-sandwich that can adopt 2 structural arrangements: Type I and Type II, distinguished by a circular permutation involving their N- and C-terminal beta strands. Many C2 domains are Ca2+-dependent membrane-targeting modules that bind a wide variety of substances including bind phospholipids, inositol polyphosphates, and intracellular proteins.  Most C2 domain proteins are either signal transduction enzymes that contain a single C2 domain, such as protein kinase C, or membrane trafficking proteins which contain at least two C2 domains, such as synaptotagmin 1.  However, there are a few exceptions to this including RIM isoforms and some splice variants of piccolo/aczonin and intersectin which only have a single C2 domain.  
Probab=94.04  E-value=0.11  Score=36.24  Aligned_cols=60  Identities=22%  Similarity=0.311  Sum_probs=46.1

Q ss_pred             CCceEEEeeeeceeeccCCeeeeeeeeeccchhccceeeeEEeceeeecCCceeEEEEEeeh
Q psy12064         81 LEFFELHICVKDYCFARDDRLVGVAVLQLKDIVEQVKHQICVKDYCFARDDRLVGVAVLQLK  142 (148)
Q Consensus        81 p~~yEL~~~VKDYCFar~Dr~vG~av~qL~~iAeKGScalcVKDyCf~r~dr~vG~~vlql~  142 (148)
                      +..-.|.+.|.|+--.+.|+++|.+.++|+++++++...-  ..+.+.+.++-.|--.+.|+
T Consensus        62 ~~~~~l~~~v~d~~~~~~d~~iG~~~~~l~~l~~~~~~~~--~~~~~~~~~k~~G~i~~~l~  121 (124)
T cd04044          62 SLTEPLNLTVYDFNDKRKDKLIGTAEFDLSSLLQNPEQEN--LTKNLLRNGKPVGELNYDLR  121 (124)
T ss_pred             CCCCEEEEEEEecCCCCCCceeEEEEEEHHHhccCccccC--cchhhhcCCccceEEEEEEE
Confidence            3455899999999988899999999999999999877631  12455677777777666553


No 8  
>cd08389 C2A_Synaptotagmin-14_16 C2A domain first repeat present in Synaptotagmins 14 and 16. Synaptotagmin 14 and 16 are membrane-trafficking proteins in specific tissues outside the brain.   Both of these contain C-terminal tandem C2 repeats, but only Synaptotagmin 14 has an N-terminal transmembrane domain and a putative fatty-acylation site. Previously all synaptotagmins were thought to be calcium sensors in the regulation of neurotransmitter release and hormone secretion, but it has been shown that not all of them bind calcium and this is indeed the case here.  Of the 17 identified synaptotagmins only 8 bind calcium (1-3, 5-7, 9, 10).  The function of the two C2 domains that bind calcium are: regulating the fusion step of synaptic vesicle exocytosis (C2A) and  binding to phosphatidyl-inositol-3,4,5-triphosphate (PIP3) in the absence of calcium ions and to phosphatidylinositol bisphosphate (PIP2) in their presence (C2B).  C2B also regulates also the recycling step of synaptic vesicle
Probab=93.99  E-value=0.066  Score=38.96  Aligned_cols=45  Identities=20%  Similarity=0.286  Sum_probs=37.0

Q ss_pred             CCCCCceEEEeeeeceeeccCCeeeeeeeeeccchhccceeeeEE
Q psy12064         78 EEQLEFFELHICVKDYCFARDDRLVGVAVLQLKDIVEQVKHQICV  122 (148)
Q Consensus        78 e~~p~~yEL~~~VKDYCFar~Dr~vG~av~qL~~iAeKGScalcV  122 (148)
                      ++......|+++|+||--.+.|.++|-+.++|.++...+....|+
T Consensus        76 ~~~l~~~~L~~~V~~~~~~~~~~~lG~~~i~L~~l~~~~~~~~w~  120 (124)
T cd08389          76 PEELNNMALRFRLYGVERMRKERLIGEKVVPLSQLNLEGETTVWL  120 (124)
T ss_pred             HHHhccCEEEEEEEECCCcccCceEEEEEEeccccCCCCCceEEE
Confidence            345667889999999987778889999999999996666666664


No 9  
>cd04030 C2C_KIAA1228 C2 domain third repeat present in uncharacterized human KIAA1228-like proteins. KIAA proteins are uncharacterized human proteins. They were compiled by the Kazusa mammalian cDNA project which identified more than 2000 human genes. They are identified by 4 digit codes that precede the KIAA designation.  Many KIAA genes are still functionally uncharacterized including KIAA1228. C2 domains fold into an 8-standed beta-sandwich that can adopt 2 structural arrangements: Type I and Type II, distinguished by a circular permutation involving their N- and C-terminal beta strands. Many C2 domains are Ca2+-dependent membrane-targeting modules that bind a wide variety of substances including bind phospholipids, inositol polyphosphates, and intracellular proteins.  Most C2 domain proteins are either signal transduction enzymes that contain a single C2 domain, such as protein kinase C, or membrane trafficking proteins which contain at least two C2 domains, such as synaptotagmin 1
Probab=93.89  E-value=0.063  Score=37.99  Aligned_cols=40  Identities=20%  Similarity=0.310  Sum_probs=30.1

Q ss_pred             ceEEEeeeece--eeccCCeeeeeeeeeccchhccceeeeEE
Q psy12064         83 FFELHICVKDY--CFARDDRLVGVAVLQLKDIVEQVKHQICV  122 (148)
Q Consensus        83 ~yEL~~~VKDY--CFar~Dr~vG~av~qL~~iAeKGScalcV  122 (148)
                      .-.|++.|+|+  .|.+.|+.+|.+.++|.++...+....|.
T Consensus        83 ~~~l~i~v~~~~~~~~~~~~~iG~~~i~l~~l~~~~~~~~W~  124 (127)
T cd04030          83 RRTLDVAVKNSKSFLSREKKLLGQVLIDLSDLDLSKGFTQWY  124 (127)
T ss_pred             CCEEEEEEEECCcccCCCCceEEEEEEecccccccCCccceE
Confidence            34566666665  55688999999999999997777666554


No 10 
>cd08675 C2B_RasGAP C2 domain second repeat of Ras GTPase activating proteins (GAPs). RasGAPs suppress Ras function by enhancing the GTPase activity of Ras proteins resulting in the inactive GDP-bound form of Ras.  In this way it can control cellular proliferation and differentiation.  The proteins here all contain two tandem C2 domains,  a Ras-GAP domain, and a pleckstrin homology (PH)-like domain. C2 domains fold into an 8-standed beta-sandwich that can adopt 2 structural arrangements: Type I and Type II, distinguished by a circular permutation involving their N- and C-terminal beta strands. Many C2 domains are Ca2+-dependent membrane-targeting modules that bind a wide variety of substances including bind phospholipids, inositol polyphosphates, and intracellular proteins.  Most C2 domain proteins are either signal transduction enzymes that contain a single C2 domain, such as protein kinase C, or membrane trafficking proteins which contain at least two C2 domains, such as synaptotagmin
Probab=92.64  E-value=0.2  Score=37.28  Aligned_cols=44  Identities=23%  Similarity=0.283  Sum_probs=37.5

Q ss_pred             CCCCceEEEeeeeceeeccCCeeeeeeeeeccchhccceeeeEE
Q psy12064         79 EQLEFFELHICVKDYCFARDDRLVGVAVLQLKDIVEQVKHQICV  122 (148)
Q Consensus        79 ~~p~~yEL~~~VKDYCFar~Dr~vG~av~qL~~iAeKGScalcV  122 (148)
                      +++....|++.|.||-....|.++|-+.++|.++...+....|+
T Consensus        73 ~~~~~~~l~i~V~d~~~~~~~~~IG~~~i~l~~l~~~~~~~~W~  116 (137)
T cd08675          73 EDLEKSELRVELWHASMVSGDDFLGEVRIPLQGLQQAGSHQAWY  116 (137)
T ss_pred             ccccccEEEEEEEcCCcCcCCcEEEEEEEehhhccCCCcccceE
Confidence            45577889999999999889999999999999998877777444


No 11 
>cd08390 C2A_Synaptotagmin-15-17 C2A domain first repeat present in Synaptotagmins 15 and 17. Synaptotagmin is a membrane-trafficking protein characterized by a N-terminal transmembrane region, a linker, and 2 C-terminal C2 domains. It is thought to be involved in the trafficking and exocytosis of secretory vesicles in non-neuronal tissues and is Ca2+ independent. Human synaptotagmin 15 has 2 alternatively spliced forms that encode proteins with different C-termini.  The larger, SYT15a, contains a N-terminal TM region, a putative fatty-acylation site, and 2 tandem C terminal C2 domains.  The smaller, SYT15b, lacks the C-terminal portion of the second C2 domain.  Unlike most other synaptotagmins it is nearly absent in the brain and rather is found in the heart, lungs, skeletal muscle, and testis. Synaptotagmin 17 is located in the brain, kidney, and prostate and is thought to be a peripheral membrane protein. Previously all synaptotagmins were thought to be calcium sensors in the regulat
Probab=91.99  E-value=0.29  Score=34.41  Aligned_cols=39  Identities=18%  Similarity=0.123  Sum_probs=33.5

Q ss_pred             eEEEeeeeceeeccCCeeeeeeeeeccchhccceeeeEE
Q psy12064         84 FELHICVKDYCFARDDRLVGVAVLQLKDIVEQVKHQICV  122 (148)
Q Consensus        84 yEL~~~VKDYCFar~Dr~vG~av~qL~~iAeKGScalcV  122 (148)
                      -.|++.|.|+...+.|.++|.+.++|.++...++-..|.
T Consensus        81 ~~l~i~v~d~~~~~~~~~iG~~~i~L~~l~~~~~~~~w~  119 (123)
T cd08390          81 RTLRLSVYDVDRFSRHCIIGHVLFPLKDLDLVKGGVVWR  119 (123)
T ss_pred             cEEEEEEEECCcCCCCcEEEEEEEeccceecCCCceEEE
Confidence            468999999999889999999999999998877766553


No 12 
>cd08395 C2C_Munc13 C2 domain third repeat in Munc13 (mammalian uncoordinated) proteins. C2-like domains are thought to be involved in phospholipid binding in a Ca2+ independent manner in both Unc13 and Munc13. Caenorabditis elegans Unc13 has a central domain with sequence similarity to PKC, which includes C1 and C2-related domains. Unc13 binds phorbol esters and DAG with high affinity in a phospholipid manner.  Mutations in Unc13 results in abnormal neuronal connections and impairment in cholinergic neurotransmission in the nematode.  Munc13 is the mammalian homolog which are expressed in the brain.  There are 3 isoforms (Munc13-1, -2, -3) and are thought to play a role in neurotransmitter release and are hypothesized to be high-affinity receptors for phorbol esters.  Unc13 and Munc13 contain both C1 and C2 domains.  There are two C2 related domains present, one central and one at the carboxyl end.  Munc13-1 contains a third C2-like domain.  Munc13 interacts with syntaxin, synaptobrevi
Probab=91.58  E-value=0.24  Score=36.92  Aligned_cols=35  Identities=69%  Similarity=1.149  Sum_probs=30.2

Q ss_pred             hccceeeeEEeceeeecCCceeEEEEEeehhhhhc
Q psy12064        113 VEQVKHQICVKDYCFARDDRLVGVAVLQLKDIVEQ  147 (148)
Q Consensus       113 AeKGScalcVKDyCf~r~dr~vG~~vlql~~i~~~  147 (148)
                      .+.-.+.++|.||-+.+.|..+|-++++|.++...
T Consensus        67 ~~~~~L~~~V~D~d~~~~dd~IG~~~l~l~~~~~~  101 (120)
T cd08395          67 PESYELHICVKDYCFARDDRLVGVTVLQLRDIAQA  101 (120)
T ss_pred             CceeEEEEEEEEecccCCCCEEEEEEEEHHHCcCC
Confidence            34456899999999999999999999999998654


No 13 
>cd08387 C2A_Synaptotagmin-8 C2A domain first repeat present in Synaptotagmin 8. Synaptotagmin is a membrane-trafficking protein characterized by a N-terminal transmembrane region, a linker, and 2 C-terminal C2 domains. Previously all synaptotagmins were thought to be calcium sensors in the regulation of neurotransmitter release and hormone secretion, but it has been shown that not all of them bind calcium.  Of the 17 identified synaptotagmins only 8 bind calcium (1-3, 5-7, 9, 10).  The function of the two C2 domains that bind calcium are: regulating the fusion step of synaptic vesicle exocytosis (C2A) and  binding to phosphatidyl-inositol-3,4,5-triphosphate (PIP3) in the absence of calcium ions and to phosphatidylinositol bisphosphate (PIP2) in their presence (C2B).  C2B also regulates also the recycling step of synaptic vesicles.  C2 domains fold into an 8-standed beta-sandwich that can adopt 2 structural arrangements: Type I and Type II, distinguished by a circular permutation involv
Probab=89.95  E-value=0.41  Score=33.99  Aligned_cols=43  Identities=23%  Similarity=0.232  Sum_probs=35.2

Q ss_pred             CCceEEEeeeeceeeccCCeeeeeeeeeccchhccceeeeEEe
Q psy12064         81 LEFFELHICVKDYCFARDDRLVGVAVLQLKDIVEQVKHQICVK  123 (148)
Q Consensus        81 p~~yEL~~~VKDYCFar~Dr~vG~av~qL~~iAeKGScalcVK  123 (148)
                      .....|.+.|.||=..+.|.++|.+.++|.++...+....|.+
T Consensus        79 l~~~~l~i~V~d~~~~~~~~~iG~~~i~l~~~~~~~~~~~W~~  121 (124)
T cd08387          79 LPKRTLEVLLYDFDQFSRDECIGVVELPLAEVDLSEKLDLWRK  121 (124)
T ss_pred             hCCCEEEEEEEECCCCCCCceeEEEEEecccccCCCCcceEEE
Confidence            3456799999999766788999999999999988887776653


No 14 
>cd04049 C2_putative_Elicitor-responsive_gene C2 domain present in the putative elicitor-responsive gene. In plants elicitor-responsive proteins are triggered in response to specific elicitor molecules such as glycolproteins, peptides, carbohydrates and lipids. A host of defensive responses are also triggered resulting in localized cell death.  Antimicrobial secondary metabolites, such as phytoalexins, or defense-related proteins, including pathogenesis-related (PR) proteins  are also produced.  There is a single C2 domain present here.  C2 domains fold into an 8-standed beta-sandwich that can adopt 2 structural arrangements: Type I and Type II, distinguished by a circular permutation involving their N- and C-terminal beta strands. Many C2 domains are Ca2+-dependent membrane-targeting modules that bind a wide variety of substances including bind phospholipids, inositol polyphosphates, and intracellular proteins.  Most C2 domain proteins are either signal transduction enzymes that contai
Probab=88.74  E-value=0.91  Score=32.23  Aligned_cols=49  Identities=22%  Similarity=0.285  Sum_probs=37.7

Q ss_pred             ceEEEeeeeceeeccCCeeeeeeeeeccchhccce----eeeEEeceeeecCC
Q psy12064         83 FFELHICVKDYCFARDDRLVGVAVLQLKDIVEQVK----HQICVKDYCFARDD  131 (148)
Q Consensus        83 ~yEL~~~VKDYCFar~Dr~vG~av~qL~~iAeKGS----calcVKDyCf~r~d  131 (148)
                      .-.|++.|.|+--.+.|.++|.+.++|.++.+.|+    +.+.=++||+-..|
T Consensus        65 ~~~l~v~V~d~~~~~~d~~iG~~~i~l~~l~~~~~~~~~~~l~p~~~~~~~~~  117 (124)
T cd04049          65 DTKLILRIMDKDNFSDDDFIGEATIHLKGLFEEGVEPGTAELVPAKYNVVLED  117 (124)
T ss_pred             CCEEEEEEEECccCCCCCeEEEEEEEhHHhhhCCCCcCceEeeccceEEEEec
Confidence            45788999999877788999999999999987654    44445677765543


No 15 
>cd04042 C2A_MCTP_PRT C2 domain first repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP). MCTPs are involved in Ca2+ signaling at the membrane.  MCTP is composed of a variable N-terminal sequence, three C2 domains, two transmembrane regions (TMRs), and a short C-terminal sequence.  It is one of four protein classes that are anchored to membranes via a transmembrane region; the others being synaptotagmins, extended synaptotagmins, and ferlins. MCTPs are the only membrane-bound C2 domain proteins that contain two functional TMRs. MCTPs are unique in that they bind Ca2+ but not phospholipids. C2 domains fold into an 8-standed beta-sandwich that can adopt 2 structural arrangements: Type I and Type II, distinguished by a circular permutation involving their N- and C-terminal beta strands. Many C2 domains are Ca2+-dependent membrane-targeting modules that bind a wide variety of substances including bind phospholipids, inositol polyphosphates, and intracellular protein
Probab=88.55  E-value=0.74  Score=32.64  Aligned_cols=55  Identities=22%  Similarity=0.233  Sum_probs=40.4

Q ss_pred             eEEEeeeeceeeccCCeeeeeeeeeccchhccceeeeEEeceeee--cCCceeEEEEEee
Q psy12064         84 FELHICVKDYCFARDDRLVGVAVLQLKDIVEQVKHQICVKDYCFA--RDDRLVGVAVLQL  141 (148)
Q Consensus        84 yEL~~~VKDYCFar~Dr~vG~av~qL~~iAeKGScalcVKDyCf~--r~dr~vG~~vlql  141 (148)
                      -.|.+.|.|+-..+.|..+|-+.++|.++...+....|+   ...  +.+...|--.+.+
T Consensus        61 ~~l~~~v~D~d~~~~~~~iG~~~~~l~~l~~~~~~~~~~---~L~~~~~~~~~G~l~l~~  117 (121)
T cd04042          61 QPLYIKVFDYDRGLTDDFMGSAFVDLSTLELNKPTEVKL---KLEDPNSDEDLGYISLVV  117 (121)
T ss_pred             CeEEEEEEeCCCCCCCcceEEEEEEHHHcCCCCCeEEEE---ECCCCCCccCceEEEEEE
Confidence            479999999999999999999999999998777666443   232  1234556555544


No 16 
>cd04025 C2B_RasA1_RasA4 C2 domain second repeat present in RasA1 and RasA4. RasA1 and RasA4 are GAP1s (GTPase activating protein 1s ), Ras-specific GAP members, which suppresses Ras function by enhancing the GTPase activity of Ras proteins resulting in the inactive GDP-bound form of Ras.  In this way it can control cellular proliferation and differentiation.  Both proteins contain two C2 domains,  a Ras-GAP domain, a plextrin homology (PH)-like domain, and a Bruton's Tyrosine Kinase (BTK) zinc binding domain. C2 domains fold into an 8-standed beta-sandwich that can adopt 2 structural arrangements: Type I and Type II, distinguished by a circular permutation involving their N- and C-terminal beta strands. Many C2 domains are Ca2+-dependent membrane-targeting modules that bind a wide variety of substances including bind phospholipids, inositol polyphosphates, and intracellular proteins.  Most C2 domain proteins are either signal transduction enzymes that contain a single C2 domain, such a
Probab=88.36  E-value=0.63  Score=33.01  Aligned_cols=39  Identities=13%  Similarity=0.205  Sum_probs=32.8

Q ss_pred             ceEEEeeeeceeeccCCeeeeeeeeeccchhccceeeeE
Q psy12064         83 FFELHICVKDYCFARDDRLVGVAVLQLKDIVEQVKHQIC  121 (148)
Q Consensus        83 ~yEL~~~VKDYCFar~Dr~vG~av~qL~~iAeKGScalc  121 (148)
                      .-.|.+.|.||-....|..+|.+.++|.++...+....|
T Consensus        60 ~~~l~~~v~d~~~~~~~~~iG~~~~~l~~l~~~~~~~~w   98 (123)
T cd04025          60 DSPLSVEVWDWDLVSKNDFLGKVVFSIQTLQQAKQEEGW   98 (123)
T ss_pred             CCEEEEEEEECCCCCCCcEeEEEEEEHHHcccCCCCCCE
Confidence            456999999999888899999999999999877665533


No 17 
>cd04009 C2B_Munc13-like C2 domain second repeat in Munc13 (mammalian uncoordinated)-like proteins. C2-like domains are thought to be involved in phospholipid binding in a Ca2+ independent manner in both Unc13 and Munc13. Caenorabditis elegans Unc13 has a central domain with sequence similarity to PKC, which includes C1 and C2-related domains. Unc13 binds phorbol esters and DAG with high affinity in a phospholipid manner.  Mutations in Unc13 results in abnormal neuronal connections and impairment in cholinergic neurotransmission in the nematode.  Munc13 is the mammalian homolog which are expressed in the brain.  There are 3 isoforms (Munc13-1, -2, -3) and are thought to play a role in neurotransmitter release and are hypothesized to be high-affinity receptors for phorbol esters.  Unc13 and Munc13 contain both C1 and C2 domains.  There are two C2 related domains present, one central and one at the carboxyl end.  Munc13-1 contains a third C2-like domain.  Munc13 interacts with syntaxin, s
Probab=88.04  E-value=0.61  Score=34.00  Aligned_cols=33  Identities=36%  Similarity=0.365  Sum_probs=28.1

Q ss_pred             CceEEEeeeeceeeccCCeeeeeeeeeccchhc
Q psy12064         82 EFFELHICVKDYCFARDDRLVGVAVLQLKDIVE  114 (148)
Q Consensus        82 ~~yEL~~~VKDYCFar~Dr~vG~av~qL~~iAe  114 (148)
                      ..-.|++.|.||-..+.|+++|.+.++|+++.+
T Consensus        86 ~~~~l~~~V~d~d~~~~d~~iG~~~i~l~~l~~  118 (133)
T cd04009          86 EGALLLFTVKDYDLLGSNDFEGEAFLPLNDIPG  118 (133)
T ss_pred             CCCEEEEEEEecCCCCCCcEeEEEEEeHHHCCc
Confidence            345789999999888889999999999998864


No 18 
>cd08386 C2A_Synaptotagmin-7 C2A domain first repeat present in Synaptotagmin 7. Synaptotagmin is a membrane-trafficking protein characterized by a N-terminal transmembrane region, a linker, and 2 C-terminal C2 domains. Synaptotagmin 7, a member of class 2 synaptotagmins, is located in presynaptic plasma membranes in neurons, dense-core vesicles in endocrine cells, and lysosomes in fibroblasts.  It has been shown to play a role in regulation of Ca2+-dependent lysosomal exocytosis in fibroblasts and may also function as a vesicular Ca2+-sensor.  It is distinguished from the other synaptotagmins by having over 12 splice forms. Previously all synaptotagmins were thought to be calcium sensors in the regulation of neurotransmitter release and hormone secretion, but it has been shown that not all of them bind calcium.  Of the 17 identified synaptotagmins only 8 bind calcium (1-3, 5-7, 9, 10).  The function of the two C2 domains that bind calcium are: regulating the fusion step of synaptic ves
Probab=88.02  E-value=0.67  Score=32.73  Aligned_cols=42  Identities=19%  Similarity=0.134  Sum_probs=32.5

Q ss_pred             CCceEEEeeeeceeeccCCeeeeeeeeeccchhccceeeeEE
Q psy12064         81 LEFFELHICVKDYCFARDDRLVGVAVLQLKDIVEQVKHQICV  122 (148)
Q Consensus        81 p~~yEL~~~VKDYCFar~Dr~vG~av~qL~~iAeKGScalcV  122 (148)
                      +..-.|.+.|+||--.+.|..+|.+.++|+++........|.
T Consensus        80 l~~~~l~~~v~d~d~~~~~~~iG~~~i~l~~l~~~~~~~~W~  121 (125)
T cd08386          80 LQQRVLYLQVLDYDRFSRNDPIGEVSLPLNKVDLTEEQTFWK  121 (125)
T ss_pred             hCCCEEEEEEEeCCCCcCCcEeeEEEEecccccCCCCcceEE
Confidence            334468999999986667789999999999998766666443


No 19 
>cd08521 C2A_SLP C2 domain first repeat present in Synaptotagmin-like proteins. All Slp members basically share an N-terminal Slp homology domain (SHD) and C-terminal tandem C2 domains (named the C2A domain and the C2B domain) with the SHD and C2 domains being separated by a linker sequence of various length.  Slp1/JFC1 and Slp2/exophilin 4 promote granule docking to the plasma membrane.  Additionally, their C2A domains are both Ca2+ independent, unlike the case in Slp3 and Slp4/granuphilin in which their C2A domains are Ca2+ dependent.  It is thought that SHD (except for the Slp4-SHD) functions as a specific Rab27A/B-binding domain. In addition to Slps, rabphilin, Noc2, and  Munc13-4 also function as Rab27-binding proteins. It has been demonstrated that Slp3 and Slp4/granuphilin promote dense-core vesicle exocytosis. Slp5 mRNA has been shown to be restricted to human placenta and liver suggesting a role in Rab27A-dependent membrane trafficking in specific tissues. C2 domains fold into 
Probab=87.64  E-value=0.67  Score=32.46  Aligned_cols=41  Identities=12%  Similarity=0.011  Sum_probs=31.4

Q ss_pred             CceEEEeeeeceeeccCCeeeeeeeeeccchhccceeeeEE
Q psy12064         82 EFFELHICVKDYCFARDDRLVGVAVLQLKDIVEQVKHQICV  122 (148)
Q Consensus        82 ~~yEL~~~VKDYCFar~Dr~vG~av~qL~~iAeKGScalcV  122 (148)
                      ....|++.|.|+--.+.|.++|.+.++|.++.-.+....|+
T Consensus        81 ~~~~l~i~v~d~~~~~~~~~iG~~~i~l~~l~~~~~~~~w~  121 (123)
T cd08521          81 ETRTLQLSVWHHDRFGRNTFLGEVEIPLDSWDLDSQQSEWY  121 (123)
T ss_pred             CCCEEEEEEEeCCCCcCCceeeEEEEecccccccCCCccEE
Confidence            35578899999986677789999999999996555555443


No 20 
>cd08388 C2A_Synaptotagmin-4-11 C2A domain first repeat present in Synaptotagmins 4 and 11. Synaptotagmin is a membrane-trafficking protein characterized by a N-terminal transmembrane region, a linker, and 2 C-terminal C2 domains.  Synaptotagmins 4 and 11, class 4 synaptotagmins, are located in the brain.  Their functions are unknown. They are distinguished from the other synaptotagmins by having and Asp to Ser substitution in their C2A domains. Previously all synaptotagmins were thought to be calcium sensors in the regulation of neurotransmitter release and hormone secretion, but it has been shown that not all of them bind calcium.  Of the 17 identified synaptotagmins only 8 bind calcium (1-3, 5-7, 9, 10).  The function of the two C2 domains that bind calcium are: regulating the fusion step of synaptic vesicle exocytosis (C2A) and  binding to phosphatidyl-inositol-3,4,5-triphosphate (PIP3) in the absence of calcium ions and to phosphatidylinositol bisphosphate (PIP2) in their presence 
Probab=87.54  E-value=0.78  Score=33.61  Aligned_cols=42  Identities=21%  Similarity=0.288  Sum_probs=32.0

Q ss_pred             CCCceEEEeeeeceeeccCCeeeeeeeeeccch--hccceeeeE
Q psy12064         80 QLEFFELHICVKDYCFARDDRLVGVAVLQLKDI--VEQVKHQIC  121 (148)
Q Consensus        80 ~p~~yEL~~~VKDYCFar~Dr~vG~av~qL~~i--AeKGScalc  121 (148)
                      +.....|++.|.||=-.+.|.++|-+.++|.++  .+.++.++|
T Consensus        80 ~~~~~~L~~~V~d~d~~~~d~~lG~~~i~L~~l~~~~~~~~~~~  123 (128)
T cd08388          80 QLQDLSLHFAVLSFDRYSRDDVIGEVVCPLAGADLLNEGELLVS  123 (128)
T ss_pred             HhCCCEEEEEEEEcCCCCCCceeEEEEEeccccCCCCCceEEEE
Confidence            334456899998874445677999999999999  456999955


No 21 
>cd04051 C2_SRC2_like C2 domain present in Soybean genes Regulated by Cold 2 (SRC2)-like proteins. SRC2 production is a response to pathogen infiltration.  The initial response of increased Ca2+ concentrations are coupled to downstream signal transduction pathways via calcium binding proteins.  SRC2 contains a single C2 domain which localizes to the plasma membrane and is involved in Ca2+ dependent protein binding. C2 domains fold into an 8-standed beta-sandwich that can adopt 2 structural arrangements: Type I and Type II, distinguished by a circular permutation involving their N- and C-terminal beta strands. Many C2 domains are Ca2+-dependent membrane-targeting modules that bind a wide variety of substances including bind phospholipids, inositol polyphosphates, and intracellular proteins.  Most C2 domain proteins are either signal transduction enzymes that contain a single C2 domain, such as protein kinase C, or membrane trafficking proteins which contain at least two C2 domains, such 
Probab=85.72  E-value=1  Score=31.85  Aligned_cols=35  Identities=26%  Similarity=0.280  Sum_probs=31.2

Q ss_pred             ceEEEeeeeceeeccCCeeeeeeeeeccchhccce
Q psy12064         83 FFELHICVKDYCFARDDRLVGVAVLQLKDIVEQVK  117 (148)
Q Consensus        83 ~yEL~~~VKDYCFar~Dr~vG~av~qL~~iAeKGS  117 (148)
                      .-.|.+.|.|+.-...|+++|.+.++|.++...+.
T Consensus        66 ~~~l~~~v~d~~~~~~~~~lG~~~i~l~~l~~~~~  100 (125)
T cd04051          66 RLALTIEVYCERPSLGDKLIGEVRVPLKDLLDGAS  100 (125)
T ss_pred             ccEEEEEEEECCCCCCCCcEEEEEEEHHHhhcccC
Confidence            57899999999877789999999999999988765


No 22 
>cd08681 C2_fungal_Inn1p-like C2 domain found in fungal Ingression 1 (Inn1) proteins. Saccharomyces cerevisiae Inn1 associates with the contractile actomyosin ring at the end of mitosis and is needed for cytokinesis. The C2 domain of Inn1, located at the N-terminus, is required for ingression of the plasma membrane. The C-terminus is relatively unstructured and contains eight PXXP motifs that are thought to mediate interaction of Inn1 with other proteins with SH3 domains in the cytokinesis proteins Hof1 (an F-BAR protein) and Cyk3 (whose overexpression can restore primary septum formation in Inn1Delta cells) as well as recruiting Inn1 to the bud-neck by binding to Cyk3. Inn1 and Cyk3 appear to cooperate in activating chitin synthase Chs2 for primary septum formation, which allows coordination of actomyosin ring contraction with ingression of the cleavage furrow. It is thought that the C2 domain of Inn1 helps to preserve the link between the actomyosin ring and the plasma membrane, contr
Probab=85.29  E-value=3.2  Score=28.97  Aligned_cols=56  Identities=20%  Similarity=0.202  Sum_probs=40.4

Q ss_pred             CceEEEeeeeceeeccCCeeeeeeeeeccchhccceeeeEEeceeeecCCceeEEEEEee
Q psy12064         82 EFFELHICVKDYCFARDDRLVGVAVLQLKDIVEQVKHQICVKDYCFARDDRLVGVAVLQL  141 (148)
Q Consensus        82 ~~yEL~~~VKDYCFar~Dr~vG~av~qL~~iAeKGScalcVKDyCf~r~dr~vG~~vlql  141 (148)
                      ..-.|.+.|.|+-..+ |+++|-+.++|.++...+....|   |-..+.++..|--.|+|
T Consensus        61 ~~~~l~i~v~d~~~~~-~~~iG~~~~~l~~~~~~~~~~~w---~~L~~~~~~~G~i~l~l  116 (118)
T cd08681          61 KKPILKVAVFDDDKRK-PDLIGDTEVDLSPALKEGEFDDW---YELTLKGRYAGEVYLEL  116 (118)
T ss_pred             CCCEEEEEEEeCCCCC-CcceEEEEEecHHHhhcCCCCCc---EEeccCCcEeeEEEEEE
Confidence            3457999999998766 99999999999999776543322   23345666777666655


No 23 
>cd08682 C2_Rab11-FIP_classI C2 domain found in Rab11-family interacting proteins (FIP) class I. Rab GTPases recruit various effector proteins to organelles and vesicles.  Rab11-family interacting proteins (FIPs) are involved in mediating the role of Rab11. FIPs can be divided into three classes: class I FIPs (Rip11a, Rip11b, RCP, and FIP2) which contain a C2 domain after N-terminus of the protein, class II FIPs (FIP3 and FIP4) which contain two EF-hands and a proline rich region, and class III FIPs (FIP1) which exhibits no homology to known protein domains. All FIP proteins contain a highly conserved, 20-amino acid motif at the C-terminus of the protein, known as Rab11/25 binding domain (RBD).  Class I FIPs are thought to bind to endocytic membranes via their C2 domain, which interacts directly with phospholipids. Class II FIPs do not have any membrane binding domains leaving much to speculate about the mechanism involving FIP3 and FIP4 interactions with endocytic membranes. The member
Probab=85.17  E-value=1.8  Score=30.91  Aligned_cols=34  Identities=18%  Similarity=0.209  Sum_probs=27.8

Q ss_pred             CCCceEEEeeeeceeeccCCeeeeeeeeeccchh
Q psy12064         80 QLEFFELHICVKDYCFARDDRLVGVAVLQLKDIV  113 (148)
Q Consensus        80 ~p~~yEL~~~VKDYCFar~Dr~vG~av~qL~~iA  113 (148)
                      +|..-.|++.|.|+=-...|.++|.+.++|+++.
T Consensus        61 ~~~~~~l~~~v~d~~~~~~d~~iG~~~i~l~~l~   94 (126)
T cd08682          61 NGNRATLQLTVMHRNLLGLDKFLGQVSIPLNDLD   94 (126)
T ss_pred             CCcCCEEEEEEEEccccCCCceeEEEEEEHHHhh
Confidence            3566689999998854456889999999999997


No 24 
>cd08373 C2A_Ferlin C2 domain first repeat in Ferlin. Ferlins are involved in vesicle fusion events.  Ferlins and other proteins, such as Synaptotagmins, are implicated in facilitating the fusion process when cell membranes fuse together.  There are six known human Ferlins: Dysferlin (Fer1L1), Otoferlin (Fer1L2), Myoferlin (Fer1L3), Fer1L4, Fer1L5, and Fer1L6.  Defects in these genes can lead to a wide range of diseases including muscular dystrophy (dysferlin), deafness (otoferlin), and infertility (fer-1, fertilization factor-1).  Structurally they have 6 tandem C2 domains, designated as (C2A-C2F) and a single C-terminal transmembrane domain, though there is a new study that disputes this and claims that there are actually 7 tandem C2 domains with another C2 domain inserted between C2D and C2E.   In a subset of them (Dysferlin, Myoferlin, and Fer1) there is an additional conserved domain called DysF. C2 domains fold into an 8-standed beta-sandwich that can adopt 2 structural arrangemen
Probab=84.48  E-value=1.9  Score=30.75  Aligned_cols=40  Identities=33%  Similarity=0.423  Sum_probs=32.0

Q ss_pred             CceEEEeeeeceeeccCCeeeeeeeeeccchhccceeeeE
Q psy12064         82 EFFELHICVKDYCFARDDRLVGVAVLQLKDIVEQVKHQIC  121 (148)
Q Consensus        82 ~~yEL~~~VKDYCFar~Dr~vG~av~qL~~iAeKGScalc  121 (148)
                      +.-.|.+.|+||=-...|+++|.+.++|+++.+.+....|
T Consensus        55 ~~~~l~~~v~d~~~~~~d~~iG~~~~~l~~l~~~~~~~~~   94 (127)
T cd08373          55 PDESLEIVVKDYEKVGRNRLIGSATVSLQDLVSEGLLEVT   94 (127)
T ss_pred             CCCEEEEEEEECCCCCCCceEEEEEEEhhHcccCCceEEE
Confidence            4457888999986666789999999999999987765433


No 25 
>cd04031 C2A_RIM1alpha C2 domain first repeat contained in Rab3-interacting molecule (RIM) proteins. RIMs are believed to organize specialized sites of the plasma membrane called active zones.  They also play a role in controlling neurotransmitter release, plasticity processes, as well as memory and learning.  RIM contains an N-terminal zinc finger domain, a PDZ domain, and two C-terminal C2 domains (C2A, C2B).  C2 domains fold into an 8-standed beta-sandwich that can adopt 2 structural arrangements: Type I and Type II, distinguished by a circular permutation involving their N- and C-terminal beta strands. Many C2 domains are Ca2+-dependent membrane-targeting modules that bind a wide variety of substances including bind phospholipids, inositol polyphosphates, and intracellular proteins.  Most C2 domain proteins are either signal transduction enzymes that contain a single C2 domain, such as protein kinase C, or membrane trafficking proteins which contain at least two C2 domains, such as 
Probab=84.32  E-value=1.5  Score=30.80  Aligned_cols=36  Identities=25%  Similarity=0.321  Sum_probs=29.9

Q ss_pred             CCceEEEeeeeceeeccCCeeeeeeeeeccchhccc
Q psy12064         81 LEFFELHICVKDYCFARDDRLVGVAVLQLKDIVEQV  116 (148)
Q Consensus        81 p~~yEL~~~VKDYCFar~Dr~vG~av~qL~~iAeKG  116 (148)
                      +..-.|++.|.|+...+.|.++|-+.++|.+....+
T Consensus        82 l~~~~l~~~V~d~~~~~~~~~iG~~~i~l~~~~~~~  117 (125)
T cd04031          82 LKERTLEVTVWDYDRDGENDFLGEVVIDLADALLDD  117 (125)
T ss_pred             hCCCEEEEEEEeCCCCCCCcEeeEEEEecccccccC
Confidence            345689999999998889999999999999954433


No 26 
>cd08690 C2_Freud-1 C2 domain found in 5' repressor element under dual repression binding protein-1 (Freud-1). Freud-1 is a novel calcium-regulated repressor that negatively regulates basal 5-HT1A receptor expression in neurons.  It may also play a role in the altered regulation of 5-HT1A receptors associated with anxiety or major depression. Freud-1 contains two DM-14 basic repeats, a helix-loop-helix DNA binding domain, and a C2 domain. The Freud-1 C2 domain is thought to be calcium insensitive and it lacks several acidic residues that mediate calcium binding of the PKC C2 domain. In addition, it contains a poly-basic insert that is not present in calcium-dependent C2 domains and may function as a nuclear localization signal. C2 domains fold into an 8-standed beta-sandwich that can adopt 2 structural arrangements: Type I and Type II, distinguished by a circular permutation involving their N- and C-terminal beta strands. Many C2 domains are Ca2+-dependent membrane-targeting modules tha
Probab=84.17  E-value=1.4  Score=34.56  Aligned_cols=50  Identities=20%  Similarity=0.269  Sum_probs=38.5

Q ss_pred             EEEeeeece-eeccCCeeeeeeeeeccchhccceeeeEEeceeeecCCceeEEE
Q psy12064         85 ELHICVKDY-CFARDDRLVGVAVLQLKDIVEQVKHQICVKDYCFARDDRLVGVA  137 (148)
Q Consensus        85 EL~~~VKDY-CFar~Dr~vG~av~qL~~iAeKGScalcVKDyCf~r~dr~vG~~  137 (148)
                      -|.+.|.|+ =|.|.|.++|-++++|.++...-..+-   .+.+++.-+.+|-.
T Consensus        79 ~L~~~V~d~~~f~~~D~~iG~~~i~L~~l~~~~~~~~---~~~L~~~~k~~Gg~  129 (155)
T cd08690          79 GLKFEVYHKGGFLRSDKLLGTAQVKLEPLETKCEIHE---SVDLMDGRKATGGK  129 (155)
T ss_pred             cEEEEEEeCCCcccCCCeeEEEEEEcccccccCcceE---EEEhhhCCCCcCCE
Confidence            389999999 677999999999999999976655442   44577666666643


No 27 
>cd04026 C2_PKC_alpha_gamma C2 domain in Protein Kinase C (PKC) alpha and gamma. A single C2 domain is found in PKC alpha and gamma. The PKC family of serine/threonine kinases regulates apoptosis, proliferation, migration, motility, chemo-resistance, and differentiation.  There are 3 groups: group 1(alpha, betaI, beta II, gamma) which require phospholipids and calcium, group 2 (delta, epsilon, theta, eta) which do not require calcium for activation, and group 3 (xi, iota/lambda) which are atypical and can be activated in the absence of diacylglycerol and calcium. C2 domains fold into an 8-standed beta-sandwich that can adopt 2 structural arrangements: Type I and Type II, distinguished by a circular permutation involving their N- and C-terminal beta strands. Many C2 domains are Ca2+-dependent membrane-targeting modules that bind a wide variety of substances including bind phospholipids, inositol polyphosphates, and intracellular proteins.  Most C2 domain proteins are either signal transd
Probab=84.16  E-value=1.3  Score=31.72  Aligned_cols=32  Identities=16%  Similarity=0.262  Sum_probs=27.8

Q ss_pred             eEEEeeeeceeeccCCeeeeeeeeeccchhcc
Q psy12064         84 FELHICVKDYCFARDDRLVGVAVLQLKDIVEQ  115 (148)
Q Consensus        84 yEL~~~VKDYCFar~Dr~vG~av~qL~~iAeK  115 (148)
                      -.|.+.|.|+.-...|+.+|-+.++|.++..+
T Consensus        80 ~~l~v~v~d~~~~~~~~~iG~~~~~l~~l~~~  111 (131)
T cd04026          80 RRLSIEVWDWDRTTRNDFMGSLSFGVSELIKM  111 (131)
T ss_pred             CEEEEEEEECCCCCCcceeEEEEEeHHHhCcC
Confidence            36888899998778899999999999999866


No 28 
>cd08391 C2A_C2C_Synaptotagmin_like C2 domain first and third repeat in Synaptotagmin-like proteins. Synaptotagmin is a membrane-trafficking protein characterized by a N-terminal transmembrane region, a linker, and 2 C-terminal C2 domains. Previously all synaptotagmins were thought to be calcium sensors in the regulation of neurotransmitter release and hormone secretion, but it has been shown that not all of them bind calcium.  Of the 17 identified synaptotagmins only 8 bind calcium (1-3, 5-7, 9, 10).  The function of the two C2 domains that bind calcium are: regulating the fusion step of synaptic vesicle exocytosis (C2A) and  binding to phosphatidyl-inositol-3,4,5-triphosphate (PIP3) in the absence of calcium ions and to phosphatidylinositol bisphosphate (PIP2) in their presence (C2B).  C2B also regulates also the recycling step of synaptic vesicles. C2 domains fold into an 8-standed beta-sandwich that can adopt 2 structural arrangements: Type I and Type II, distinguished by a circular
Probab=83.99  E-value=1.9  Score=29.86  Aligned_cols=37  Identities=19%  Similarity=0.075  Sum_probs=30.7

Q ss_pred             CceEEEeeeeceeeccCCeeeeeeeeeccchhccceee
Q psy12064         82 EFFELHICVKDYCFARDDRLVGVAVLQLKDIVEQVKHQ  119 (148)
Q Consensus        82 ~~yEL~~~VKDYCFar~Dr~vG~av~qL~~iAeKGSca  119 (148)
                      ..-.|++.|.|+=.. .|.++|.+.++|.++.+.+...
T Consensus        66 ~~~~l~i~v~d~~~~-~~~~iG~~~i~l~~l~~~~~~~  102 (121)
T cd08391          66 PGQELEIELFDEDPD-KDDFLGRLSIDLGSVEKKGFID  102 (121)
T ss_pred             CCCEEEEEEEecCCC-CCCcEEEEEEEHHHhcccCccc
Confidence            345788999999766 8889999999999999877644


No 29 
>cd08685 C2_RGS-like C2 domain of the Regulator Of G-Protein Signaling (RGS) family. This CD contains members of the regulator of G-protein signaling (RGS) family. RGS is a GTPase activating protein which inhibits G-protein mediated signal transduction. The protein is largely cytosolic, but G-protein activation leads to translocation of this protein to the plasma membrane. A nuclear form of this protein has also been described, but its sequence has not been identified. There are multiple alternatively spliced transcript variants in this family with some members having additional domains (ex. PDZ and RGS) downstream of the C2 domain. The C2 domain was first identified in PKC. C2 domains fold into an 8-standed beta-sandwich that can adopt 2 structural arrangements: Type I and Type II, distinguished by a circular permutation involving their N- and C-terminal beta strands. Many C2 domains are Ca2+-dependent membrane-targeting modules that bind a wide variety of substances including bind pho
Probab=83.75  E-value=1.5  Score=31.92  Aligned_cols=38  Identities=26%  Similarity=0.251  Sum_probs=29.5

Q ss_pred             EEEeeeeceeec-cCCeeeeeeeeeccchhccceeeeEE
Q psy12064         85 ELHICVKDYCFA-RDDRLVGVAVLQLKDIVEQVKHQICV  122 (148)
Q Consensus        85 EL~~~VKDYCFa-r~Dr~vG~av~qL~~iAeKGScalcV  122 (148)
                      .|++.|.|+.-. +.+..+|-+.++|+++.......-|+
T Consensus        79 ~l~v~V~~~~~~~~~~~~lG~~~i~l~~~~~~~~~~~Wy  117 (119)
T cd08685          79 RLLVTVWNKLSKSRDSGLLGCMSFGVKSIVNQKEISGWY  117 (119)
T ss_pred             EEEEEEECCCCCcCCCEEEEEEEecHHHhccCccccceE
Confidence            488999999854 56789999999999998544455443


No 30 
>cd04047 C2B_Copine C2 domain second repeat in Copine. There are 2 copies of the C2 domain present in copine, a protein involved in membrane trafficking, protein-protein interactions, and perhaps even cell division and growth.  C2 domains fold into an 8-standed beta-sandwich that can adopt 2 structural arrangements: Type I and Type II, distinguished by a circular permutation involving their N- and C-terminal beta strands. Many C2 domains are Ca2+-dependent membrane-targeting modules that bind a wide variety of substances including bind phospholipids, inositol polyphosphates, and intracellular proteins.  Most C2 domain proteins are either signal transduction enzymes that contain a single C2 domain, such as protein kinase C, or membrane trafficking proteins which contain at least two C2 domains, such as synaptotagmin 1.  However, there are a few exceptions to this including RIM isoforms and some splice variants of piccolo/aczonin and intersectin which only have a single C2 domain.  C2 dom
Probab=83.71  E-value=2.2  Score=29.58  Aligned_cols=34  Identities=21%  Similarity=0.267  Sum_probs=25.7

Q ss_pred             eEEEeeeeceeeccCCeeeeeeeeeccchhccce
Q psy12064         84 FELHICVKDYCFARDDRLVGVAVLQLKDIVEQVK  117 (148)
Q Consensus        84 yEL~~~VKDYCFar~Dr~vG~av~qL~~iAeKGS  117 (148)
                      -.|.+.|.||--.+.|..+|-+.++|+++.....
T Consensus        70 ~~l~~~V~d~d~~~~d~~iG~~~~~l~~l~~~~~  103 (110)
T cd04047          70 RPIKIEVYDYDSSGKHDLIGEFETTLDELLKSSP  103 (110)
T ss_pred             CEEEEEEEEeCCCCCCcEEEEEEEEHHHHhcCCC
Confidence            3677888888777778888888888888874443


No 31 
>cd08381 C2B_PI3K_class_II C2 domain second repeat present in class II phosphatidylinositol 3-kinases (PI3Ks). There are 3 classes of PI3Ks based on structure, regulation, and specificity.  All classes contain a N-terminal C2 domain, a PIK domain, and a kinase catalytic domain. Unlike class I and class III, class II PI3Ks have additionally a PX domain and a C-terminal C2 domain containing a nuclear localization signal both of which bind phospholipids though in a slightly different fashion.  PI3Ks (AKA phosphatidylinositol (PtdIns) 3-kinases) regulate cell processes such as cell growth, differentiation, proliferation, and motility. PI3Ks work on phosphorylation of phosphatidylinositol, phosphatidylinositide (4)P (PtdIns (4)P),2 or PtdIns(4,5)P2. Specifically they phosphorylate the D3 hydroxyl group of phosphoinositol lipids on the inositol ring. C2 domains fold into an 8-standed beta-sandwich that can adopt 2 structural arrangements: Type I and Type II, distinguished by a circular permut
Probab=82.99  E-value=1.5  Score=31.84  Aligned_cols=44  Identities=16%  Similarity=0.124  Sum_probs=34.9

Q ss_pred             CCCCCceEEEeeeeceeeccCCeeeeeeeeeccchhccceeeeE
Q psy12064         78 EEQLEFFELHICVKDYCFARDDRLVGVAVLQLKDIVEQVKHQIC  121 (148)
Q Consensus        78 e~~p~~yEL~~~VKDYCFar~Dr~vG~av~qL~~iAeKGScalc  121 (148)
                      .+++..-.|++.|+||=-.+.|.++|-+.++|+++........|
T Consensus        75 ~~~l~~~~L~~~V~d~d~~~~~~~lG~~~i~l~~l~~~~~~~~W  118 (122)
T cd08381          75 VEDLQQRVLQVSVWSHDSLVENEFLGGVCIPLKKLDLSQETEKW  118 (122)
T ss_pred             hHHhCCCEEEEEEEeCCCCcCCcEEEEEEEeccccccCCCccce
Confidence            34566778999999997777889999999999999766554433


No 32 
>cd04028 C2B_RIM1alpha C2 domain second repeat contained in Rab3-interacting molecule (RIM) proteins. RIMs are believed to organize specialized sites of the plasma membrane called active zones.  They also play a role in controlling neurotransmitter release, plasticity processes, as well as memory and learning.  RIM contains an N-terminal zinc finger domain, a PDZ domain, and two C-terminal C2 domains (C2A, C2B).  C2 domains fold into an 8-standed beta-sandwich that can adopt 2 structural arrangements: Type I and Type II, distinguished by a circular permutation involving their N- and C-terminal beta strands. Many C2 domains are Ca2+-dependent membrane-targeting modules that bind a wide variety of substances including bind phospholipids, inositol polyphosphates, and intracellular proteins.  Most C2 domain proteins are either signal transduction enzymes that contain a single C2 domain, such as protein kinase C, or membrane trafficking proteins which contain at least two C2 domains, such as
Probab=82.92  E-value=2.4  Score=32.79  Aligned_cols=42  Identities=21%  Similarity=0.072  Sum_probs=33.6

Q ss_pred             CCceEEEeeee-ceeeccCCeeeeeeeeeccchhccceeeeEE
Q psy12064         81 LEFFELHICVK-DYCFARDDRLVGVAVLQLKDIVEQVKHQICV  122 (148)
Q Consensus        81 p~~yEL~~~VK-DYCFar~Dr~vG~av~qL~~iAeKGScalcV  122 (148)
                      +..-.|+++|. ||=+.+.|..+|.+.++|.++.-.+....|.
T Consensus        92 l~~~~L~v~V~~d~~~~~~~~~iG~~~i~L~~l~~~~~~~~Wy  134 (146)
T cd04028          92 PTGKTLQVIVWGDYGRMDKKVFMGVAQILLDDLDLSNLVIGWY  134 (146)
T ss_pred             CCCCEEEEEEEeCCCCCCCCceEEEEEEEcccccCCCCceeEE
Confidence            67789999999 7877778889999999999985555555443


No 33 
>cd08680 C2_Kibra C2 domain found in Human protein Kibra. Kibra is thought to be a regulator of the Salvador (Sav)/Warts (Wts)/Hippo (Hpo) (SWH) signaling network, which limits tissue growth by inhibiting cell proliferation and promoting apoptosis. The core of the pathway consists of a MST and LATS family kinase cascade that ultimately phosphorylates and inactivates the YAP/Yorkie (Yki) transcription coactivator. The FERM domain proteins Merlin (Mer) and Expanded (Ex) are part of the upstream regulation controlling pathway mechanism.  Kibra colocalizes and associates with Mer and Ex and is thought to transduce an extracellular signal via the SWH network. The apical scaffold machinery that contains Hpo, Wts, and Ex recruits Yki to the apical membrane facilitating its inhibitory phosphorlyation by Wts.  Since Kibra associates with Ex and is apically located it is hypothesized that KIBRA is part of the scaffold, helps in the Hpo/Wts complex, and helps recruit Yki for inactivation that prom
Probab=82.46  E-value=1.3  Score=33.00  Aligned_cols=37  Identities=19%  Similarity=0.151  Sum_probs=30.7

Q ss_pred             CCCCceEEEeeeeceeeccCCeeeeeeeeeccchhcc
Q psy12064         79 EQLEFFELHICVKDYCFARDDRLVGVAVLQLKDIVEQ  115 (148)
Q Consensus        79 ~~p~~yEL~~~VKDYCFar~Dr~vG~av~qL~~iAeK  115 (148)
                      ++...-.|+++|.||=.-+.+..+|.+.++|.++-..
T Consensus        78 ~~L~~~~L~~~V~~~~~~~~~~~lG~~~i~L~~~~~~  114 (124)
T cd08680          78 TKLYQKTLQVDVCSVGPDQQEECLGGAQISLADFESS  114 (124)
T ss_pred             HHhhcCEEEEEEEeCCCCCceeEEEEEEEEhhhccCC
Confidence            4567779999999987777788999999999999433


No 34 
>cd04038 C2_ArfGAP C2 domain present in Arf GTPase Activating Proteins (GAP). ArfGAP is a GTPase activating protein which regulates the ADP ribosylation factor Arf, a member of the Ras superfamily of GTP-binding proteins.  The GTP-bound form of Arf is involved in Golgi morphology and is involved in recruiting coat proteins.  ArfGAP is responsible for the GDP-bound form of Arf which is necessary for uncoating the membrane and allowing the Golgi to fuse with an acceptor compartment.  These proteins contain an N-terminal ArfGAP domain containing the characteristic zinc finger motif (Cys-x2-Cys-x(16,17)-x2-Cys) and C-terminal C2 domain. C2 domains were first identified in Protein Kinase C (PKC). C2 domains fold into an 8-standed beta-sandwich that can adopt 2 structural arrangements: Type I and Type II, distinguished by a circular permutation involving their N- and C-terminal beta strands. Many C2 domains are Ca2+-dependent membrane-targeting modules that bind a wide variety of substances i
Probab=81.62  E-value=4.1  Score=31.11  Aligned_cols=62  Identities=29%  Similarity=0.406  Sum_probs=45.0

Q ss_pred             ceEEEeeeeceeeccCCeeeeeeeeeccchhccceee----------e----EEeceeee-------cCCceeEEEEEee
Q psy12064         83 FFELHICVKDYCFARDDRLVGVAVLQLKDIVEQVKHQ----------I----CVKDYCFA-------RDDRLVGVAVLQL  141 (148)
Q Consensus        83 ~yEL~~~VKDYCFar~Dr~vG~av~qL~~iAeKGSca----------l----cVKDyCf~-------r~dr~vG~~vlql  141 (148)
                      .-.|.+.|.|+--...|.++|-+.+.|+++.+.....          +    --+|=|.+       -+|+++-=.+|+|
T Consensus        60 ~~~l~~~V~D~d~~~~dd~iG~a~i~l~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~~~~l~l  139 (145)
T cd04038          60 MAPLKLEVFDKDTFSKDDSMGEAEIDLEPLVEAAKLDHLRDTPGGTQIKKVLPSVENCLASESHITWKDGKIVQDLVLKL  139 (145)
T ss_pred             CCEEEEEEEECCCCCCCCEEEEEEEEHHHhhhhhhhhccccCCCCEEEEEEecCCCceEeccceEEEECCEEEEEEEEEe
Confidence            3458889999985555779999999999987654322          1    23456766       5677788888899


Q ss_pred             hhh
Q psy12064        142 KDI  144 (148)
Q Consensus       142 ~~i  144 (148)
                      +++
T Consensus       140 ~~~  142 (145)
T cd04038         140 RNV  142 (145)
T ss_pred             ccc
Confidence            886


No 35 
>cd08691 C2_NEDL1-like C2 domain present in NEDL1 (NEDD4-like ubiquitin protein ligase-1). NEDL1 (AKA  HECW1(HECT, C2 and WW domain containing E3 ubiquitin protein ligase 1)) is a newly identified HECT-type E3 ubiquitin protein ligase highly expressed in favorable neuroblastomas. In vertebrates it is found primarily in neuronal tissues, including the spinal cord. NEDL1 is thought to normally function in the quality control of cellular proteins by eliminating misfolded proteins.  This is thought to be accomplished via a mechanism analogous to that of ER-associated degradation by forming tight complexes and aggregating misfolded proteins that have escaped ubiquitin-mediated degradation.  NEDL1, is composed of a C2 domain, two WW domains, and a ubiquitin ligase Hect domain. C2 domains fold into an 8-standed beta-sandwich that can adopt 2 structural arrangements: Type I and Type II, distinguished by a circular permutation involving their N- and C-terminal beta strands. Many C2 domains are C
Probab=81.04  E-value=2.7  Score=31.87  Aligned_cols=44  Identities=18%  Similarity=0.255  Sum_probs=33.3

Q ss_pred             EEEeeeeceeeccC---CeeeeeeeeeccchhccceeeeEEeceeeecC
Q psy12064         85 ELHICVKDYCFARD---DRLVGVAVLQLKDIVEQVKHQICVKDYCFARD  130 (148)
Q Consensus        85 EL~~~VKDYCFar~---Dr~vG~av~qL~~iAeKGScalcVKDyCf~r~  130 (148)
                      .|.+.|.||..-+.   |+.+|.+.++|.++.+......  ..+|+.-+
T Consensus        74 ~L~v~V~D~~~~~~~~~~d~lG~~~i~l~~l~~~~~~~~--~~~~~~l~  120 (137)
T cd08691          74 VLEIEVKDKFAKSRPIIRRFLGKLSIPVQRLLERHAIGD--QELSYTLG  120 (137)
T ss_pred             EEEEEEEecCCCCCccCCceEEEEEEEHHHhcccccCCc--eEEEEECC
Confidence            79999999976433   8999999999999987754432  44566433


No 36 
>cd00275 C2_PLC_like C2 domain present in Phosphoinositide-specific phospholipases C (PLC). PLCs are involved in the hydrolysis of phosphatidylinositol-4,5-bisphosphate (PIP2) to d-myo-inositol-1,4,5-trisphosphate (1,4,5-IP3) and sn-1,2-diacylglycerol (DAG).   1,4,5-IP3 and DAG are second messengers in eukaryotic signal transduction cascades. PLC is composed of a N-terminal PH domain followed by a series of EF hands, a catalytic TIM barrel and a C-terminal C2 domain. C2 domains fold into an 8-standed beta-sandwich that can adopt 2 structural arrangements: Type I and Type II, distinguished by a circular permutation involving their N- and C-terminal beta strands. Many C2 domains are Ca2+-dependent membrane-targeting modules that bind a wide variety of substances including bind phospholipids, inositol polyphosphates, and intracellular proteins.  Most C2 domain proteins are either signal transduction enzymes that contain a single C2 domain, such as protein kinase C, or membrane trafficking 
Probab=81.01  E-value=4.1  Score=28.47  Aligned_cols=43  Identities=28%  Similarity=0.272  Sum_probs=32.1

Q ss_pred             CCCceEEEeeeeceeeccCCeeeeeeeeeccchhccceeeeEEec
Q psy12064         80 QLEFFELHICVKDYCFARDDRLVGVAVLQLKDIVEQVKHQICVKD  124 (148)
Q Consensus        80 ~p~~yEL~~~VKDYCFar~Dr~vG~av~qL~~iAeKGScalcVKD  124 (148)
                      .|+.=.|.+.|.|+... .|.++|.+.++|+++ +.|+-.+..+|
T Consensus        68 ~~~~~~l~~~V~d~~~~-~~~~iG~~~~~l~~l-~~g~~~~~l~~  110 (128)
T cd00275          68 VPELAFLRFVVYDEDSG-DDDFLGQACLPLDSL-RQGYRHVPLLD  110 (128)
T ss_pred             CCCeEEEEEEEEeCCCC-CCcEeEEEEEEhHHh-cCceEEEEecC
Confidence            34433588899999877 778999999999998 45665555544


No 37 
>cd04015 C2_plant_PLD C2 domain present in plant phospholipase D (PLD). PLD hydrolyzes terminal phosphodiester bonds in diester glycerophospholipids resulting in the degradation of phospholipids.  In vitro PLD transfers phosphatidic acid to primary alcohols.  In plants PLD plays a role in germination, seedling growth, phosphatidylinositol metabolism, and changes in phospholipid composition.  There is a single Ca(2+)/phospholipid-binding C2 domain in PLD. C2 domains fold into an 8-standed beta-sandwich that can adopt 2 structural arrangements: Type I and Type II, distinguished by a circular permutation involving their N- and C-terminal beta strands. Many C2 domains are Ca2+-dependent membrane-targeting modules that bind a wide variety of substances including bind phospholipids, inositol polyphosphates, and intracellular proteins.  Most C2 domain proteins are either signal transduction enzymes that contain a single C2 domain, such as protein kinase C, or membrane trafficking proteins whic
Probab=79.63  E-value=2.9  Score=31.97  Aligned_cols=34  Identities=21%  Similarity=0.340  Sum_probs=27.2

Q ss_pred             EEEeeeeceeeccCCeeeeeeeeeccchhccceee
Q psy12064         85 ELHICVKDYCFARDDRLVGVAVLQLKDIVEQVKHQ  119 (148)
Q Consensus        85 EL~~~VKDYCFar~Dr~vG~av~qL~~iAeKGSca  119 (148)
                      .|.+.|||+-... |.+||.+.++|.++...+...
T Consensus        99 ~l~~~V~d~d~~~-~~~IG~~~i~l~~l~~g~~~~  132 (158)
T cd04015          99 HVEFTVKDNDVVG-AQLIGRAYIPVEDLLSGEPVE  132 (158)
T ss_pred             EEEEEEEeCCCcC-CcEEEEEEEEhHHccCCCCcc
Confidence            6888999987664 569999999999998755543


No 38 
>cd08401 C2A_RasA2_RasA3 C2 domain first repeat present in RasA2 and RasA3. RasA2 and RasA3 are GAP1s (GTPase activating protein 1s ), Ras-specific GAP members, which suppresses Ras function by enhancing the GTPase activity of Ras proteins resulting in the inactive GDP-bound form of Ras. In this way it can control cellular proliferation and differentiation.  RasA2 and RasA3 are both inositol 1,3,4,5-tetrakisphosphate-binding proteins and contain an N-terminal C2 domain, a Ras-GAP domain, a pleckstrin-homology (PH) domain which localizes it to the plasma membrane, and Bruton's Tyrosine Kinase (BTK) a zinc binding domain. C2 domains fold into an 8-standed beta-sandwich that can adopt 2 structural arrangements: Type I and Type II, distinguished by a circular permutation involving their N- and C-terminal beta strands. Many C2 domains are Ca2+-dependent membrane-targeting modules that bind a wide variety of substances including bind phospholipids, inositol polyphosphates, and intracellular p
Probab=79.33  E-value=8.9  Score=27.74  Aligned_cols=39  Identities=18%  Similarity=0.284  Sum_probs=32.3

Q ss_pred             ceEEEeeeeceeeccCCeeeeeeeeeccchhccceeeeE
Q psy12064         83 FFELHICVKDYCFARDDRLVGVAVLQLKDIVEQVKHQIC  121 (148)
Q Consensus        83 ~yEL~~~VKDYCFar~Dr~vG~av~qL~~iAeKGScalc  121 (148)
                      ...|+++|.|+=-.+.|..+|.+.++|.++...+....|
T Consensus        61 ~~~l~~~v~d~~~~~~~~~iG~~~i~l~~l~~~~~~~~w   99 (121)
T cd08401          61 FRHLSFYIYDRDVLRRDSVIGKVAIKKEDLHKYYGKDTW   99 (121)
T ss_pred             CCEEEEEEEECCCCCCCceEEEEEEEHHHccCCCCcEee
Confidence            468999999988888899999999999999876654433


No 39 
>cd04021 C2_E3_ubiquitin_ligase C2 domain present in E3 ubiquitin ligase. E3 ubiquitin ligase is part of the ubiquitylation mechanism responsible for controlling surface expression of membrane proteins.  The sequential action of several enzymes are involved: ubiquitin-activating enzyme E1, ubiquitin-conjugating enzyme E2, and ubiquitin-protein ligase E3 which is responsible for substrate recognition and promoting the transfer of ubiquitin to the target protein.  E3 ubiquitin ligase is composed of an N-terminal C2 domain, 4 WW domains, and a HECTc domain.  C2 domains fold into an 8-standed beta-sandwich that can adopt 2 structural arrangements: Type I and Type II, distinguished by a circular permutation involving their N- and C-terminal beta strands. Many C2 domains are Ca2+-dependent membrane-targeting modules that bind a wide variety of substances including bind phospholipids, inositol polyphosphates, and intracellular proteins.  Most C2 domain proteins are either signal transduction e
Probab=78.06  E-value=9.1  Score=27.69  Aligned_cols=47  Identities=23%  Similarity=0.239  Sum_probs=35.9

Q ss_pred             EEEeeeeceeeccCCeeeeeeeeeccchhcc--ceeeeEEeceeeecCC
Q psy12064         85 ELHICVKDYCFARDDRLVGVAVLQLKDIVEQ--VKHQICVKDYCFARDD  131 (148)
Q Consensus        85 EL~~~VKDYCFar~Dr~vG~av~qL~~iAeK--GScalcVKDyCf~r~d  131 (148)
                      +|++.|.|+=-.+.|..+|-+.++|.++...  |...-..+.+-..+..
T Consensus        62 ~l~~~V~d~~~~~~~~~iG~~~i~l~~l~~~~~~~~~~~~~~~~~~~~~  110 (125)
T cd04021          62 TLEFKVWSHHTLKADVLLGEASLDLSDILKNHNGKLENVKLTLNLSSEN  110 (125)
T ss_pred             EEEEEEEeCCCCCCCcEEEEEEEEHHHhHhhcCCCccceEEEEEEEccC
Confidence            6888899998888999999999999999865  4555444555555444


No 40 
>cd04039 C2_PSD C2 domain present in Phosphatidylserine decarboxylase (PSD). PSD is involved in the biosynthesis of aminophospholipid by converting phosphatidylserine (PtdSer) to phosphatidylethanolamine (PtdEtn). There is a single C2 domain present and it is thought to confer PtdSer binding motif that is common to PKC and synaptotagmin. C2 domains fold into an 8-standed beta-sandwich that can adopt 2 structural arrangements: Type I and Type II, distinguished by a circular permutation involving their N- and C-terminal beta strands. Many C2 domains are Ca2+-dependent membrane-targeting modules that bind a wide variety of substances including bind phospholipids, inositol polyphosphates, and intracellular proteins.  Most C2 domain proteins are either signal transduction enzymes that contain a single C2 domain, such as protein kinase C, or membrane trafficking proteins which contain at least two C2 domains, such as synaptotagmin 1.  However, there are a few exceptions to this including RIM 
Probab=77.19  E-value=3.1  Score=29.79  Aligned_cols=34  Identities=15%  Similarity=0.210  Sum_probs=26.2

Q ss_pred             CceEEEeeeeceeeccCCeeeeeeeeeccchhcc
Q psy12064         82 EFFELHICVKDYCFARDDRLVGVAVLQLKDIVEQ  115 (148)
Q Consensus        82 ~~yEL~~~VKDYCFar~Dr~vG~av~qL~~iAeK  115 (148)
                      ....|.+.|.||=-...|.++|-+.++|+++.+.
T Consensus        65 ~~~~L~~~V~D~d~~~~dd~IG~~~l~L~~l~~~   98 (108)
T cd04039          65 KNFDIQFKVLDKDKFSFNDYVATGSLSVQELLNA   98 (108)
T ss_pred             CCCEEEEEEEECCCCCCCcceEEEEEEHHHHHhh
Confidence            3467888888886666788888888888888654


No 41 
>cd04014 C2_PKC_epsilon C2 domain in Protein Kinase C (PKC) epsilon. A single C2 domain is found in PKC epsilon. The PKC family of serine/threonine kinases regulates apoptosis, proliferation, migration, motility, chemo-resistance, and differentiation.  There are 3 groups: group 1 (alpha, betaI, beta II, gamma) which require phospholipids and calcium, group 2 (delta, epsilon, theta, eta) which do not require calcium for activation, and group 3 (xi, iota/lambda) which are atypical and can be activated in the absence of diacylglycerol and calcium. C2 domains fold into an 8-standed beta-sandwich that can adopt 2 structural arrangements: Type I and Type II, distinguished by a circular permutation involving their N- and C-terminal beta strands. Many C2 domains are Ca2+-dependent membrane-targeting modules that bind a wide variety of substances including bind phospholipids, inositol polyphosphates, and intracellular proteins.  Most C2 domain proteins are either signal transduction enzymes that
Probab=76.13  E-value=4.6  Score=29.08  Aligned_cols=47  Identities=15%  Similarity=0.248  Sum_probs=33.7

Q ss_pred             eEEEeeeeceeeccCCeeeeeeeeeccchhcc--ceeeeEEeceeeecCCce
Q psy12064         84 FELHICVKDYCFARDDRLVGVAVLQLKDIVEQ--VKHQICVKDYCFARDDRL  133 (148)
Q Consensus        84 yEL~~~VKDYCFar~Dr~vG~av~qL~~iAeK--GScalcVKDyCf~r~dr~  133 (148)
                      -.|+++|.|+--...|.++|.+.++|.++...  +....|+   ..-+.+++
T Consensus        74 ~~l~~~v~d~~~~~~~~~iG~~~i~l~~l~~~~~~~~~~w~---~L~~~G~l  122 (132)
T cd04014          74 RNLELTVFHDAAIGPDDFVANCTISFEDLIQRGSGSFDLWV---DLEPQGKL  122 (132)
T ss_pred             CEEEEEEEeCCCCCCCceEEEEEEEhHHhcccCCCcccEEE---EccCCcEE
Confidence            47889998887667889999999999999873  3444333   23345544


No 42 
>cd04044 C2A_Tricalbin-like C2 domain first repeat present in Tricalbin-like proteins. 5 to 6 copies of the C2 domain are present in Tricalbin, a yeast homolog of Synaptotagmin, which is involved in membrane trafficking and sorting.  C2 domains fold into an 8-standed beta-sandwich that can adopt 2 structural arrangements: Type I and Type II, distinguished by a circular permutation involving their N- and C-terminal beta strands. Many C2 domains are Ca2+-dependent membrane-targeting modules that bind a wide variety of substances including bind phospholipids, inositol polyphosphates, and intracellular proteins.  Most C2 domain proteins are either signal transduction enzymes that contain a single C2 domain, such as protein kinase C, or membrane trafficking proteins which contain at least two C2 domains, such as synaptotagmin 1.  However, there are a few exceptions to this including RIM isoforms and some splice variants of piccolo/aczonin and intersectin which only have a single C2 domain.  
Probab=74.93  E-value=4.2  Score=28.21  Aligned_cols=33  Identities=24%  Similarity=0.448  Sum_probs=28.5

Q ss_pred             cceeeeEEeceeeecCCceeEEEEEeehhhhhc
Q psy12064        115 QVKHQICVKDYCFARDDRLVGVAVLQLKDIVEQ  147 (148)
Q Consensus       115 KGScalcVKDyCf~r~dr~vG~~vlql~~i~~~  147 (148)
                      ...+.+.|.|+--...|.++|.+.++|.+++++
T Consensus        64 ~~~l~~~v~d~~~~~~d~~iG~~~~~l~~l~~~   96 (124)
T cd04044          64 TEPLNLTVYDFNDKRKDKLIGTAEFDLSSLLQN   96 (124)
T ss_pred             CCEEEEEEEecCCCCCCceeEEEEEEHHHhccC
Confidence            457888888988778899999999999999865


No 43 
>cd08678 C2_C21orf25-like C2 domain found in the Human chromosome 21 open reading frame 25 (C21orf25) protein. The members in this cd are named after the Human C21orf25 which contains a single C2 domain.  Several other members contain a C1 domain downstream of the C2 domain.  No other information on this protein is currently known. The C2 domain was first identified in PKC. C2 domains fold into an 8-standed beta-sandwich that can adopt 2 structural arrangements: Type I and Type II, distinguished by a circular permutation involving their N- and C-terminal beta strands. Many C2 domains are Ca2+-dependent membrane-targeting modules that bind a wide variety of substances including bind phospholipids, inositol polyphosphates, and intracellular proteins.  Most C2 domain proteins are either signal transduction enzymes that contain a single C2 domain, such as protein kinase C, or membrane trafficking proteins which contain at least two C2 domains, such as synaptotagmin 1.  However, there are a 
Probab=73.73  E-value=16  Score=26.19  Aligned_cols=58  Identities=17%  Similarity=0.261  Sum_probs=40.5

Q ss_pred             CCCceEEEeeeeceeeccCCeeeeeeeeeccchhccceeeeEEeceeeecC------CceeEEEEEeeh
Q psy12064         80 QLEFFELHICVKDYCFARDDRLVGVAVLQLKDIVEQVKHQICVKDYCFARD------DRLVGVAVLQLK  142 (148)
Q Consensus        80 ~p~~yEL~~~VKDYCFar~Dr~vG~av~qL~~iAeKGScalcVKDyCf~r~------dr~vG~~vlql~  142 (148)
                      .++.-+|.+.|-|+=-.+.|..+|-+.++|+++.......-     +|-..      ....|--.++++
T Consensus        55 ~~~~~~l~~~v~d~~~~~~~~~lG~~~i~l~~l~~~~~~~~-----~~~L~~~~~~~~~~~G~l~l~~~  118 (126)
T cd08678          55 SPNSKELLFEVYDNGKKSDSKFLGLAIVPFDELRKNPSGRQ-----IFPLQGRPYEGDSVSGSITVEFL  118 (126)
T ss_pred             CCCCCEEEEEEEECCCCCCCceEEEEEEeHHHhccCCceeE-----EEEecCCCCCCCCcceEEEEEEE
Confidence            34456899999888666789999999999999987655432     33333      335666655554


No 44 
>cd08376 C2B_MCTP_PRT C2 domain second repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP). MCTPs are involved in Ca2+ signaling at the membrane.  MCTP is composed of a variable N-terminal sequence, three C2 domains, two transmembrane regions (TMRs), and a short C-terminal sequence.  It is one of four protein classes that are anchored to membranes via a transmembrane region; the others being synaptotagmins, extended synaptotagmins, and ferlins. MCTPs are the only membrane-bound C2 domain proteins that contain two functional TMRs. MCTPs are unique in that they bind Ca2+ but not phospholipids. C2 domains fold into an 8-standed beta-sandwich that can adopt 2 structural arrangements: Type I and Type II, distinguished by a circular permutation involving their N- and C-terminal beta strands. Many C2 domains are Ca2+-dependent membrane-targeting modules that bind a wide variety of substances including bind phospholipids, inositol polyphosphates, and intracellular protei
Probab=73.37  E-value=7.9  Score=26.89  Aligned_cols=40  Identities=20%  Similarity=0.239  Sum_probs=31.3

Q ss_pred             ceEEEeeeeceeeccCCeeeeeeeeeccchhccceeeeEE
Q psy12064         83 FFELHICVKDYCFARDDRLVGVAVLQLKDIVEQVKHQICV  122 (148)
Q Consensus        83 ~yEL~~~VKDYCFar~Dr~vG~av~qL~~iAeKGScalcV  122 (148)
                      .-.|.+.|-|+---..|..+|.+.++|.++........|+
T Consensus        60 ~~~l~v~v~d~~~~~~~~~iG~~~~~l~~l~~~~~~~~w~   99 (116)
T cd08376          60 SQILEIEVWDKDTGKKDEFIGRCEIDLSALPREQTHSLEL   99 (116)
T ss_pred             CCEEEEEEEECCCCCCCCeEEEEEEeHHHCCCCCceEEEE
Confidence            4467788878766678999999999999998777665443


No 45 
>cd08393 C2A_SLP-1_2 C2 domain first repeat present in Synaptotagmin-like proteins 1 and 2. All Slp members basically share an N-terminal Slp homology domain (SHD) and C-terminal tandem C2 domains (named the C2A domain and the C2B domain) with the SHD and C2 domains being separated by a linker sequence of various length.  Slp1/JFC1 and Slp2/exophilin 4 promote granule docking to the plasma membrane.  Additionally, their C2A domains are both Ca2+ independent, unlike Slp3 and Slp4/granuphilin which are Ca2+ dependent.  It is thought that SHD (except for the Slp4-SHD) functions as a specific Rab27A/B-binding domain.  In addition to Slps, rabphilin, Noc2, and  Munc13-4 also function as Rab27-binding proteins.  C2 domains fold into an 8-standed beta-sandwich that can adopt 2 structural arrangements: Type I and Type II, distinguished by a circular permutation involving their N- and C-terminal beta strands. Many C2 domains are Ca2+-dependent membrane-targeting modules that bind a wide variety 
Probab=73.15  E-value=4.4  Score=29.36  Aligned_cols=41  Identities=12%  Similarity=-0.017  Sum_probs=31.2

Q ss_pred             CCceEEEeeeeceeeccCCeeeeeeeeeccchhccceeeeE
Q psy12064         81 LEFFELHICVKDYCFARDDRLVGVAVLQLKDIVEQVKHQIC  121 (148)
Q Consensus        81 p~~yEL~~~VKDYCFar~Dr~vG~av~qL~~iAeKGScalc  121 (148)
                      ...-.|++.|+||=-.+.|..+|-+.++|+++.-......|
T Consensus        81 l~~~~L~~~V~d~~~~~~~~~iG~~~i~L~~~~~~~~~~~W  121 (125)
T cd08393          81 LPTRVLNLSVWHRDSLGRNSFLGEVEVDLGSWDWSNTQPTW  121 (125)
T ss_pred             hCCCEEEEEEEeCCCCCCCcEeEEEEEecCccccCCCCcce
Confidence            44568999999987667788999999999998555444433


No 46 
>cd04016 C2_Tollip C2 domain present in Toll-interacting protein (Tollip). Tollip is a part of the Interleukin-1 receptor (IL-1R) signaling pathway. Tollip is proposed to link serine/threonine kinase IRAK to IL-1Rs as well as inhibiting phosphorylation of IRAK. There is a single C2 domain present in Tollip. C2 domains fold into an 8-standed beta-sandwich that can adopt 2 structural arrangements: Type I and Type II, distinguished by a circular permutation involving their N- and C-terminal beta strands. Many C2 domains are Ca2+-dependent membrane-targeting modules that bind a wide variety of substances including bind phospholipids, inositol polyphosphates, and intracellular proteins.  Most C2 domain proteins are either signal transduction enzymes that contain a single C2 domain, such as protein kinase C, or membrane trafficking proteins which contain at least two C2 domains, such as synaptotagmin 1.  However, there are a few exceptions to this including RIM isoforms and some splice varian
Probab=72.94  E-value=12  Score=27.78  Aligned_cols=36  Identities=11%  Similarity=-0.045  Sum_probs=29.5

Q ss_pred             CceEEEeeeeceeeccCCeeeeeeeeeccchhccce
Q psy12064         82 EFFELHICVKDYCFARDDRLVGVAVLQLKDIVEQVK  117 (148)
Q Consensus        82 ~~yEL~~~VKDYCFar~Dr~vG~av~qL~~iAeKGS  117 (148)
                      +..+|++.|+|+=-...|.++|.+.++|.+....|+
T Consensus        60 ~~~~l~~~V~d~d~~~~dd~iG~~~i~l~~~~~~g~   95 (121)
T cd04016          60 GVDSIYIEIFDERAFTMDERIAWTHITIPESVFNGE   95 (121)
T ss_pred             CCcEEEEEEEeCCCCcCCceEEEEEEECchhccCCC
Confidence            457899999998877789999999999976444564


No 47 
>cd04036 C2_cPLA2 C2 domain present in cytosolic PhosphoLipase A2 (cPLA2). A single copy of the C2 domain is present in cPLA2 which releases arachidonic acid from membranes initiating the biosynthesis of potent inflammatory mediators such as prostaglandins, leukotrienes, and platelet-activating factor.  C2 domains fold into an 8-standed beta-sandwich that can adopt 2 structural arrangements: Type I and Type II, distinguished by a circular permutation involving their N- and C-terminal beta strands. Many C2 domains are Ca2+-dependent membrane-targeting modules that bind a wide variety of substances including bind phospholipids, inositol polyphosphates, and intracellular proteins.  Most C2 domain proteins are either signal transduction enzymes that contain a single C2 domain, such as protein kinase C, or membrane trafficking proteins which contain at least two C2 domains, such as synaptotagmin 1.  However, there are a few exceptions to this including RIM isoforms and some splice variants o
Probab=72.40  E-value=6.1  Score=27.84  Aligned_cols=33  Identities=18%  Similarity=0.218  Sum_probs=26.9

Q ss_pred             eEEEeeeeceeeccCCeeeeeeeeeccchhccce
Q psy12064         84 FELHICVKDYCFARDDRLVGVAVLQLKDIVEQVK  117 (148)
Q Consensus        84 yEL~~~VKDYCFar~Dr~vG~av~qL~~iAeKGS  117 (148)
                      -.|++.|+|+=.. .|.++|-+.++|.++.....
T Consensus        64 ~~l~v~v~d~d~~-~~~~iG~~~~~l~~l~~g~~   96 (119)
T cd04036          64 NVLELTVMDEDYV-MDDHLGTVLFDVSKLKLGEK   96 (119)
T ss_pred             CEEEEEEEECCCC-CCcccEEEEEEHHHCCCCCc
Confidence            3589999998666 78899999999999876544


No 48 
>cd04029 C2A_SLP-4_5 C2 domain first repeat present in Synaptotagmin-like proteins 4 and 5. All Slp members basically share an N-terminal Slp homology domain (SHD) and C-terminal tandem C2 domains (named the C2A domain and the C2B domain) with the SHD and C2 domains being separated by a linker sequence of various length. SHD of Slp (except for the Slp4-SHD) function as a specific Rab27A/B-binding domain.  In addition to Slp, rabphilin, Noc2, and  Munc13-4 also function as Rab27-binding proteins. It has been demonstrated that Slp4/granuphilin promotes dense-core vesicle exocytosis. The C2A domain of Slp4 is Ca2+ dependent. Slp5 mRNA has been shown to be restricted to human placenta and liver suggesting a role in Rab27A-dependent membrane trafficking in specific tissues. C2 domains fold into an 8-standed beta-sandwich that can adopt 2 structural arrangements: Type I and Type II, distinguished by a circular permutation involving their N- and C-terminal beta strands. Many C2 domains are Ca2
Probab=71.65  E-value=6.5  Score=28.60  Aligned_cols=40  Identities=20%  Similarity=0.257  Sum_probs=32.2

Q ss_pred             CceEEEeeeeceeeccCCeeeeeeeeeccchhccceeeeE
Q psy12064         82 EFFELHICVKDYCFARDDRLVGVAVLQLKDIVEQVKHQIC  121 (148)
Q Consensus        82 ~~yEL~~~VKDYCFar~Dr~vG~av~qL~~iAeKGScalc  121 (148)
                      ..-.|++.|.||=..+.|.++|-+.++|.++.-......|
T Consensus        82 ~~~~L~~~V~d~~~~~~~~~lG~~~i~l~~~~~~~~~~~w  121 (125)
T cd04029          82 ETRTLQLSVWHYDRFGRNTFLGEVEIPLDSWNFDSQHEEC  121 (125)
T ss_pred             CCCEEEEEEEECCCCCCCcEEEEEEEeCCcccccCCcccE
Confidence            3446999999998778888999999999999766665544


No 49 
>cd08688 C2_KIAA0528-like C2 domain found in the Human KIAA0528 cDNA clone. The members of this CD are named after the Human KIAA0528 cDNA clone.  All members here contain a single C2 repeat.  No other information on this protein is currently known. The C2 domain was first identified in PKC.  C2 domains fold into an 8-standed beta-sandwich that can adopt 2 structural arrangements: Type I and Type II, distinguished by a circular permutation involving their N- and C-terminal beta strands. Many C2 domains are Ca2+-dependent membrane-targeting modules that bind a wide variety of substances including bind phospholipids, inositol polyphosphates, and intracellular proteins.  Most C2 domain proteins are either signal transduction enzymes that contain a single C2 domain, such as protein kinase C, or membrane trafficking proteins which contain at least two C2 domains, such as synaptotagmin 1.  However, there are a few exceptions to this including RIM isoforms and some splice variants of piccolo/a
Probab=71.09  E-value=5.8  Score=27.86  Aligned_cols=33  Identities=18%  Similarity=0.152  Sum_probs=27.8

Q ss_pred             eEEEeeeeceeeccCCeeeeeeeeeccchhccc
Q psy12064         84 FELHICVKDYCFARDDRLVGVAVLQLKDIVEQV  116 (148)
Q Consensus        84 yEL~~~VKDYCFar~Dr~vG~av~qL~~iAeKG  116 (148)
                      -.|.+.|.|+-..+.|.++|-+.++|++++..+
T Consensus        64 ~~l~i~V~d~d~~~~~~~iG~~~~~l~~l~~~~   96 (110)
T cd08688          64 EPLQIRVMDHDTYSANDAIGKVYIDLNPLLLKD   96 (110)
T ss_pred             CeEEEEEEeCCCCCCCCceEEEEEeHHHhcccC
Confidence            368888989888888889999999999998853


No 50 
>cd08385 C2A_Synaptotagmin-1-5-6-9-10 C2A domain first repeat present in Synaptotagmins 1, 5, 6, 9, and 10. Synaptotagmin is a membrane-trafficking protein characterized by a N-terminal transmembrane region, a linker, and 2 C-terminal C2 domains. Synaptotagmin 1, a member of class 1 synaptotagmins, is located in the brain and endocranium and localized to the synaptic vesicles and secretory granules.  It functions as a Ca2+ sensor for fast exocytosis as do synaptotagmins 5, 6, and 10. It is distinguished from the other synaptotagmins by having an N-glycosylated N-terminus. Synaptotagmins 5, 6, and 10, members of class 3 synaptotagmins, are located primarily in the brain and localized to the active zone and plasma membrane.  They is distinguished from the other synaptotagmins by having disulfide bonds at its N-terminus.  Synaptotagmin 6 also regulates the acrosome reaction, a unique Ca2+-regulated exocytosis, in sperm. Synaptotagmin 9, a class 5 synaptotagmins, is located in the brain and
Probab=70.53  E-value=8.6  Score=27.10  Aligned_cols=40  Identities=15%  Similarity=0.022  Sum_probs=28.4

Q ss_pred             CceEEEeeeeceeeccCCeeeeeeeeeccchhccceeeeE
Q psy12064         82 EFFELHICVKDYCFARDDRLVGVAVLQLKDIVEQVKHQIC  121 (148)
Q Consensus        82 ~~yEL~~~VKDYCFar~Dr~vG~av~qL~~iAeKGScalc  121 (148)
                      ....|++.|.||=-.+.|.++|-+.++|.++.......-|
T Consensus        80 ~~~~l~~~V~d~d~~~~~~~lG~~~i~l~~~~~~~~~~~W  119 (124)
T cd08385          80 GNKTLVFSVYDFDRFSKHDLIGEVRVPLLTVDLGHVTEEW  119 (124)
T ss_pred             CCCEEEEEEEeCCCCCCCceeEEEEEecCcccCCCCcceE
Confidence            3457999999984335566999999999998654444433


No 51 
>cd04054 C2A_Rasal1_RasA4 C2 domain first repeat present in RasA1 and RasA4. Rasal1 and RasA4 are both members of GAP1 (GTPase activating protein 1).  Rasal1 responds to repetitive Ca2+ signals by associating with the plasma membrane and deactivating Ras. RasA4 suppresses Ras function by enhancing the GTPase activity of Ras proteins resulting in the inactive GDP-bound form of Ras. In this way it can control cellular proliferation and differentiation.  Both of these proteins contains two C2 domains, a Ras-GAP domain, a plextrin homology (PH)-like domain, and a Bruton's Tyrosine Kinase (BTK) zinc binding domain. C2 domains fold into an 8-standed beta-sandwich that can adopt 2 structural arrangements: Type I and Type II, distinguished by a circular permutation involving their N- and C-terminal beta strands. Many C2 domains are Ca2+-dependent membrane-targeting modules that bind a wide variety of substances including bind phospholipids, inositol polyphosphates, and intracellular proteins.  
Probab=69.75  E-value=15  Score=26.29  Aligned_cols=58  Identities=17%  Similarity=0.105  Sum_probs=38.4

Q ss_pred             eEEEeeeeceeeccCCeeeeeeeeeccchhcc-ceeeeEEeceeeecCCceeEEEEEee
Q psy12064         84 FELHICVKDYCFARDDRLVGVAVLQLKDIVEQ-VKHQICVKDYCFARDDRLVGVAVLQL  141 (148)
Q Consensus        84 yEL~~~VKDYCFar~Dr~vG~av~qL~~iAeK-GScalcVKDyCf~r~dr~vG~~vlql  141 (148)
                      -.|++.|.|+-....|..+|-+.+++.++... +....|+.---.-..+.+-|--.|++
T Consensus        61 ~~l~v~v~d~~~~~~d~~iG~~~~~~~~~~~~~~~~~~W~~L~~~~~~~~~~G~i~l~~  119 (121)
T cd04054          61 HTVSFYVLDEDTLSRDDVIGKVSLTREVISAHPRGIDGWMNLTEVDPDEEVQGEIHLEL  119 (121)
T ss_pred             CEEEEEEEECCCCCCCCEEEEEEEcHHHhccCCCCCCcEEECeeeCCCCccccEEEEEE
Confidence            47888899998888899999999999988754 23444443322223334455555444


No 52 
>cd04041 C2A_fungal C2 domain first repeat; fungal group. C2 domains were first identified in Protein Kinase C (PKC). C2 domains fold into an 8-standed beta-sandwich that can adopt 2 structural arrangements: Type I and Type II, distinguished by a circular permutation involving their N- and C-terminal beta strands. Many C2 domains are Ca2+-dependent membrane-targeting modules that bind a wide variety of substances including bind phospholipids, inositol polyphosphates, and intracellular proteins.  Most C2 domain proteins are either signal transduction enzymes that contain a single C2 domain, such as protein kinase C, or membrane trafficking proteins which contain at least two C2 domains, such as synaptotagmin 1.  However, there are a few exceptions to this including RIM isoforms and some splice variants of piccolo/aczonin and intersectin which only have a single C2 domain.  C2 domains with a calcium binding region have negatively charged residues, primarily aspartates, that serve as ligan
Probab=69.53  E-value=5  Score=28.21  Aligned_cols=34  Identities=21%  Similarity=0.125  Sum_probs=26.7

Q ss_pred             ceEEEeeeeceeeccCCeeeeeeeeeccchhccc
Q psy12064         83 FFELHICVKDYCFARDDRLVGVAVLQLKDIVEQV  116 (148)
Q Consensus        83 ~yEL~~~VKDYCFar~Dr~vG~av~qL~~iAeKG  116 (148)
                      ...|.+.|.|+=-...|.++|.+.++|++++..+
T Consensus        68 ~~~l~~~V~d~d~~~~dd~lG~~~i~l~~l~~~~  101 (111)
T cd04041          68 GERLSCRLWDSDRFTADDRLGRVEIDLKELIEDR  101 (111)
T ss_pred             CCEEEEEEEeCCCCCCCCcceEEEEEHHHHhcCC
Confidence            4578888888865566789999999999988654


No 53 
>cd04033 C2_NEDD4_NEDD4L C2 domain present in the Human neural precursor cell-expressed, developmentally down-regulated 4 (NEDD4) and NEDD4-like (NEDD4L/NEDD42). Nedd4 and Nedd4-2 are two of the nine members of the Human Nedd4 family.  All vertebrates appear to have both Nedd4 and Nedd4-2 genes. They are thought to participate in the regulation of epithelial Na+ channel (ENaC) activity. They also have identical specificity for ubiquitin conjugating enzymes (E2).  Nedd4 and Nedd4-2 are composed of a C2 domain, 2-4 WW domains, and a ubiquitin ligase Hect domain. Their WW domains can bind PPxY (PY) or LPSY motifs, and in vitro studies suggest that WW3 and WW4 of both proteins bind PY motifs in the key substrates, with WW3 generally exhibiting higher affinity. Most Nedd4 family members, especially Nedd4-2, also have multiple splice variants, which might play different roles in regulating their substrates. C2 domains fold into an 8-standed beta-sandwich that can adopt 2 structural arrangemen
Probab=69.50  E-value=6.3  Score=28.03  Aligned_cols=46  Identities=20%  Similarity=0.223  Sum_probs=35.1

Q ss_pred             ceEEEeeeeceeeccCCeeeeeeeeeccchhccce---eeeEEeceeee
Q psy12064         83 FFELHICVKDYCFARDDRLVGVAVLQLKDIVEQVK---HQICVKDYCFA  128 (148)
Q Consensus        83 ~yEL~~~VKDYCFar~Dr~vG~av~qL~~iAeKGS---calcVKDyCf~  128 (148)
                      .-.|.+.|.|+--...|.++|.+.+++.++...+.   +..-.+.|..-
T Consensus        66 ~~~l~~~v~d~~~~~~~~~iG~~~i~l~~l~~~~~~~~~~~~~~~~~l~  114 (133)
T cd04033          66 EHRLLFEVFDENRLTRDDFLGQVEVPLNNLPTETPGNERRYTFKDYLLR  114 (133)
T ss_pred             CCEEEEEEEECCCCCCCCeeEEEEEEHHHCCCcCccccccccchheeee
Confidence            45789999999888889999999999999986543   33445555544


No 54 
>cd04011 C2B_Ferlin C2 domain second repeat in Ferlin. Ferlins are involved in vesicle fusion events.  Ferlins and other proteins, such as Synaptotagmins, are implicated in facilitating the fusion process when cell membranes fuse together.  There are six known human Ferlins: Dysferlin (Fer1L1), Otoferlin (Fer1L2), Myoferlin (Fer1L3), Fer1L4, Fer1L5, and Fer1L6.  Defects in these genes can lead to a wide range of diseases including muscular dystrophy (dysferlin), deafness (otoferlin), and infertility (fer-1, fertilization factor-1).  Structurally they have 6 tandem C2 domains, designated as (C2A-C2F) and a single C-terminal transmembrane domain, though there is a new study that disputes this and claims that there are actually 7 tandem C2 domains with another C2 domain inserted between C2D and C2E.   In a subset of them (Dysferlin, Myoferlin, and Fer1) there is an additional conserved domain called DysF. C2 domains fold into an 8-standed beta-sandwich that can adopt 2 structural arrangeme
Probab=69.24  E-value=8.3  Score=26.93  Aligned_cols=32  Identities=28%  Similarity=0.322  Sum_probs=26.6

Q ss_pred             eEEEeeeeceeeccCCeeeeeeeeeccchhcc
Q psy12064         84 FELHICVKDYCFARDDRLVGVAVLQLKDIVEQ  115 (148)
Q Consensus        84 yEL~~~VKDYCFar~Dr~vG~av~qL~~iAeK  115 (148)
                      =.|.+.|.|+--.+.|+++|.+.++|.++...
T Consensus        65 ~~l~i~V~d~~~~~~~~~iG~~~i~l~~v~~~   96 (111)
T cd04011          65 KIIKISVYDSRSLRSDTLIGSFKLDVGTVYDQ   96 (111)
T ss_pred             CeEEEEEEcCcccccCCccEEEEECCccccCC
Confidence            36888899987666799999999999999654


No 55 
>cd00276 C2B_Synaptotagmin C2 domain second repeat present in Synaptotagmin. Synaptotagmin is a membrane-trafficking protein characterized by a N-terminal transmembrane region, a linker, and 2 C-terminal C2 domains. There are several classes of Synaptotagmins. Previously all synaptotagmins were thought to be calcium sensors in the regulation of neurotransmitter release and hormone secretion, but it has been shown that not all of them bind calcium.  Of the 17 identified synaptotagmins only 8 bind calcium (1-3, 5-7, 9, 10).  The function of the two C2 domains that bind calcium are: regulating the fusion step of synaptic vesicle exocytosis (C2A) and  binding to phosphatidyl-inositol-3,4,5-triphosphate (PIP3) in the absence of calcium ions and to phosphatidylinositol bisphosphate (PIP2) in their presence (C2B).  C2B also regulates also the recycling step of synaptic vesicles. C2 domains fold into an 8-standed beta-sandwich that can adopt 2 structural arrangements: Type I and Type II, distin
Probab=68.90  E-value=6.1  Score=27.81  Aligned_cols=29  Identities=24%  Similarity=0.195  Sum_probs=24.6

Q ss_pred             ceEEEeeeeceeeccCCeeeeeeeeeccc
Q psy12064         83 FFELHICVKDYCFARDDRLVGVAVLQLKD  111 (148)
Q Consensus        83 ~yEL~~~VKDYCFar~Dr~vG~av~qL~~  111 (148)
                      .-.|.+.|.|+-..+.|+++|-+.++|.+
T Consensus        81 ~~~l~~~v~d~~~~~~~~~lG~~~i~l~~  109 (134)
T cd00276          81 EVSLVITVVDKDSVGRNEVIGQVVLGPDS  109 (134)
T ss_pred             CcEEEEEEEecCCCCCCceeEEEEECCCC
Confidence            45688889998877888999999999988


No 56 
>cd04009 C2B_Munc13-like C2 domain second repeat in Munc13 (mammalian uncoordinated)-like proteins. C2-like domains are thought to be involved in phospholipid binding in a Ca2+ independent manner in both Unc13 and Munc13. Caenorabditis elegans Unc13 has a central domain with sequence similarity to PKC, which includes C1 and C2-related domains. Unc13 binds phorbol esters and DAG with high affinity in a phospholipid manner.  Mutations in Unc13 results in abnormal neuronal connections and impairment in cholinergic neurotransmission in the nematode.  Munc13 is the mammalian homolog which are expressed in the brain.  There are 3 isoforms (Munc13-1, -2, -3) and are thought to play a role in neurotransmitter release and are hypothesized to be high-affinity receptors for phorbol esters.  Unc13 and Munc13 contain both C1 and C2 domains.  There are two C2 related domains present, one central and one at the carboxyl end.  Munc13-1 contains a third C2-like domain.  Munc13 interacts with syntaxin, s
Probab=68.55  E-value=6  Score=28.76  Aligned_cols=32  Identities=31%  Similarity=0.357  Sum_probs=27.7

Q ss_pred             cceeeeEEeceeeecCCceeEEEEEeehhhhh
Q psy12064        115 QVKHQICVKDYCFARDDRLVGVAVLQLKDIVE  146 (148)
Q Consensus       115 KGScalcVKDyCf~r~dr~vG~~vlql~~i~~  146 (148)
                      ...+.+.|.||-..+.|+++|.+.+.|+++.+
T Consensus        87 ~~~l~~~V~d~d~~~~d~~iG~~~i~l~~l~~  118 (133)
T cd04009          87 GALLLFTVKDYDLLGSNDFEGEAFLPLNDIPG  118 (133)
T ss_pred             CCEEEEEEEecCCCCCCcEeEEEEEeHHHCCc
Confidence            34678889999888899999999999999864


No 57 
>cd08392 C2A_SLP-3 C2 domain first repeat present in Synaptotagmin-like protein 3. All Slp members basically share an N-terminal Slp homology domain (SHD) and C-terminal tandem C2 domains (named the C2A domain and the C2B domain) with the SHD and C2 domains being separated by a linker sequence of various length. SHD of Slp (except for the Slp4-SHD) function as a specific Rab27A/B-binding domain.  In addition to Slp, rabphilin, Noc2, and  Munc13-4 also function as Rab27-binding proteins. Little is known about the expression or localization of Slp3.  The C2A domain of Slp3 is Ca2+ dependent.  It has been demonstrated that Slp3 promotes dense-core vesicle exocytosis.  C2 domains fold into an 8-standed beta-sandwich that can adopt 2 structural arrangements: Type I and Type II, distinguished by a circular permutation involving their N- and C-terminal beta strands. Many C2 domains are Ca2+-dependent membrane-targeting modules that bind a wide variety of substances including bind phospholipids
Probab=68.48  E-value=4.7  Score=29.78  Aligned_cols=33  Identities=18%  Similarity=0.195  Sum_probs=27.8

Q ss_pred             CCCceEEEeeeeceeeccCCeeeeeeeeeccch
Q psy12064         80 QLEFFELHICVKDYCFARDDRLVGVAVLQLKDI  112 (148)
Q Consensus        80 ~p~~yEL~~~VKDYCFar~Dr~vG~av~qL~~i  112 (148)
                      +.....|++.|.|+=-.+.|.++|.+.|+|.++
T Consensus        80 ~l~~~~L~v~V~~~~~~~~~~~lG~~~i~L~~~  112 (128)
T cd08392          80 LLSSRQLQVSVWHSRTLKRRVFLGEVLIPLADW  112 (128)
T ss_pred             HhCCcEEEEEEEeCCCCcCcceEEEEEEEcCCc
Confidence            345678999999987667788999999999988


No 58 
>cd04035 C2A_Rabphilin_Doc2 C2 domain first repeat present in Rabphilin and Double C2 domain. Rabphilin is found neurons and in neuroendrocrine cells, while Doc2 is found not only in the brain but in tissues, including mast cells, chromaffin cells, and osteoblasts.  Rabphilin and Doc2s share highly homologous tandem C2 domains, although their N-terminal structures are completely different: rabphilin contains an N-terminal Rab-binding domain (RBD),7 whereas Doc2 contains an N-terminal Munc13-1-interacting domain (MID). C2 domains fold into an 8-standed beta-sandwich that can adopt 2 structural arrangements: Type I and Type II, distinguished by a circular permutation involving their N- and C-terminal beta strands. Many C2 domains are Ca2+-dependent membrane-targeting modules that bind a wide variety of substances including bind phospholipids, inositol polyphosphates, and intracellular proteins.  Most C2 domain proteins are either signal transduction enzymes that contain a single C2 domain
Probab=67.25  E-value=9.8  Score=26.88  Aligned_cols=36  Identities=19%  Similarity=0.155  Sum_probs=28.6

Q ss_pred             ceEEEeeeeceeeccCCeeeeeeeeeccchhccceee
Q psy12064         83 FFELHICVKDYCFARDDRLVGVAVLQLKDIVEQVKHQ  119 (148)
Q Consensus        83 ~yEL~~~VKDYCFar~Dr~vG~av~qL~~iAeKGSca  119 (148)
                      ...|.+.|.|+-.. .|.++|-+.++|+++.....-.
T Consensus        83 ~~~l~~~v~d~~~~-~~~~iG~~~i~l~~l~~~~~~~  118 (123)
T cd04035          83 RKTLRLLVLDEDRF-GNDFLGETRIPLKKLKPNQTKQ  118 (123)
T ss_pred             CCEEEEEEEEcCCc-CCeeEEEEEEEcccCCCCcceE
Confidence            45788888898755 7889999999999997665443


No 59 
>cd08382 C2_Smurf-like C2 domain present in Smad ubiquitination-related factor (Smurf)-like proteins. A single C2 domain is found in Smurf proteins, C2-WW-HECT-domain E3s, which play an important role in the downregulation of the TGF-beta signaling pathway.  Smurf proteins also regulate cell shape, motility, and polarity by degrading small guanosine triphosphatases (GTPases). C2 domains fold into an 8-standed beta-sandwich that can adopt 2 structural arrangements: Type I and Type II, distinguished by a circular permutation involving their N- and C-terminal beta strands. Many C2 domains are Ca2+-dependent membrane-targeting modules that bind a wide variety of substances including bind phospholipids, inositol polyphosphates, and intracellular proteins.  Most C2 domain proteins are either signal transduction enzymes that contain a single C2 domain, such as protein kinase C, or membrane trafficking proteins which contain at least two C2 domains, such as synaptotagmin 1.  However, there are 
Probab=67.17  E-value=22  Score=25.42  Aligned_cols=33  Identities=18%  Similarity=0.264  Sum_probs=26.2

Q ss_pred             eEEEeeeecee-ecc-CCeeeeeeeeeccchhccc
Q psy12064         84 FELHICVKDYC-FAR-DDRLVGVAVLQLKDIVEQV  116 (148)
Q Consensus        84 yEL~~~VKDYC-Far-~Dr~vG~av~qL~~iAeKG  116 (148)
                      =.|.+.|.|+- |.+ +|..+|.+.+++.++.+..
T Consensus        60 ~~l~i~V~d~~~~~~~~d~~lG~~~i~l~~l~~~~   94 (123)
T cd08382          60 SIITIQVFDQKKFKKKDQGFLGCVRIRANAVLPLK   94 (123)
T ss_pred             CEEEEEEEECCCCCCCCCceEeEEEEEHHHccccC
Confidence            47888898885 343 4799999999999997654


No 60 
>cd04040 C2D_Tricalbin-like C2 domain fourth repeat present in Tricalbin-like proteins. 5 to 6 copies of the C2 domain are present in Tricalbin, a yeast homolog of Synaptotagmin, which is involved in membrane trafficking and sorting.  C2 domains fold into an 8-standed beta-sandwich that can adopt 2 structural arrangements: Type I and Type II, distinguished by a circular permutation involving their N- and C-terminal beta strands. Many C2 domains are Ca2+-dependent membrane-targeting modules that bind a wide variety of substances including bind phospholipids, inositol polyphosphates, and intracellular proteins.  Most C2 domain proteins are either signal transduction enzymes that contain a single C2 domain, such as protein kinase C, or membrane trafficking proteins which contain at least two C2 domains, such as synaptotagmin 1.  However, there are a few exceptions to this including RIM isoforms and some splice variants of piccolo/aczonin and intersectin which only have a single C2 domain. 
Probab=66.96  E-value=10  Score=26.14  Aligned_cols=40  Identities=23%  Similarity=0.305  Sum_probs=30.4

Q ss_pred             ceEEEeeeeceeeccCCeeeeeeeeeccchhccceeeeEE
Q psy12064         83 FFELHICVKDYCFARDDRLVGVAVLQLKDIVEQVKHQICV  122 (148)
Q Consensus        83 ~yEL~~~VKDYCFar~Dr~vG~av~qL~~iAeKGScalcV  122 (148)
                      .-.|.+.|.|+=-...|++||-+.+++.++........|+
T Consensus        60 ~~~l~~~v~d~~~~~~~~~iG~~~~~l~~l~~~~~~~~~~   99 (115)
T cd04040          60 RAVLKVEVYDWDRGGKDDLLGSAYIDLSDLEPEETTELTL   99 (115)
T ss_pred             CCEEEEEEEeCCCCCCCCceEEEEEEHHHcCCCCcEEEEE
Confidence            3467777888765578889999999999998766655444


No 61 
>cd08400 C2_Ras_p21A1 C2 domain present in RAS p21 protein activator 1 (RasA1). RasA1 is a GAP1 (GTPase activating protein 1), a Ras-specific GAP member, which suppresses Ras function by enhancing the GTPase activity of Ras proteins resulting in the inactive GDP-bound form of Ras.  In this way it can control cellular proliferation and differentiation.  RasA1 contains a C2 domain,  a Ras-GAP domain, a pleckstrin homology (PH)-like domain, a SH3 domain, and 2 SH2 domains. C2 domains fold into an 8-standed beta-sandwich that can adopt 2 structural arrangements: Type I and Type II, distinguished by a circular permutation involving their N- and C-terminal beta strands. Many C2 domains are Ca2+-dependent membrane-targeting modules that bind a wide variety of substances including bind phospholipids, inositol polyphosphates, and intracellular proteins.  Most C2 domain proteins are either signal transduction enzymes that contain a single C2 domain, such as protein kinase C, or membrane trafficki
Probab=66.56  E-value=11  Score=27.30  Aligned_cols=35  Identities=11%  Similarity=0.183  Sum_probs=29.1

Q ss_pred             EEEeeeeceeeccCCeeeeeeeeeccchhccceee
Q psy12064         85 ELHICVKDYCFARDDRLVGVAVLQLKDIVEQVKHQ  119 (148)
Q Consensus        85 EL~~~VKDYCFar~Dr~vG~av~qL~~iAeKGSca  119 (148)
                      .|++.|.|+-=...|..||.+.++|.++...+...
T Consensus        63 ~l~v~v~d~~~~~~d~~iG~v~i~l~~l~~~~~~~   97 (126)
T cd08400          63 SFTISLSNKAKRSKDSEIAEVTVQLSKLQNGQETD   97 (126)
T ss_pred             EEEEEEEECCCCCCCCeEEEEEEEHhHccCCCccc
Confidence            57788888876678999999999999998766654


No 62 
>cd04030 C2C_KIAA1228 C2 domain third repeat present in uncharacterized human KIAA1228-like proteins. KIAA proteins are uncharacterized human proteins. They were compiled by the Kazusa mammalian cDNA project which identified more than 2000 human genes. They are identified by 4 digit codes that precede the KIAA designation.  Many KIAA genes are still functionally uncharacterized including KIAA1228. C2 domains fold into an 8-standed beta-sandwich that can adopt 2 structural arrangements: Type I and Type II, distinguished by a circular permutation involving their N- and C-terminal beta strands. Many C2 domains are Ca2+-dependent membrane-targeting modules that bind a wide variety of substances including bind phospholipids, inositol polyphosphates, and intracellular proteins.  Most C2 domain proteins are either signal transduction enzymes that contain a single C2 domain, such as protein kinase C, or membrane trafficking proteins which contain at least two C2 domains, such as synaptotagmin 1
Probab=66.41  E-value=7.8  Score=27.25  Aligned_cols=32  Identities=22%  Similarity=0.463  Sum_probs=24.4

Q ss_pred             cceeeeEEece--eeecCCceeEEEEEeehhhhh
Q psy12064        115 QVKHQICVKDY--CFARDDRLVGVAVLQLKDIVE  146 (148)
Q Consensus       115 KGScalcVKDy--Cf~r~dr~vG~~vlql~~i~~  146 (148)
                      ...+.+.|+|+  .|.+.|+.+|.+.++|.++..
T Consensus        83 ~~~l~i~v~~~~~~~~~~~~~iG~~~i~l~~l~~  116 (127)
T cd04030          83 RRTLDVAVKNSKSFLSREKKLLGQVLIDLSDLDL  116 (127)
T ss_pred             CCEEEEEEEECCcccCCCCceEEEEEEecccccc
Confidence            35666666665  455789999999999999854


No 63 
>cd04037 C2E_Ferlin C2 domain fifth repeat in Ferlin. Ferlins are involved in vesicle fusion events.  Ferlins and other proteins, such as Synaptotagmins, are implicated in facilitating the fusion process when cell membranes fuse together.  There are six known human Ferlins: Dysferlin (Fer1L1), Otoferlin (Fer1L2), Myoferlin (Fer1L3), Fer1L4, Fer1L5, and Fer1L6.  Defects in these genes can lead to a wide range of diseases including muscular dystrophy (dysferlin), deafness (otoferlin), and infertility (fer-1, fertilization factor-1).  Structurally they have 6 tandem C2 domains, designated as (C2A-C2F) and a single C-terminal transmembrane domain, though there is a new study that disputes this and claims that there are actually 7 tandem C2 domains with another C2 domain inserted between C2D and C2E.   In a subset of them (Dysferlin, Myoferlin, and Fer1) there is an additional conserved domain called DysF. C2 domains fold into an 8-standed beta-sandwich that can adopt 2 structural arrangemen
Probab=66.11  E-value=9.4  Score=27.59  Aligned_cols=34  Identities=32%  Similarity=0.379  Sum_probs=26.6

Q ss_pred             CCCceEEEeeeeceeeccCCeeeeeeeeeccchh
Q psy12064         80 QLEFFELHICVKDYCFARDDRLVGVAVLQLKDIV  113 (148)
Q Consensus        80 ~p~~yEL~~~VKDYCFar~Dr~vG~av~qL~~iA  113 (148)
                      .|+.-.|.+.|.|+=....|+++|-+.++|++.-
T Consensus        59 ~~~~~~L~~~V~d~d~~~~dd~iG~~~i~l~~~~   92 (124)
T cd04037          59 LPGNSILKISVMDYDLLGSDDLIGETVIDLEDRF   92 (124)
T ss_pred             CCCCCEEEEEEEECCCCCCCceeEEEEEeecccc
Confidence            4556678888888877778888888888887764


No 64 
>cd04047 C2B_Copine C2 domain second repeat in Copine. There are 2 copies of the C2 domain present in copine, a protein involved in membrane trafficking, protein-protein interactions, and perhaps even cell division and growth.  C2 domains fold into an 8-standed beta-sandwich that can adopt 2 structural arrangements: Type I and Type II, distinguished by a circular permutation involving their N- and C-terminal beta strands. Many C2 domains are Ca2+-dependent membrane-targeting modules that bind a wide variety of substances including bind phospholipids, inositol polyphosphates, and intracellular proteins.  Most C2 domain proteins are either signal transduction enzymes that contain a single C2 domain, such as protein kinase C, or membrane trafficking proteins which contain at least two C2 domains, such as synaptotagmin 1.  However, there are a few exceptions to this including RIM isoforms and some splice variants of piccolo/aczonin and intersectin which only have a single C2 domain.  C2 dom
Probab=65.63  E-value=12  Score=25.83  Aligned_cols=32  Identities=22%  Similarity=0.277  Sum_probs=27.2

Q ss_pred             cceeeeEEeceeeecCCceeEEEEEeehhhhh
Q psy12064        115 QVKHQICVKDYCFARDDRLVGVAVLQLKDIVE  146 (148)
Q Consensus       115 KGScalcVKDyCf~r~dr~vG~~vlql~~i~~  146 (148)
                      ...+.+.|.||=-.+.|..+|.+.+.|++++.
T Consensus        69 ~~~l~~~V~d~d~~~~d~~iG~~~~~l~~l~~  100 (110)
T cd04047          69 DRPIKIEVYDYDSSGKHDLIGEFETTLDELLK  100 (110)
T ss_pred             CCEEEEEEEEeCCCCCCcEEEEEEEEHHHHhc
Confidence            35778888888877889999999999999874


No 65 
>cd04051 C2_SRC2_like C2 domain present in Soybean genes Regulated by Cold 2 (SRC2)-like proteins. SRC2 production is a response to pathogen infiltration.  The initial response of increased Ca2+ concentrations are coupled to downstream signal transduction pathways via calcium binding proteins.  SRC2 contains a single C2 domain which localizes to the plasma membrane and is involved in Ca2+ dependent protein binding. C2 domains fold into an 8-standed beta-sandwich that can adopt 2 structural arrangements: Type I and Type II, distinguished by a circular permutation involving their N- and C-terminal beta strands. Many C2 domains are Ca2+-dependent membrane-targeting modules that bind a wide variety of substances including bind phospholipids, inositol polyphosphates, and intracellular proteins.  Most C2 domain proteins are either signal transduction enzymes that contain a single C2 domain, such as protein kinase C, or membrane trafficking proteins which contain at least two C2 domains, such 
Probab=64.55  E-value=9.6  Score=26.90  Aligned_cols=33  Identities=24%  Similarity=0.279  Sum_probs=27.0

Q ss_pred             cceeeeEEeceeeecCCceeEEEEEeehhhhhc
Q psy12064        115 QVKHQICVKDYCFARDDRLVGVAVLQLKDIVEQ  147 (148)
Q Consensus       115 KGScalcVKDyCf~r~dr~vG~~vlql~~i~~~  147 (148)
                      ...+.+.|.|+.-...|+++|.+.+.|.++...
T Consensus        66 ~~~l~~~v~d~~~~~~~~~lG~~~i~l~~l~~~   98 (125)
T cd04051          66 RLALTIEVYCERPSLGDKLIGEVRVPLKDLLDG   98 (125)
T ss_pred             ccEEEEEEEECCCCCCCCcEEEEEEEHHHhhcc
Confidence            456777888887767899999999999998753


No 66 
>cd04024 C2A_Synaptotagmin-like C2 domain first repeat present in Synaptotagmin-like proteins. Synaptotagmin is a membrane-trafficking protein characterized by a N-terminal transmembrane region, a linker, and 2 C-terminal C2 domains. Previously all synaptotagmins were thought to be calcium sensors in the regulation of neurotransmitter release and hormone secretion, but it has been shown that not all of them bind calcium.  Of the 17 identified synaptotagmins only 8 bind calcium (1-3, 5-7, 9, 10).  The function of the two C2 domains that bind calcium are: regulating the fusion step of synaptic vesicle exocytosis (C2A) and  binding to phosphatidyl-inositol-3,4,5-triphosphate (PIP3) in the absence of calcium ions and to phosphatidylinositol bisphosphate (PIP2) in their presence (C2B).  C2B also regulates also the recycling step of synaptic vesicles. C2 domains fold into an 8-standed beta-sandwich that can adopt 2 structural arrangements: Type I and Type II, distinguished by a circular permu
Probab=63.80  E-value=11  Score=26.44  Aligned_cols=30  Identities=13%  Similarity=0.118  Sum_probs=24.5

Q ss_pred             EEEeeeeceeeccCCeeeeeeeeeccchhc
Q psy12064         85 ELHICVKDYCFARDDRLVGVAVLQLKDIVE  114 (148)
Q Consensus        85 EL~~~VKDYCFar~Dr~vG~av~qL~~iAe  114 (148)
                      .|.+.|.|+=-...|.++|.+.++|.++..
T Consensus        65 ~l~i~v~d~~~~~~~~~lG~~~i~l~~~~~   94 (128)
T cd04024          65 LLKLILWDKDRFAGKDYLGEFDIALEEVFA   94 (128)
T ss_pred             EEEEEEEECCCCCCCCcceEEEEEHHHhhc
Confidence            677777777655578899999999999984


No 67 
>cd04049 C2_putative_Elicitor-responsive_gene C2 domain present in the putative elicitor-responsive gene. In plants elicitor-responsive proteins are triggered in response to specific elicitor molecules such as glycolproteins, peptides, carbohydrates and lipids. A host of defensive responses are also triggered resulting in localized cell death.  Antimicrobial secondary metabolites, such as phytoalexins, or defense-related proteins, including pathogenesis-related (PR) proteins  are also produced.  There is a single C2 domain present here.  C2 domains fold into an 8-standed beta-sandwich that can adopt 2 structural arrangements: Type I and Type II, distinguished by a circular permutation involving their N- and C-terminal beta strands. Many C2 domains are Ca2+-dependent membrane-targeting modules that bind a wide variety of substances including bind phospholipids, inositol polyphosphates, and intracellular proteins.  Most C2 domain proteins are either signal transduction enzymes that contai
Probab=63.72  E-value=12  Score=26.46  Aligned_cols=32  Identities=28%  Similarity=0.379  Sum_probs=25.8

Q ss_pred             ceeeeEEeceeeecCCceeEEEEEeehhhhhc
Q psy12064        116 VKHQICVKDYCFARDDRLVGVAVLQLKDIVEQ  147 (148)
Q Consensus       116 GScalcVKDyCf~r~dr~vG~~vlql~~i~~~  147 (148)
                      ..+.+.|.|+--.+.|..+|.+.++|.++++.
T Consensus        66 ~~l~v~V~d~~~~~~d~~iG~~~i~l~~l~~~   97 (124)
T cd04049          66 TKLILRIMDKDNFSDDDFIGEATIHLKGLFEE   97 (124)
T ss_pred             CEEEEEEEECccCCCCCeEEEEEEEhHHhhhC
Confidence            45667777777666789999999999999764


No 68 
>cd04050 C2B_Synaptotagmin-like C2 domain second repeat present in Synaptotagmin-like proteins. Synaptotagmin is a membrane-trafficking protein characterized by a N-terminal transmembrane region, a linker, and 2 C-terminal C2 domains. Previously all synaptotagmins were thought to be calcium sensors in the regulation of neurotransmitter release and hormone secretion, but it has been shown that not all of them bind calcium.  Of the 17 identified synaptotagmins only 8 bind calcium (1-3, 5-7, 9, 10).  The function of the two C2 domains that bind calcium are: regulating the fusion step of synaptic vesicle exocytosis (C2A) and  binding to phosphatidyl-inositol-3,4,5-triphosphate (PIP3) in the absence of calcium ions and to phosphatidylinositol bisphosphate (PIP2) in their presence (C2B).  C2B also regulates also the recycling step of synaptic vesicles. C2 domains fold into an 8-standed beta-sandwich that can adopt 2 structural arrangements: Type I and Type II, distinguished by a circular perm
Probab=62.22  E-value=14  Score=25.55  Aligned_cols=35  Identities=29%  Similarity=0.310  Sum_probs=27.6

Q ss_pred             CCCCceEEEeeeeceeeccCCeeeeeeeeeccchhccc
Q psy12064         79 EQLEFFELHICVKDYCFARDDRLVGVAVLQLKDIVEQV  116 (148)
Q Consensus        79 ~~p~~yEL~~~VKDYCFar~Dr~vG~av~qL~~iAeKG  116 (148)
                      ..|+.-.|.+.|+|+=-   |+++|-+.++|.++....
T Consensus        56 ~~~~~~~l~v~v~d~~~---~~~iG~~~i~l~~l~~~~   90 (105)
T cd04050          56 RNPENQELEIEVKDDKT---GKSLGSLTLPLSELLKEP   90 (105)
T ss_pred             CCCCCCEEEEEEEECCC---CCccEEEEEEHHHhhccc
Confidence            34555579999998742   899999999999998664


No 69 
>cd08686 C2_ABR C2 domain in the Active BCR (Breakpoint cluster region) Related protein. The ABR protein is similar to the breakpoint cluster region protein.  It has homology to guanine nucleotide exchange proteins and GTPase-activating proteins (GAPs).  ABR is expressed primarily in the brain, but also includes non-neuronal tissues such as the heart.  It has been associated with human diseases such as Miller-Dieker syndrome in which mental retardation and malformations of the heart are present.  ABR contains a RhoGEF domain and a PH-like domain upstream of its C2 domain and a RhoGAP domain downstream of this domain.  A few members also contain a Bcr-Abl oncoprotein oligomerization domain at the very N-terminal end. Splice variants of ABR have been identified. ABR is found in a wide variety of organisms including chimpanzee, dog, mouse, rat, fruit fly, and mosquito. The C2 domain was first identified in PKC. C2 domains fold into an 8-standed beta-sandwich that can adopt 2 structural arr
Probab=61.85  E-value=11  Score=28.65  Aligned_cols=30  Identities=23%  Similarity=0.294  Sum_probs=25.0

Q ss_pred             CceEEEeeeecee-------eccCCeeeeeeeeeccc
Q psy12064         82 EFFELHICVKDYC-------FARDDRLVGVAVLQLKD  111 (148)
Q Consensus        82 ~~yEL~~~VKDYC-------Far~Dr~vG~av~qL~~  111 (148)
                      ++..|.++|=|+|       -.+.|+++|-|.++|..
T Consensus        56 ~s~~L~~~v~d~~~~~~~~d~~~~d~~~G~g~i~Ld~   92 (118)
T cd08686          56 GSQTLRILCYEKCYSKVKLDGEGTDAIMGKGQIQLDP   92 (118)
T ss_pred             CCCEEEEEEEEcccccccccccCcccEEEEEEEEECH
Confidence            4668999999998       34789999999999854


No 70 
>cd04052 C2B_Tricalbin-like C2 domain second repeat present in Tricalbin-like proteins. 5 to 6 copies of the C2 domain are present in Tricalbin, a yeast homolog of Synaptotagmin, which is involved in membrane trafficking and sorting.  C2 domains fold into an 8-standed beta-sandwich that can adopt 2 structural arrangements: Type I and Type II, distinguished by a circular permutation involving their N- and C-terminal beta strands. Many C2 domains are Ca2+-dependent membrane-targeting modules that bind a wide variety of substances including bind phospholipids, inositol polyphosphates, and intracellular proteins.  Most C2 domain proteins are either signal transduction enzymes that contain a single C2 domain, such as protein kinase C, or membrane trafficking proteins which contain at least two C2 domains, such as synaptotagmin 1.  However, there are a few exceptions to this including RIM isoforms and some splice variants of piccolo/aczonin and intersectin which only have a single C2 domain. 
Probab=61.79  E-value=9.7  Score=26.83  Aligned_cols=36  Identities=19%  Similarity=0.302  Sum_probs=29.0

Q ss_pred             CCCCceEEEeeeeceeeccCCeeeeeeeeeccchhcc
Q psy12064         79 EQLEFFELHICVKDYCFARDDRLVGVAVLQLKDIVEQ  115 (148)
Q Consensus        79 ~~p~~yEL~~~VKDYCFar~Dr~vG~av~qL~~iAeK  115 (148)
                      .+|..-+|++.|+|+=-. .|..||.+.++|.++.+.
T Consensus        49 ~~~~~~~l~i~v~d~~~~-~d~~iG~~~v~L~~l~~~   84 (111)
T cd04052          49 TDRRKSRVTVVVKDDRDR-HDPVLGSVSISLNDLIDA   84 (111)
T ss_pred             cCcCCCEEEEEEEECCCC-CCCeEEEEEecHHHHHhh
Confidence            345566799999887655 799999999999999654


No 71 
>cd04048 C2A_Copine C2 domain first repeat in Copine. There are 2 copies of the C2 domain present in copine, a protein involved in membrane trafficking, protein-protein interactions, and perhaps even cell division and growth.  C2 domains fold into an 8-standed beta-sandwich that can adopt 2 structural arrangements: Type I and Type II, distinguished by a circular permutation involving their N- and C-terminal beta strands. Many C2 domains are Ca2+-dependent membrane-targeting modules that bind a wide variety of substances including bind phospholipids, inositol polyphosphates, and intracellular proteins.  Most C2 domain proteins are either signal transduction enzymes that contain a single C2 domain, such as protein kinase C, or membrane trafficking proteins which contain at least two C2 domains, such as synaptotagmin 1.  However, there are a few exceptions to this including RIM isoforms and some splice variants of piccolo/aczonin and intersectin which only have a single C2 domain.  C2 doma
Probab=60.45  E-value=17  Score=25.74  Aligned_cols=31  Identities=29%  Similarity=0.292  Sum_probs=22.8

Q ss_pred             EEEeeeeceee----ccCCeeeeeeeeeccchhcc
Q psy12064         85 ELHICVKDYCF----ARDDRLVGVAVLQLKDIVEQ  115 (148)
Q Consensus        85 EL~~~VKDYCF----ar~Dr~vG~av~qL~~iAeK  115 (148)
                      .|.+.|-||=.    .+.|+++|.+.++++++...
T Consensus        69 ~l~~~V~d~d~~~~~~~~~d~iG~~~i~l~~l~~~  103 (120)
T cd04048          69 KLRFEVYDVDSKSKDLSDHDFLGEAECTLGEIVSS  103 (120)
T ss_pred             EEEEEEEEecCCcCCCCCCcEEEEEEEEHHHHhcC
Confidence            56777777753    56778888888888888744


No 72 
>cd08403 C2B_Synaptotagmin-3-5-6-9-10 C2 domain second repeat present in Synaptotagmins 3, 5, 6, 9, and 10. Synaptotagmin is a membrane-trafficking protein characterized by a N-terminal transmembrane region, a linker, and 2 C-terminal C2 domains. Synaptotagmin 3, a member of class 3 synaptotagmins, is located in the brain and localized to the active zone and plasma membrane.  It functions as a Ca2+ sensor for fast exocytosis. It, along with synaptotagmins 5,6, and 10, has disulfide bonds at its N-terminus. Synaptotagmin 9, a class 5 synaptotagmins, is located in the brain and localized to the synaptic vesicles.  It is thought to be a Ca2+-sensor for dense-core vesicle exocytosis. Previously all synaptotagmins were thought to be calcium sensors in the regulation of neurotransmitter release and hormone secretion, but it has been shown that not all of them bind calcium.  Of the 17 identified synaptotagmins only 8 bind calcium (1-3, 5-7, 9, 10).  The function of the two C2 domains that bind
Probab=60.38  E-value=7.5  Score=28.03  Aligned_cols=29  Identities=28%  Similarity=0.358  Sum_probs=24.2

Q ss_pred             CceEEEeeeeceeeccCCeeeeeeeeecc
Q psy12064         82 EFFELHICVKDYCFARDDRLVGVAVLQLK  110 (148)
Q Consensus        82 ~~yEL~~~VKDYCFar~Dr~vG~av~qL~  110 (148)
                      ....|.+.|+||--.+.|+++|-+.+++.
T Consensus        80 ~~~~l~~~v~d~~~~~~~~~IG~~~l~~~  108 (134)
T cd08403          80 DNVSLIIAVVDYDRVGHNELIGVCRVGPN  108 (134)
T ss_pred             CCCEEEEEEEECCCCCCCceeEEEEECCC
Confidence            33568899999988888999999999876


No 73 
>cd08389 C2A_Synaptotagmin-14_16 C2A domain first repeat present in Synaptotagmins 14 and 16. Synaptotagmin 14 and 16 are membrane-trafficking proteins in specific tissues outside the brain.   Both of these contain C-terminal tandem C2 repeats, but only Synaptotagmin 14 has an N-terminal transmembrane domain and a putative fatty-acylation site. Previously all synaptotagmins were thought to be calcium sensors in the regulation of neurotransmitter release and hormone secretion, but it has been shown that not all of them bind calcium and this is indeed the case here.  Of the 17 identified synaptotagmins only 8 bind calcium (1-3, 5-7, 9, 10).  The function of the two C2 domains that bind calcium are: regulating the fusion step of synaptic vesicle exocytosis (C2A) and  binding to phosphatidyl-inositol-3,4,5-triphosphate (PIP3) in the absence of calcium ions and to phosphatidylinositol bisphosphate (PIP2) in their presence (C2B).  C2B also regulates also the recycling step of synaptic vesicle
Probab=59.73  E-value=12  Score=27.02  Aligned_cols=32  Identities=19%  Similarity=0.331  Sum_probs=27.8

Q ss_pred             hccceeeeEEeceeeecCCceeEEEEEeehhh
Q psy12064        113 VEQVKHQICVKDYCFARDDRLVGVAVLQLKDI  144 (148)
Q Consensus       113 AeKGScalcVKDyCf~r~dr~vG~~vlql~~i  144 (148)
                      .+.-++.+.|+||-..+.+..+|-+.++|.++
T Consensus        79 l~~~~L~~~V~~~~~~~~~~~lG~~~i~L~~l  110 (124)
T cd08389          79 LNNMALRFRLYGVERMRKERLIGEKVVPLSQL  110 (124)
T ss_pred             hccCEEEEEEEECCCcccCceEEEEEEecccc
Confidence            34667899999998778889999999999987


No 74 
>PF10929 DUF2811:  Protein of unknown function (DUF2811);  InterPro: IPR021231  This is a bacterial family of uncharacterised proteins. 
Probab=59.46  E-value=4.9  Score=27.90  Aligned_cols=20  Identities=20%  Similarity=0.516  Sum_probs=15.9

Q ss_pred             ccccccCcchhh---HHHHHhhh
Q psy12064         33 KTYLDKSPELAS---LRYALSLY   52 (148)
Q Consensus        33 k~fLeks~~l~s---lryalsLy   52 (148)
                      |.|+|.+|+|.+   +..|||+|
T Consensus        15 ~~fie~hP~WDQ~Rl~~aALa~F   37 (57)
T PF10929_consen   15 KDFIETHPNWDQYRLFQAALAGF   37 (57)
T ss_pred             HHHHHcCCCchHHHHHHHHHHHH
Confidence            469999999976   45688866


No 75 
>cd08390 C2A_Synaptotagmin-15-17 C2A domain first repeat present in Synaptotagmins 15 and 17. Synaptotagmin is a membrane-trafficking protein characterized by a N-terminal transmembrane region, a linker, and 2 C-terminal C2 domains. It is thought to be involved in the trafficking and exocytosis of secretory vesicles in non-neuronal tissues and is Ca2+ independent. Human synaptotagmin 15 has 2 alternatively spliced forms that encode proteins with different C-termini.  The larger, SYT15a, contains a N-terminal TM region, a putative fatty-acylation site, and 2 tandem C terminal C2 domains.  The smaller, SYT15b, lacks the C-terminal portion of the second C2 domain.  Unlike most other synaptotagmins it is nearly absent in the brain and rather is found in the heart, lungs, skeletal muscle, and testis. Synaptotagmin 17 is located in the brain, kidney, and prostate and is thought to be a peripheral membrane protein. Previously all synaptotagmins were thought to be calcium sensors in the regulat
Probab=59.41  E-value=13  Score=25.99  Aligned_cols=32  Identities=19%  Similarity=0.202  Sum_probs=27.5

Q ss_pred             cceeeeEEeceeeecCCceeEEEEEeehhhhh
Q psy12064        115 QVKHQICVKDYCFARDDRLVGVAVLQLKDIVE  146 (148)
Q Consensus       115 KGScalcVKDyCf~r~dr~vG~~vlql~~i~~  146 (148)
                      .-.+.+.|.|+...+.+..+|.+.+.|.++..
T Consensus        80 ~~~l~i~v~d~~~~~~~~~iG~~~i~L~~l~~  111 (123)
T cd08390          80 RRTLRLSVYDVDRFSRHCIIGHVLFPLKDLDL  111 (123)
T ss_pred             ccEEEEEEEECCcCCCCcEEEEEEEeccceec
Confidence            34688899999988899999999999998743


No 76 
>cd04020 C2B_SLP_1-2-3-4 C2 domain second repeat present in Synaptotagmin-like proteins 1-4. All Slp members basically share an N-terminal Slp homology domain (SHD) and C-terminal tandem C2 domains (named the C2A domain and the C2B domain) with the SHD and C2 domains being separated by a linker sequence of various length.  Slp1/JFC1 and Slp2/exophilin 4 promote granule docking to the plasma membrane.  Additionally, their C2A domains are both Ca2+ independent, unlike the case in Slp3 and Slp4/granuphilin in which their C2A domains are Ca2+ dependent.  It is thought that SHD (except for the Slp4-SHD) functions as a specific Rab27A/B-binding domain. In addition to Slps, rabphilin, Noc2, and  Munc13-4 also function as Rab27-binding proteins. It has been demonstrated that Slp3 and Slp4/granuphilin promote dense-core vesicle exocytosis. C2 domains fold into an 8-standed beta-sandwich that can adopt 2 structural arrangements: Type I and Type II, distinguished by a circular permutation involvin
Probab=59.03  E-value=12  Score=28.79  Aligned_cols=38  Identities=16%  Similarity=-0.074  Sum_probs=31.8

Q ss_pred             ceEEEeeeeceeeccCCeeeeeeeeeccchhccceeee
Q psy12064         83 FFELHICVKDYCFARDDRLVGVAVLQLKDIVEQVKHQI  120 (148)
Q Consensus        83 ~yEL~~~VKDYCFar~Dr~vG~av~qL~~iAeKGScal  120 (148)
                      ...|.+.|.|+-..+.|.++|-+.+.|.++...|....
T Consensus        95 ~~~L~i~V~d~d~~~~d~~lG~v~i~l~~~~~~~~~~~  132 (162)
T cd04020          95 QACLELTVWDHDKLSSNDFLGGVRLGLGTGKSYGQAVD  132 (162)
T ss_pred             CCEEEEEEEeCCCCCCCceEEEEEEeCCccccCCCccc
Confidence            35799999999887889999999999999987775443


No 77 
>cd08690 C2_Freud-1 C2 domain found in 5' repressor element under dual repression binding protein-1 (Freud-1). Freud-1 is a novel calcium-regulated repressor that negatively regulates basal 5-HT1A receptor expression in neurons.  It may also play a role in the altered regulation of 5-HT1A receptors associated with anxiety or major depression. Freud-1 contains two DM-14 basic repeats, a helix-loop-helix DNA binding domain, and a C2 domain. The Freud-1 C2 domain is thought to be calcium insensitive and it lacks several acidic residues that mediate calcium binding of the PKC C2 domain. In addition, it contains a poly-basic insert that is not present in calcium-dependent C2 domains and may function as a nuclear localization signal. C2 domains fold into an 8-standed beta-sandwich that can adopt 2 structural arrangements: Type I and Type II, distinguished by a circular permutation involving their N- and C-terminal beta strands. Many C2 domains are Ca2+-dependent membrane-targeting modules tha
Probab=57.84  E-value=12  Score=29.39  Aligned_cols=37  Identities=22%  Similarity=0.376  Sum_probs=30.4

Q ss_pred             ccchhccceeeeEEece-eeecCCceeEEEEEeehhhh
Q psy12064        109 LKDIVEQVKHQICVKDY-CFARDDRLVGVAVLQLKDIV  145 (148)
Q Consensus       109 L~~iAeKGScalcVKDy-Cf~r~dr~vG~~vlql~~i~  145 (148)
                      |....++.++.+.|.|+ =|.+.|..+|-+.++|.++.
T Consensus        71 ~~R~l~~~~L~~~V~d~~~f~~~D~~iG~~~i~L~~l~  108 (155)
T cd08690          71 FQRVFKRHGLKFEVYHKGGFLRSDKLLGTAQVKLEPLE  108 (155)
T ss_pred             hhhhccCCcEEEEEEeCCCcccCCCeeEEEEEEccccc
Confidence            34456678899999999 57789999999999998874


No 78 
>cd04022 C2A_MCTP_PRT_plant C2 domain first repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP); plant subset. MCTPs are involved in Ca2+ signaling at the membrane.  Plant-MCTPs are composed of a variable N-terminal sequence, four C2 domains, two transmembrane regions (TMRs), and a short C-terminal sequence.  It is one of four protein classes that are anchored to membranes via a transmembrane region; the others being synaptotagmins, extended synaptotagmins, and ferlins. MCTPs are the only membrane-bound C2 domain proteins that contain two functional TMRs. MCTPs are unique in that they bind Ca2+ but not phospholipids. C2 domains fold into an 8-standed beta-sandwich that can adopt 2 structural arrangements: Type I and Type II, distinguished by a circular permutation involving their N- and C-terminal beta strands. Many C2 domains are Ca2+-dependent membrane-targeting modules that bind a wide variety of substances including bind phospholipids, inositol polyphosphates
Probab=57.74  E-value=16  Score=26.09  Aligned_cols=33  Identities=15%  Similarity=0.160  Sum_probs=26.8

Q ss_pred             eEEEeeeecee-eccCCeeeeeeeeeccchhccc
Q psy12064         84 FELHICVKDYC-FARDDRLVGVAVLQLKDIVEQV  116 (148)
Q Consensus        84 yEL~~~VKDYC-Far~Dr~vG~av~qL~~iAeKG  116 (148)
                      -+|++.|.|+- |.+.|.++|-+.++|.++...|
T Consensus        64 ~~l~~~V~d~~~~~~~d~~lG~v~i~l~~l~~~~   97 (127)
T cd04022          64 LVLEVYVYNDRRSGRRRSFLGRVRISGTSFVPPS   97 (127)
T ss_pred             CeEEEEEeeCCCCcCCCCeeeEEEEcHHHcCCCC
Confidence            57999999975 3347899999999999998444


No 79 
>cd04031 C2A_RIM1alpha C2 domain first repeat contained in Rab3-interacting molecule (RIM) proteins. RIMs are believed to organize specialized sites of the plasma membrane called active zones.  They also play a role in controlling neurotransmitter release, plasticity processes, as well as memory and learning.  RIM contains an N-terminal zinc finger domain, a PDZ domain, and two C-terminal C2 domains (C2A, C2B).  C2 domains fold into an 8-standed beta-sandwich that can adopt 2 structural arrangements: Type I and Type II, distinguished by a circular permutation involving their N- and C-terminal beta strands. Many C2 domains are Ca2+-dependent membrane-targeting modules that bind a wide variety of substances including bind phospholipids, inositol polyphosphates, and intracellular proteins.  Most C2 domain proteins are either signal transduction enzymes that contain a single C2 domain, such as protein kinase C, or membrane trafficking proteins which contain at least two C2 domains, such as 
Probab=57.36  E-value=16  Score=25.57  Aligned_cols=31  Identities=23%  Similarity=0.387  Sum_probs=27.2

Q ss_pred             ccceeeeEEeceeeecCCceeEEEEEeehhh
Q psy12064        114 EQVKHQICVKDYCFARDDRLVGVAVLQLKDI  144 (148)
Q Consensus       114 eKGScalcVKDyCf~r~dr~vG~~vlql~~i  144 (148)
                      ....+.+.|.|+...+.|.++|-+.++|.+.
T Consensus        83 ~~~~l~~~V~d~~~~~~~~~iG~~~i~l~~~  113 (125)
T cd04031          83 KERTLEVTVWDYDRDGENDFLGEVVIDLADA  113 (125)
T ss_pred             CCCEEEEEEEeCCCCCCCcEeeEEEEecccc
Confidence            4568899999999888999999999999984


No 80 
>cd08375 C2_Intersectin C2 domain present in Intersectin. A single instance of the C2 domain is located C terminally in the intersectin protein.  Intersectin functions as a scaffolding protein, providing a link between the actin cytoskeleton and the components of endocytosis and plays a role in signal transduction.   In addition to C2, intersectin contains several additional domains including: Eps15 homology domains, SH3 domains, a RhoGEF domain, and a PH domain.  C2 domains fold into an 8-standed beta-sandwich that can adopt 2 structural arrangements: Type I and Type II, distinguished by a circular permutation involving their N- and C-terminal beta strands. Many C2 domains are Ca2+-dependent membrane-targeting modules that bind a wide variety of substances including bind phospholipids, inositol polyphosphates, and intracellular proteins.  Most C2 domain proteins are either signal transduction enzymes that contain a single C2 domain, such as protein kinase C, or membrane trafficking pro
Probab=56.70  E-value=23  Score=26.32  Aligned_cols=32  Identities=28%  Similarity=0.311  Sum_probs=26.2

Q ss_pred             ceEEEeeeeceeeccCCeeeeeeeeeccchhc
Q psy12064         83 FFELHICVKDYCFARDDRLVGVAVLQLKDIVE  114 (148)
Q Consensus        83 ~yEL~~~VKDYCFar~Dr~vG~av~qL~~iAe  114 (148)
                      .=.|.+.|.|+-....|.++|-+.++|.++..
T Consensus        75 ~~~l~i~V~D~d~~~~d~~lG~~~i~l~~l~~  106 (136)
T cd08375          75 QDVLCITVFDRDFFSPDDFLGRTEIRVADILK  106 (136)
T ss_pred             CCEEEEEEEECCCCCCCCeeEEEEEEHHHhcc
Confidence            33677888888777788899999999999876


No 81 
>cd08377 C2C_MCTP_PRT C2 domain third repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP). MCTPs are involved in Ca2+ signaling at the membrane.  The cds in this family contain multiple C2 domains as well as a C-terminal PRT domain.  It is one of four protein classes that are anchored to membranes via a transmembrane region; the others being synaptotagmins, extended synaptotagmins, and ferlins. MCTPs are the only membrane-bound C2 domain proteins that contain two functional TMRs. MCTPs are unique in that they bind Ca2+ but not phospholipids. C2 domains fold into an 8-standed beta-sandwich that can adopt 2 structural arrangements: Type I and Type II, distinguished by a circular permutation involving their N- and C-terminal beta strands. Many C2 domains are Ca2+-dependent membrane-targeting modules that bind a wide variety of substances including bind phospholipids, inositol polyphosphates, and intracellular proteins.  Most C2 domain proteins are either signal tran
Probab=56.04  E-value=41  Score=23.21  Aligned_cols=32  Identities=19%  Similarity=0.170  Sum_probs=26.6

Q ss_pred             eEEEeeeeceeeccCCeeeeeeeeeccchhcc
Q psy12064         84 FELHICVKDYCFARDDRLVGVAVLQLKDIVEQ  115 (148)
Q Consensus        84 yEL~~~VKDYCFar~Dr~vG~av~qL~~iAeK  115 (148)
                      -.|++.|.|+=....|.++|.+.++|.++...
T Consensus        61 ~~l~~~v~d~~~~~~~~~iG~~~~~l~~~~~~   92 (119)
T cd08377          61 DVLEVTVYDEDKDKKPEFLGKVAIPLLSIKNG   92 (119)
T ss_pred             CEEEEEEEECCCCCCCceeeEEEEEHHHCCCC
Confidence            47888899987766788999999999998643


No 82 
>PF01726 LexA_DNA_bind:  LexA DNA binding domain;  InterPro: IPR006199 This is the DNA binding domain of the LexA SOS regulon repressor which prevents expression of DNA repair proteins in bacteria. The aligned region contains a variant form of the helix-turn-helix DNA binding motif []. This domain usually at the N terminus is found associated with IPR006198 from INTERPRO the auto-proteolytic domain of LexA 3.4.21.88 from EC.; GO: 0004252 serine-type endopeptidase activity, 0006508 proteolysis; PDB: 1LEA_A 1JHH_A 3JSP_A 1JHF_A 3JSO_B 1LEB_A 3K2Z_A.
Probab=55.80  E-value=11  Score=25.77  Aligned_cols=37  Identities=27%  Similarity=0.378  Sum_probs=18.7

Q ss_pred             CCCCchhhHHHHHHHHHHHHhhhhcCCCccccccccCcchhhHHHHHhhh
Q psy12064          3 KSLSPKQCALLDASLDSIKNYFHAAGNGLKKTYLDKSPELASLRYALSLY   52 (148)
Q Consensus         3 k~LtpkQCavld~aldtiK~yFhagg~GlKk~fLeks~~l~slryalsLy   52 (148)
                      +.||+||=.|||.+.+.|++    -|         .+|-+.-+.-++.+-
T Consensus         2 ~~LT~rQ~~vL~~I~~~~~~----~G---------~~Pt~rEIa~~~g~~   38 (65)
T PF01726_consen    2 KELTERQKEVLEFIREYIEE----NG---------YPPTVREIAEALGLK   38 (65)
T ss_dssp             ----HHHHHHHHHHHHHHHH----HS---------S---HHHHHHHHTSS
T ss_pred             CCCCHHHHHHHHHHHHHHHH----cC---------CCCCHHHHHHHhCCC
Confidence            57999999997665555544    33         255555555555554


No 83 
>cd04039 C2_PSD C2 domain present in Phosphatidylserine decarboxylase (PSD). PSD is involved in the biosynthesis of aminophospholipid by converting phosphatidylserine (PtdSer) to phosphatidylethanolamine (PtdEtn). There is a single C2 domain present and it is thought to confer PtdSer binding motif that is common to PKC and synaptotagmin. C2 domains fold into an 8-standed beta-sandwich that can adopt 2 structural arrangements: Type I and Type II, distinguished by a circular permutation involving their N- and C-terminal beta strands. Many C2 domains are Ca2+-dependent membrane-targeting modules that bind a wide variety of substances including bind phospholipids, inositol polyphosphates, and intracellular proteins.  Most C2 domain proteins are either signal transduction enzymes that contain a single C2 domain, such as protein kinase C, or membrane trafficking proteins which contain at least two C2 domains, such as synaptotagmin 1.  However, there are a few exceptions to this including RIM 
Probab=55.27  E-value=22  Score=25.36  Aligned_cols=32  Identities=16%  Similarity=0.111  Sum_probs=27.0

Q ss_pred             ceeeeEEeceeeecCCceeEEEEEeehhhhhc
Q psy12064        116 VKHQICVKDYCFARDDRLVGVAVLQLKDIVEQ  147 (148)
Q Consensus       116 GScalcVKDyCf~r~dr~vG~~vlql~~i~~~  147 (148)
                      -.+.+.|.||=....|..+|-+.+.|+++++.
T Consensus        67 ~~L~~~V~D~d~~~~dd~IG~~~l~L~~l~~~   98 (108)
T cd04039          67 FDIQFKVLDKDKFSFNDYVATGSLSVQELLNA   98 (108)
T ss_pred             CEEEEEEEECCCCCCCcceEEEEEEHHHHHhh
Confidence            46788898887677899999999999999764


No 84 
>cd04025 C2B_RasA1_RasA4 C2 domain second repeat present in RasA1 and RasA4. RasA1 and RasA4 are GAP1s (GTPase activating protein 1s ), Ras-specific GAP members, which suppresses Ras function by enhancing the GTPase activity of Ras proteins resulting in the inactive GDP-bound form of Ras.  In this way it can control cellular proliferation and differentiation.  Both proteins contain two C2 domains,  a Ras-GAP domain, a plextrin homology (PH)-like domain, and a Bruton's Tyrosine Kinase (BTK) zinc binding domain. C2 domains fold into an 8-standed beta-sandwich that can adopt 2 structural arrangements: Type I and Type II, distinguished by a circular permutation involving their N- and C-terminal beta strands. Many C2 domains are Ca2+-dependent membrane-targeting modules that bind a wide variety of substances including bind phospholipids, inositol polyphosphates, and intracellular proteins.  Most C2 domain proteins are either signal transduction enzymes that contain a single C2 domain, such a
Probab=55.22  E-value=17  Score=25.61  Aligned_cols=31  Identities=13%  Similarity=0.306  Sum_probs=26.6

Q ss_pred             ceeeeEEeceeeecCCceeEEEEEeehhhhh
Q psy12064        116 VKHQICVKDYCFARDDRLVGVAVLQLKDIVE  146 (148)
Q Consensus       116 GScalcVKDyCf~r~dr~vG~~vlql~~i~~  146 (148)
                      ..+.+.|.||-....|..+|.+.++|.++..
T Consensus        61 ~~l~~~v~d~~~~~~~~~iG~~~~~l~~l~~   91 (123)
T cd04025          61 SPLSVEVWDWDLVSKNDFLGKVVFSIQTLQQ   91 (123)
T ss_pred             CEEEEEEEECCCCCCCcEeEEEEEEHHHccc
Confidence            4678889999888889999999999998864


No 85 
>cd04018 C2C_Ferlin C2 domain third repeat in Ferlin. Ferlins are involved in vesicle fusion events.  Ferlins and other proteins, such as Synaptotagmins, are implicated in facilitating the fusion process when cell membranes fuse together.  There are six known human Ferlins: Dysferlin (Fer1L1), Otoferlin (Fer1L2), Myoferlin (Fer1L3), Fer1L4, Fer1L5, and Fer1L6.  Defects in these genes can lead to a wide range of diseases including muscular dystrophy (dysferlin), deafness (otoferlin), and infertility (fer-1, fertilization factor-1).  Structurally they have 6 tandem C2 domains, designated as (C2A-C2F) and a single C-terminal transmembrane domain, though there is a new study that disputes this and claims that there are actually 7 tandem C2 domains with another C2 domain inserted between C2D and C2E.   In a subset of them (Dysferlin, Myoferlin, and Fer1) there is an additional conserved domain called DysF. C2 domains fold into an 8-standed beta-sandwich that can adopt 2 structural arrangemen
Probab=54.28  E-value=17  Score=28.04  Aligned_cols=34  Identities=18%  Similarity=0.340  Sum_probs=29.5

Q ss_pred             ceEEEeeeeceeeccCCeeeeeeeeeccchhccc
Q psy12064         83 FFELHICVKDYCFARDDRLVGVAVLQLKDIVEQV  116 (148)
Q Consensus        83 ~yEL~~~VKDYCFar~Dr~vG~av~qL~~iAeKG  116 (148)
                      .-.|.+.|.||=....|.+||-+.++|.+|...+
T Consensus        75 ~~~l~~~v~D~d~~~~dd~iG~~~l~l~~l~~~~  108 (151)
T cd04018          75 CERIKIQIRDWDRVGNDDVIGTHFIDLSKISNSG  108 (151)
T ss_pred             CCEEEEEEEECCCCCCCCEEEEEEEeHHHhccCC
Confidence            3478899999988889999999999999998776


No 86 
>cd08409 C2B_Synaptotagmin-15 C2 domain second repeat present in Synaptotagmin 15. Synaptotagmin is a membrane-trafficking protein characterized by a N-terminal transmembrane region, a linker, and 2 C-terminal C2 domains. It is thought to be involved in the trafficking and exocytosis of secretory vesicles in non-neuronal tissues and is Ca2+ independent. Human synaptotagmin 15 has 2 alternatively spliced forms that encode proteins with different C-termini.  The larger, SYT15a, contains a N-terminal TM region, a putative fatty-acylation site, and 2 tandem C terminal C2 domains.  The smaller, SYT15b, lacks the C-terminal portion of the second C2 domain.  Unlike most other synaptotagmins it is nearly absent in the brain and rather is found in the heart, lungs, skeletal muscle, and testis.  Previously all synaptotagmins were thought to be calcium sensors in the regulation of neurotransmitter release and hormone secretion, but it has been shown that not all of them bind calcium.  Of the 17 id
Probab=54.23  E-value=11  Score=27.75  Aligned_cols=32  Identities=28%  Similarity=0.270  Sum_probs=25.9

Q ss_pred             CCCCceEEEeeeeceeeccCCeeeeeeeeecc
Q psy12064         79 EQLEFFELHICVKDYCFARDDRLVGVAVLQLK  110 (148)
Q Consensus        79 ~~p~~yEL~~~VKDYCFar~Dr~vG~av~qL~  110 (148)
                      ++.....|++.|+|+.-.+.|.+||-+++...
T Consensus        77 ~~l~~~~L~~~V~~~~~~~~~~~lG~v~ig~~  108 (137)
T cd08409          77 RQLDTASLSLSVMQSGGVRKSKLLGRVVLGPF  108 (137)
T ss_pred             HHhCccEEEEEEEeCCCCCCcceEEEEEECCc
Confidence            34556789999999997778889999998753


No 87 
>cd04032 C2_Perforin C2 domain of Perforin. Perforin contains a single copy of a C2 domain in its C-terminus and plays a role in lymphocyte-mediated cytotoxicity.  Mutations in perforin leads to familial hemophagocytic lymphohistiocytosis type 2.  The function of perforin is calcium dependent and the C2 domain is thought to confer this binding to target cell membranes.  C2 domains fold into an 8-standed beta-sandwich that can adopt 2 structural arrangements: Type I and Type II, distinguished by a circular permutation involving their N- and C-terminal beta strands. Many C2 domains are Ca2+-dependent membrane-targeting modules that bind a wide variety of substances including bind phospholipids, inositol polyphosphates, and intracellular proteins.  Most C2 domain proteins are either signal transduction enzymes that contain a single C2 domain, such as protein kinase C, or membrane trafficking proteins which contain at least two C2 domains, such as synaptotagmin 1.  However, there are a few 
Probab=53.92  E-value=22  Score=26.69  Aligned_cols=39  Identities=23%  Similarity=0.051  Sum_probs=31.3

Q ss_pred             CCceEEEeeeeceeeccCCeeeeeeeeeccchhccceee
Q psy12064         81 LEFFELHICVKDYCFARDDRLVGVAVLQLKDIVEQVKHQ  119 (148)
Q Consensus        81 p~~yEL~~~VKDYCFar~Dr~vG~av~qL~~iAeKGSca  119 (148)
                      +..-.|.+.|.||=-...|.++|-+.+.|+......|+.
T Consensus        86 ~~~~~L~v~V~D~d~~s~dd~IG~~~i~l~~~~~~~~~~  124 (127)
T cd04032          86 SPGGKLRFEVWDRDNGWDDDLLGTCSVVPEAGVHEDSCQ  124 (127)
T ss_pred             CCCCEEEEEEEeCCCCCCCCeeEEEEEEecCCceeeeee
Confidence            455688999999877778889999999999877656655


No 88 
>cd08394 C2A_Munc13 C2 domain first repeat in Munc13 (mammalian uncoordinated) proteins. C2-like domains are thought to be involved in phospholipid binding in a Ca2+ independent manner in both Unc13 and Munc13. Caenorabditis elegans Unc13 has a central domain with sequence similarity to PKC, which includes C1 and C2-related domains. Unc13 binds phorbol esters and DAG with high affinity in a phospholipid manner.  Mutations in Unc13 results in abnormal neuronal connections and impairment in cholinergic neurotransmission in the nematode.  Munc13 is the mammalian homolog which are expressed in the brain.  There are 3 isoforms (Munc13-1, -2, -3) and are thought to play a role in neurotransmitter release and are hypothesized to be high-affinity receptors for phorbol esters.  Unc13 and Munc13 contain both C1 and C2 domains.  There are two C2 related domains present, one central and one at the carboxyl end.  Munc13-1 contains a third C2-like domain.  Munc13 interacts with syntaxin, synaptobrevi
Probab=53.75  E-value=14  Score=28.42  Aligned_cols=33  Identities=24%  Similarity=0.226  Sum_probs=27.2

Q ss_pred             eEEEeeeeceeeccCCeeeeeeeeeccchhccce
Q psy12064         84 FELHICVKDYCFARDDRLVGVAVLQLKDIVEQVK  117 (148)
Q Consensus        84 yEL~~~VKDYCFar~Dr~vG~av~qL~~iAeKGS  117 (148)
                      .+|.+.|.|+-+. .|-.+|-+.++|.+|....+
T Consensus        58 ~~L~v~V~dkd~~-~DD~lG~v~i~L~~v~~~~~   90 (127)
T cd08394          58 LGLVIELWNKGLI-WDTLVGTVWIPLSTIRQSNE   90 (127)
T ss_pred             CEEEEEEEeCCCc-CCCceEEEEEEhHHcccCCC
Confidence            3488999888887 78889999999999976543


No 89 
>cd08408 C2B_Synaptotagmin-14_16 C2 domain second repeat present in Synaptotagmins 14 and 16. Synaptotagmin 14 and 16 are membrane-trafficking proteins in specific tissues outside the brain.   Both of these contain C-terminal tandem C2 repeats, but only Synaptotagmin 14 has an N-terminal transmembrane domain and a putative fatty-acylation site. Previously all synaptotagmins were thought to be calcium sensors in the regulation of neurotransmitter release and hormone secretion, but it has been shown that not all of them bind calcium and this is indeed the case here.  Of the 17 identified synaptotagmins only 8 bind calcium (1-3, 5-7, 9, 10).  The function of the two C2 domains that bind calcium are: regulating the fusion step of synaptic vesicle exocytosis (C2A) and  binding to phosphatidyl-inositol-3,4,5-triphosphate (PIP3) in the absence of calcium ions and to phosphatidylinositol bisphosphate (PIP2) in their presence (C2B).  C2B also regulates also the recycling step of synaptic vesicle
Probab=51.32  E-value=14  Score=27.69  Aligned_cols=35  Identities=20%  Similarity=0.114  Sum_probs=28.6

Q ss_pred             CCCCCceEEEeeeeceeeccCCeeeeeeeeeccch
Q psy12064         78 EEQLEFFELHICVKDYCFARDDRLVGVAVLQLKDI  112 (148)
Q Consensus        78 e~~p~~yEL~~~VKDYCFar~Dr~vG~av~qL~~i  112 (148)
                      ++++....|++.|.||--.+.|.++|-.++.+...
T Consensus        78 ~~~l~~~~L~~~V~~~~~~~~~~~iG~v~l~~~~~  112 (138)
T cd08408          78 LFQLSEVTLMFSVYNKRKMKRKEMIGWFSLGLNSS  112 (138)
T ss_pred             HHHhCccEEEEEEEECCCCCCCcEEEEEEECCcCC
Confidence            45677889999999998667778999999888644


No 90 
>cd08379 C2D_MCTP_PRT_plant C2 domain fourth repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP); plant subset. MCTPs are involved in Ca2+ signaling at the membrane.  Plant-MCTPs are composed of a variable N-terminal sequence, four C2 domains, two transmembrane regions (TMRs), and a short C-terminal sequence.  It is one of four protein classes that are anchored to membranes via a transmembrane region; the others being synaptotagmins, extended synaptotagmins, and ferlins. MCTPs are the only membrane-bound C2 domain proteins that contain two functional TMRs. MCTPs are unique in that they bind Ca2+ but not phospholipids. C2 domains fold into an 8-standed beta-sandwich that can adopt 2 structural arrangements: Type I and Type II, distinguished by a circular permutation involving their N- and C-terminal beta strands. Many C2 domains are Ca2+-dependent membrane-targeting modules that bind a wide variety of substances including bind phospholipids, inositol polyphosphate
Probab=51.13  E-value=36  Score=25.49  Aligned_cols=35  Identities=20%  Similarity=0.243  Sum_probs=27.9

Q ss_pred             EEEeeeeceeec------cCCeeeeeeeeeccchhccceee
Q psy12064         85 ELHICVKDYCFA------RDDRLVGVAVLQLKDIVEQVKHQ  119 (148)
Q Consensus        85 EL~~~VKDYCFa------r~Dr~vG~av~qL~~iAeKGSca  119 (148)
                      .|.+.|.|+=-.      +.|.++|-+.++|..+.......
T Consensus        64 ~l~v~V~d~d~~~~~~~~~~dd~lG~~~i~l~~l~~~~~~~  104 (126)
T cd08379          64 VLTVGVFDNSQSHWKEAVQPDVLIGKVRIRLSTLEDDRVYA  104 (126)
T ss_pred             EEEEEEEECCCccccccCCCCceEEEEEEEHHHccCCCEEe
Confidence            789999887432      57999999999999988766544


No 91 
>cd04045 C2C_Tricalbin-like C2 domain third repeat present in Tricalbin-like proteins. 5 to 6 copies of the C2 domain are present in Tricalbin, a yeast homolog of Synaptotagmin, which is involved in membrane trafficking and sorting.  C2 domains fold into an 8-standed beta-sandwich that can adopt 2 structural arrangements: Type I and Type II, distinguished by a circular permutation involving their N- and C-terminal beta strands. Many C2 domains are Ca2+-dependent membrane-targeting modules that bind a wide variety of substances including bind phospholipids, inositol polyphosphates, and intracellular proteins.  Most C2 domain proteins are either signal transduction enzymes that contain a single C2 domain, such as protein kinase C, or membrane trafficking proteins which contain at least two C2 domains, such as synaptotagmin 1.  However, there are a few exceptions to this including RIM isoforms and some splice variants of piccolo/aczonin and intersectin which only have a single C2 domain.  
Probab=51.10  E-value=22  Score=25.66  Aligned_cols=31  Identities=23%  Similarity=0.462  Sum_probs=26.4

Q ss_pred             EEEeeeeceeeccCCeeeeeeeeeccchhcc
Q psy12064         85 ELHICVKDYCFARDDRLVGVAVLQLKDIVEQ  115 (148)
Q Consensus        85 EL~~~VKDYCFar~Dr~vG~av~qL~~iAeK  115 (148)
                      .|.+.|.|+--...|..||-+.++|.++.+.
T Consensus        63 ~L~v~v~d~~~~~~d~~IG~~~~~l~~l~~~   93 (120)
T cd04045          63 KITLEVMDYEKVGKDRSLGSVEINVSDLIKK   93 (120)
T ss_pred             EEEEEEEECCCCCCCCeeeEEEEeHHHhhCC
Confidence            7888888887667788999999999999876


No 92 
>cd06560 PriL Archaeal/eukaryotic core primase: Large subunit, PriL. Primases synthesize the RNA primers required for DNA replication. Primases are grouped into two classes, bacteria/bacteriophage and archaeal/eukaryotic. The proteins in the two classes differ in structure and the replication apparatus components. The DNA replication machinery of archaeal organisms contains only the core primase, a simpler arrangement compared to eukaryotes. Archaeal/eukaryotic core primase is a heterodimeric enzyme consisting of a small catalytic subunit (PriS) and a large subunit (PriL). Although the catalytic activity resides within PriS, the PriL subunit is essential for primase function as disruption of the PriL gene in yeast is lethal. PriL is composed of two structural domains. Several functions have been proposed for PriL, such as the stabilization of PriS, involvement in the initiation of synthesis, the improvement of primase processivity, and the determination of product size.
Probab=50.42  E-value=48  Score=25.07  Aligned_cols=60  Identities=10%  Similarity=0.105  Sum_probs=47.4

Q ss_pred             HHHHHHHHHHHHhhhhcCCCccccccccCcchhhHHHHHhhhhhh-hHHHHHHHHHhhccc
Q psy12064         11 ALLDASLDSIKNYFHAAGNGLKKTYLDKSPELASLRYALSLYTQT-TDALIKTFVQSQCNE   70 (148)
Q Consensus        11 avld~aldtiK~yFhagg~GlKk~fLeks~~l~slryalsLytqt-Td~LIk~fv~tQ~~q   70 (148)
                      ..+|.|++.++.....+..+-.....+..-|+-|...|.-++..+ ++.|++.|+.....-
T Consensus        10 ~~~~~a~~Rv~~~~~~~~~~~~~~~~~~~~d~~s~~ilr~~~~~~~~~~l~~rf~~~Ea~~   70 (166)
T cd06560          10 IAVERAIERVREALEGKIIESPELEDSVENEVLSFYIARVLVAALDDSILTRRFARAEAKI   70 (166)
T ss_pred             HHHHHHHHHHHHHHcCCCcCCcccccchhHHHHHHHHHHHHHHHcCCHHHHHHHHHHHHHH
Confidence            378999999999987776665544555556888888888899998 889999999877543


No 93 
>cd08402 C2B_Synaptotagmin-1 C2 domain second repeat present in Synaptotagmin 1. Synaptotagmin is a membrane-trafficking protein characterized by a N-terminal transmembrane region, a linker, and 2 C-terminal C2 domains.  Synaptotagmin 1, a member of the class 1 synaptotagmins, is located in the brain and endocranium and localized to the synaptic vesicles and secretory granules.  It functions as a Ca2+ sensor for fast exocytosis. It, like synaptotagmin-2, has an N-glycosylated N-terminus. Synaptotagmin 4, a member of class 4 synaptotagmins, is located in the brain.  It functions are unknown. It, like synaptotagmin-11, has an Asp to Ser substitution in its C2A domain. Previously all synaptotagmins were thought to be calcium sensors in the regulation of neurotransmitter release and hormone secretion, but it has been shown that not all of them bind calcium.  Of the 17 identified synaptotagmins only 8 bind calcium (1-3, 5-7, 9, 10).  The function of the two C2 domains that bind calcium are: 
Probab=49.97  E-value=19  Score=25.99  Aligned_cols=29  Identities=24%  Similarity=0.241  Sum_probs=25.3

Q ss_pred             ceEEEeeeeceeeccCCeeeeeeeeeccc
Q psy12064         83 FFELHICVKDYCFARDDRLVGVAVLQLKD  111 (148)
Q Consensus        83 ~yEL~~~VKDYCFar~Dr~vG~av~qL~~  111 (148)
                      ...|.+.|.||--.+.|.++|-+.+++..
T Consensus        82 ~~~l~~~v~d~~~~~~~~~iG~~~i~~~~  110 (136)
T cd08402          82 KVHLIVTVLDYDRIGKNDPIGKVVLGCNA  110 (136)
T ss_pred             CCEEEEEEEeCCCCCCCceeEEEEECCcc
Confidence            45799999999988889999999999865


No 94 
>cd08386 C2A_Synaptotagmin-7 C2A domain first repeat present in Synaptotagmin 7. Synaptotagmin is a membrane-trafficking protein characterized by a N-terminal transmembrane region, a linker, and 2 C-terminal C2 domains. Synaptotagmin 7, a member of class 2 synaptotagmins, is located in presynaptic plasma membranes in neurons, dense-core vesicles in endocrine cells, and lysosomes in fibroblasts.  It has been shown to play a role in regulation of Ca2+-dependent lysosomal exocytosis in fibroblasts and may also function as a vesicular Ca2+-sensor.  It is distinguished from the other synaptotagmins by having over 12 splice forms. Previously all synaptotagmins were thought to be calcium sensors in the regulation of neurotransmitter release and hormone secretion, but it has been shown that not all of them bind calcium.  Of the 17 identified synaptotagmins only 8 bind calcium (1-3, 5-7, 9, 10).  The function of the two C2 domains that bind calcium are: regulating the fusion step of synaptic ves
Probab=49.96  E-value=23  Score=24.90  Aligned_cols=32  Identities=22%  Similarity=0.188  Sum_probs=26.6

Q ss_pred             ccceeeeEEeceeeecCCceeEEEEEeehhhh
Q psy12064        114 EQVKHQICVKDYCFARDDRLVGVAVLQLKDIV  145 (148)
Q Consensus       114 eKGScalcVKDyCf~r~dr~vG~~vlql~~i~  145 (148)
                      +...+.+.|+||--.+.|..+|.+.+.|+++.
T Consensus        81 ~~~~l~~~v~d~d~~~~~~~iG~~~i~l~~l~  112 (125)
T cd08386          81 QQRVLYLQVLDYDRFSRNDPIGEVSLPLNKVD  112 (125)
T ss_pred             CCCEEEEEEEeCCCCcCCcEeeEEEEeccccc
Confidence            34568899999986677889999999999875


No 95 
>cd04010 C2B_RasA3 C2 domain second repeat present in RAS p21 protein activator 3 (RasA3). RasA3 are members of GTPase activating protein 1 (GAP1), a Ras-specific GAP, which suppresses Ras function by enhancing the GTPase activity of Ras proteins resulting in the inactive GDP-bound form of Ras.  In this way it can control cellular proliferation and differentiation.  RasA3 contains an N-terminal C2 domain,  a Ras-GAP domain, a plextrin homology (PH)-like domain, and a Bruton's Tyrosine Kinase (BTK) zinc binding domain. C2 domains fold into an 8-standed beta-sandwich that can adopt 2 structural arrangements: Type I and Type II, distinguished by a circular permutation involving their N- and C-terminal beta strands. Many C2 domains are Ca2+-dependent membrane-targeting modules that bind a wide variety of substances including bind phospholipids, inositol polyphosphates, and intracellular proteins.  Most C2 domain proteins are either signal transduction enzymes that contain a single C2 domain
Probab=49.64  E-value=20  Score=27.52  Aligned_cols=31  Identities=10%  Similarity=0.175  Sum_probs=26.9

Q ss_pred             ceeeeEEeceeeecCCceeEEEEEeehhhhh
Q psy12064        116 VKHQICVKDYCFARDDRLVGVAVLQLKDIVE  146 (148)
Q Consensus       116 GScalcVKDyCf~r~dr~vG~~vlql~~i~~  146 (148)
                      ..+.+.|+|+-..+.|..+|.+.|+|+++.+
T Consensus        79 ~~L~i~V~d~~~~~~ddfLG~v~i~l~~l~~  109 (148)
T cd04010          79 LELRVDLWHASMGGGDVFLGEVRIPLRGLDL  109 (148)
T ss_pred             EEEEEEEEcCCCCCCCceeEEEEEecccccc
Confidence            4677888999888899999999999999865


No 96 
>cd08680 C2_Kibra C2 domain found in Human protein Kibra. Kibra is thought to be a regulator of the Salvador (Sav)/Warts (Wts)/Hippo (Hpo) (SWH) signaling network, which limits tissue growth by inhibiting cell proliferation and promoting apoptosis. The core of the pathway consists of a MST and LATS family kinase cascade that ultimately phosphorylates and inactivates the YAP/Yorkie (Yki) transcription coactivator. The FERM domain proteins Merlin (Mer) and Expanded (Ex) are part of the upstream regulation controlling pathway mechanism.  Kibra colocalizes and associates with Mer and Ex and is thought to transduce an extracellular signal via the SWH network. The apical scaffold machinery that contains Hpo, Wts, and Ex recruits Yki to the apical membrane facilitating its inhibitory phosphorlyation by Wts.  Since Kibra associates with Ex and is apically located it is hypothesized that KIBRA is part of the scaffold, helps in the Hpo/Wts complex, and helps recruit Yki for inactivation that prom
Probab=49.62  E-value=21  Score=26.43  Aligned_cols=32  Identities=22%  Similarity=0.180  Sum_probs=27.0

Q ss_pred             hccceeeeEEeceeeecCCceeEEEEEeehhh
Q psy12064        113 VEQVKHQICVKDYCFARDDRLVGVAVLQLKDI  144 (148)
Q Consensus       113 AeKGScalcVKDyCf~r~dr~vG~~vlql~~i  144 (148)
                      .+..+++++|.||=..+.+..+|.+.|.|.++
T Consensus        80 L~~~~L~~~V~~~~~~~~~~~lG~~~i~L~~~  111 (124)
T cd08680          80 LYQKTLQVDVCSVGPDQQEECLGGAQISLADF  111 (124)
T ss_pred             hhcCEEEEEEEeCCCCCceeEEEEEEEEhhhc
Confidence            35678999999986666778999999999987


No 97 
>smart00239 C2 Protein kinase C conserved region 2 (CalB). Ca2+-binding motif present in phospholipases, protein kinases C, and synaptotamins (among others). Some do not appear to contain Ca2+-binding sites. Particular C2s appear to bind phospholipids, inositol polyphosphates, and intracellular proteins. Unusual occurrence in perforin. Synaptotagmin and PLC C2s are permuted in sequence with respect to N- and C-terminal beta strands. SMART detects C2 domains using one or both of two profiles.
Probab=49.53  E-value=24  Score=22.04  Aligned_cols=34  Identities=26%  Similarity=0.258  Sum_probs=20.7

Q ss_pred             ceEEEeeeeceeeccCCeeeeeeeeeccchhccc
Q psy12064         83 FFELHICVKDYCFARDDRLVGVAVLQLKDIVEQV  116 (148)
Q Consensus        83 ~yEL~~~VKDYCFar~Dr~vG~av~qL~~iAeKG  116 (148)
                      .-.|.+.|.|..=...+..+|.+.++|.++.+..
T Consensus        63 ~~~l~i~v~~~~~~~~~~~~G~~~~~l~~~~~~~   96 (101)
T smart00239       63 LAELEIEVYDKDRFGRDDFIGQVTIPLSDLLLGG   96 (101)
T ss_pred             cCEEEEEEEecCCccCCceeEEEEEEHHHcccCc
Confidence            4456666666554445677777777776665443


No 98 
>cd04042 C2A_MCTP_PRT C2 domain first repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP). MCTPs are involved in Ca2+ signaling at the membrane.  MCTP is composed of a variable N-terminal sequence, three C2 domains, two transmembrane regions (TMRs), and a short C-terminal sequence.  It is one of four protein classes that are anchored to membranes via a transmembrane region; the others being synaptotagmins, extended synaptotagmins, and ferlins. MCTPs are the only membrane-bound C2 domain proteins that contain two functional TMRs. MCTPs are unique in that they bind Ca2+ but not phospholipids. C2 domains fold into an 8-standed beta-sandwich that can adopt 2 structural arrangements: Type I and Type II, distinguished by a circular permutation involving their N- and C-terminal beta strands. Many C2 domains are Ca2+-dependent membrane-targeting modules that bind a wide variety of substances including bind phospholipids, inositol polyphosphates, and intracellular protein
Probab=49.09  E-value=22  Score=25.05  Aligned_cols=31  Identities=26%  Similarity=0.228  Sum_probs=27.4

Q ss_pred             ceeeeEEeceeeecCCceeEEEEEeehhhhh
Q psy12064        116 VKHQICVKDYCFARDDRLVGVAVLQLKDIVE  146 (148)
Q Consensus       116 GScalcVKDyCf~r~dr~vG~~vlql~~i~~  146 (148)
                      ..+.+.|.|+-....|..+|-+.+.|.++..
T Consensus        61 ~~l~~~v~D~d~~~~~~~iG~~~~~l~~l~~   91 (121)
T cd04042          61 QPLYIKVFDYDRGLTDDFMGSAFVDLSTLEL   91 (121)
T ss_pred             CeEEEEEEeCCCCCCCcceEEEEEEHHHcCC
Confidence            5688899999998899999999999998863


No 99 
>cd04026 C2_PKC_alpha_gamma C2 domain in Protein Kinase C (PKC) alpha and gamma. A single C2 domain is found in PKC alpha and gamma. The PKC family of serine/threonine kinases regulates apoptosis, proliferation, migration, motility, chemo-resistance, and differentiation.  There are 3 groups: group 1(alpha, betaI, beta II, gamma) which require phospholipids and calcium, group 2 (delta, epsilon, theta, eta) which do not require calcium for activation, and group 3 (xi, iota/lambda) which are atypical and can be activated in the absence of diacylglycerol and calcium. C2 domains fold into an 8-standed beta-sandwich that can adopt 2 structural arrangements: Type I and Type II, distinguished by a circular permutation involving their N- and C-terminal beta strands. Many C2 domains are Ca2+-dependent membrane-targeting modules that bind a wide variety of substances including bind phospholipids, inositol polyphosphates, and intracellular proteins.  Most C2 domain proteins are either signal transd
Probab=48.53  E-value=32  Score=24.48  Aligned_cols=31  Identities=13%  Similarity=0.260  Sum_probs=25.7

Q ss_pred             ceeeeEEeceeeecCCceeEEEEEeehhhhh
Q psy12064        116 VKHQICVKDYCFARDDRLVGVAVLQLKDIVE  146 (148)
Q Consensus       116 GScalcVKDyCf~r~dr~vG~~vlql~~i~~  146 (148)
                      ..+.+.|.|+.-...|+.+|-+.+.|.++.+
T Consensus        80 ~~l~v~v~d~~~~~~~~~iG~~~~~l~~l~~  110 (131)
T cd04026          80 RRLSIEVWDWDRTTRNDFMGSLSFGVSELIK  110 (131)
T ss_pred             CEEEEEEEECCCCCCcceeEEEEEeHHHhCc
Confidence            4567778888777789999999999999874


No 100
>cd04011 C2B_Ferlin C2 domain second repeat in Ferlin. Ferlins are involved in vesicle fusion events.  Ferlins and other proteins, such as Synaptotagmins, are implicated in facilitating the fusion process when cell membranes fuse together.  There are six known human Ferlins: Dysferlin (Fer1L1), Otoferlin (Fer1L2), Myoferlin (Fer1L3), Fer1L4, Fer1L5, and Fer1L6.  Defects in these genes can lead to a wide range of diseases including muscular dystrophy (dysferlin), deafness (otoferlin), and infertility (fer-1, fertilization factor-1).  Structurally they have 6 tandem C2 domains, designated as (C2A-C2F) and a single C-terminal transmembrane domain, though there is a new study that disputes this and claims that there are actually 7 tandem C2 domains with another C2 domain inserted between C2D and C2E.   In a subset of them (Dysferlin, Myoferlin, and Fer1) there is an additional conserved domain called DysF. C2 domains fold into an 8-standed beta-sandwich that can adopt 2 structural arrangeme
Probab=48.31  E-value=20  Score=24.94  Aligned_cols=32  Identities=25%  Similarity=0.284  Sum_probs=26.8

Q ss_pred             cceeeeEEeceeeecCCceeEEEEEeehhhhh
Q psy12064        115 QVKHQICVKDYCFARDDRLVGVAVLQLKDIVE  146 (148)
Q Consensus       115 KGScalcVKDyCf~r~dr~vG~~vlql~~i~~  146 (148)
                      ...+.+.|.|+--...|+++|.+.+.|.++.+
T Consensus        64 ~~~l~i~V~d~~~~~~~~~iG~~~i~l~~v~~   95 (111)
T cd04011          64 DKIIKISVYDSRSLRSDTLIGSFKLDVGTVYD   95 (111)
T ss_pred             cCeEEEEEEcCcccccCCccEEEEECCccccC
Confidence            45788999999866679999999999998854


No 101
>cd08373 C2A_Ferlin C2 domain first repeat in Ferlin. Ferlins are involved in vesicle fusion events.  Ferlins and other proteins, such as Synaptotagmins, are implicated in facilitating the fusion process when cell membranes fuse together.  There are six known human Ferlins: Dysferlin (Fer1L1), Otoferlin (Fer1L2), Myoferlin (Fer1L3), Fer1L4, Fer1L5, and Fer1L6.  Defects in these genes can lead to a wide range of diseases including muscular dystrophy (dysferlin), deafness (otoferlin), and infertility (fer-1, fertilization factor-1).  Structurally they have 6 tandem C2 domains, designated as (C2A-C2F) and a single C-terminal transmembrane domain, though there is a new study that disputes this and claims that there are actually 7 tandem C2 domains with another C2 domain inserted between C2D and C2E.   In a subset of them (Dysferlin, Myoferlin, and Fer1) there is an additional conserved domain called DysF. C2 domains fold into an 8-standed beta-sandwich that can adopt 2 structural arrangemen
Probab=46.79  E-value=31  Score=24.53  Aligned_cols=34  Identities=35%  Similarity=0.553  Sum_probs=26.5

Q ss_pred             ccceeeeEEeceeeecCCceeEEEEEeehhhhhc
Q psy12064        114 EQVKHQICVKDYCFARDDRLVGVAVLQLKDIVEQ  147 (148)
Q Consensus       114 eKGScalcVKDyCf~r~dr~vG~~vlql~~i~~~  147 (148)
                      +...+.+.|+||=-...|+.+|.+.+.|+++.+.
T Consensus        55 ~~~~l~~~v~d~~~~~~d~~iG~~~~~l~~l~~~   88 (127)
T cd08373          55 PDESLEIVVKDYEKVGRNRLIGSATVSLQDLVSE   88 (127)
T ss_pred             CCCEEEEEEEECCCCCCCceEEEEEEEhhHcccC
Confidence            4566778888875556788999999999988753


No 102
>cd08691 C2_NEDL1-like C2 domain present in NEDL1 (NEDD4-like ubiquitin protein ligase-1). NEDL1 (AKA  HECW1(HECT, C2 and WW domain containing E3 ubiquitin protein ligase 1)) is a newly identified HECT-type E3 ubiquitin protein ligase highly expressed in favorable neuroblastomas. In vertebrates it is found primarily in neuronal tissues, including the spinal cord. NEDL1 is thought to normally function in the quality control of cellular proteins by eliminating misfolded proteins.  This is thought to be accomplished via a mechanism analogous to that of ER-associated degradation by forming tight complexes and aggregating misfolded proteins that have escaped ubiquitin-mediated degradation.  NEDL1, is composed of a C2 domain, two WW domains, and a ubiquitin ligase Hect domain. C2 domains fold into an 8-standed beta-sandwich that can adopt 2 structural arrangements: Type I and Type II, distinguished by a circular permutation involving their N- and C-terminal beta strands. Many C2 domains are C
Probab=46.52  E-value=25  Score=26.58  Aligned_cols=31  Identities=23%  Similarity=0.329  Sum_probs=25.2

Q ss_pred             eeeeEEeceeeecC---CceeEEEEEeehhhhhc
Q psy12064        117 KHQICVKDYCFARD---DRLVGVAVLQLKDIVEQ  147 (148)
Q Consensus       117 ScalcVKDyCf~r~---dr~vG~~vlql~~i~~~  147 (148)
                      .+.+.|.||..-+.   |+.+|.+.++|.++.+.
T Consensus        74 ~L~v~V~D~~~~~~~~~~d~lG~~~i~l~~l~~~  107 (137)
T cd08691          74 VLEIEVKDKFAKSRPIIRRFLGKLSIPVQRLLER  107 (137)
T ss_pred             EEEEEEEecCCCCCccCCceEEEEEEEHHHhccc
Confidence            58889999875432   78999999999999754


No 103
>cd08681 C2_fungal_Inn1p-like C2 domain found in fungal Ingression 1 (Inn1) proteins. Saccharomyces cerevisiae Inn1 associates with the contractile actomyosin ring at the end of mitosis and is needed for cytokinesis. The C2 domain of Inn1, located at the N-terminus, is required for ingression of the plasma membrane. The C-terminus is relatively unstructured and contains eight PXXP motifs that are thought to mediate interaction of Inn1 with other proteins with SH3 domains in the cytokinesis proteins Hof1 (an F-BAR protein) and Cyk3 (whose overexpression can restore primary septum formation in Inn1Delta cells) as well as recruiting Inn1 to the bud-neck by binding to Cyk3. Inn1 and Cyk3 appear to cooperate in activating chitin synthase Chs2 for primary septum formation, which allows coordination of actomyosin ring contraction with ingression of the cleavage furrow. It is thought that the C2 domain of Inn1 helps to preserve the link between the actomyosin ring and the plasma membrane, contr
Probab=46.31  E-value=30  Score=23.99  Aligned_cols=30  Identities=17%  Similarity=0.154  Sum_probs=24.7

Q ss_pred             ceeeeEEeceeeecCCceeEEEEEeehhhhh
Q psy12064        116 VKHQICVKDYCFARDDRLVGVAVLQLKDIVE  146 (148)
Q Consensus       116 GScalcVKDyCf~r~dr~vG~~vlql~~i~~  146 (148)
                      -.+.+.|.|+-... |+.+|-+.+.|.++..
T Consensus        63 ~~l~i~v~d~~~~~-~~~iG~~~~~l~~~~~   92 (118)
T cd08681          63 PILKVAVFDDDKRK-PDLIGDTEVDLSPALK   92 (118)
T ss_pred             CEEEEEEEeCCCCC-CcceEEEEEecHHHhh
Confidence            46778888887665 8999999999999864


No 104
>cd08391 C2A_C2C_Synaptotagmin_like C2 domain first and third repeat in Synaptotagmin-like proteins. Synaptotagmin is a membrane-trafficking protein characterized by a N-terminal transmembrane region, a linker, and 2 C-terminal C2 domains. Previously all synaptotagmins were thought to be calcium sensors in the regulation of neurotransmitter release and hormone secretion, but it has been shown that not all of them bind calcium.  Of the 17 identified synaptotagmins only 8 bind calcium (1-3, 5-7, 9, 10).  The function of the two C2 domains that bind calcium are: regulating the fusion step of synaptic vesicle exocytosis (C2A) and  binding to phosphatidyl-inositol-3,4,5-triphosphate (PIP3) in the absence of calcium ions and to phosphatidylinositol bisphosphate (PIP2) in their presence (C2B).  C2B also regulates also the recycling step of synaptic vesicles. C2 domains fold into an 8-standed beta-sandwich that can adopt 2 structural arrangements: Type I and Type II, distinguished by a circular
Probab=45.48  E-value=29  Score=23.85  Aligned_cols=31  Identities=16%  Similarity=0.172  Sum_probs=24.4

Q ss_pred             ceeeeEEeceeeecCCceeEEEEEeehhhhhc
Q psy12064        116 VKHQICVKDYCFARDDRLVGVAVLQLKDIVEQ  147 (148)
Q Consensus       116 GScalcVKDyCf~r~dr~vG~~vlql~~i~~~  147 (148)
                      ..+.+.|.|+=.. .|..+|.+.++|.++.+.
T Consensus        68 ~~l~i~v~d~~~~-~~~~iG~~~i~l~~l~~~   98 (121)
T cd08391          68 QELEIELFDEDPD-KDDFLGRLSIDLGSVEKK   98 (121)
T ss_pred             CEEEEEEEecCCC-CCCcEEEEEEEHHHhccc
Confidence            4667777777655 788999999999998654


No 105
>cd08675 C2B_RasGAP C2 domain second repeat of Ras GTPase activating proteins (GAPs). RasGAPs suppress Ras function by enhancing the GTPase activity of Ras proteins resulting in the inactive GDP-bound form of Ras.  In this way it can control cellular proliferation and differentiation.  The proteins here all contain two tandem C2 domains,  a Ras-GAP domain, and a pleckstrin homology (PH)-like domain. C2 domains fold into an 8-standed beta-sandwich that can adopt 2 structural arrangements: Type I and Type II, distinguished by a circular permutation involving their N- and C-terminal beta strands. Many C2 domains are Ca2+-dependent membrane-targeting modules that bind a wide variety of substances including bind phospholipids, inositol polyphosphates, and intracellular proteins.  Most C2 domain proteins are either signal transduction enzymes that contain a single C2 domain, such as protein kinase C, or membrane trafficking proteins which contain at least two C2 domains, such as synaptotagmin
Probab=45.18  E-value=31  Score=25.58  Aligned_cols=33  Identities=12%  Similarity=0.258  Sum_probs=28.4

Q ss_pred             ccceeeeEEeceeeecCCceeEEEEEeehhhhh
Q psy12064        114 EQVKHQICVKDYCFARDDRLVGVAVLQLKDIVE  146 (148)
Q Consensus       114 eKGScalcVKDyCf~r~dr~vG~~vlql~~i~~  146 (148)
                      ....+.+.|.||-....+.++|-+.++|.++..
T Consensus        76 ~~~~l~i~V~d~~~~~~~~~IG~~~i~l~~l~~  108 (137)
T cd08675          76 EKSELRVELWHASMVSGDDFLGEVRIPLQGLQQ  108 (137)
T ss_pred             cccEEEEEEEcCCcCcCCcEEEEEEEehhhccC
Confidence            556788999999988889999999999998753


No 106
>cd04041 C2A_fungal C2 domain first repeat; fungal group. C2 domains were first identified in Protein Kinase C (PKC). C2 domains fold into an 8-standed beta-sandwich that can adopt 2 structural arrangements: Type I and Type II, distinguished by a circular permutation involving their N- and C-terminal beta strands. Many C2 domains are Ca2+-dependent membrane-targeting modules that bind a wide variety of substances including bind phospholipids, inositol polyphosphates, and intracellular proteins.  Most C2 domain proteins are either signal transduction enzymes that contain a single C2 domain, such as protein kinase C, or membrane trafficking proteins which contain at least two C2 domains, such as synaptotagmin 1.  However, there are a few exceptions to this including RIM isoforms and some splice variants of piccolo/aczonin and intersectin which only have a single C2 domain.  C2 domains with a calcium binding region have negatively charged residues, primarily aspartates, that serve as ligan
Probab=44.44  E-value=31  Score=24.19  Aligned_cols=33  Identities=18%  Similarity=0.179  Sum_probs=26.1

Q ss_pred             cceeeeEEeceeeecCCceeEEEEEeehhhhhc
Q psy12064        115 QVKHQICVKDYCFARDDRLVGVAVLQLKDIVEQ  147 (148)
Q Consensus       115 KGScalcVKDyCf~r~dr~vG~~vlql~~i~~~  147 (148)
                      ...+.+.|.|+=-...|..+|.+.++++++++.
T Consensus        68 ~~~l~~~V~d~d~~~~dd~lG~~~i~l~~l~~~  100 (111)
T cd04041          68 GERLSCRLWDSDRFTADDRLGRVEIDLKELIED  100 (111)
T ss_pred             CCEEEEEEEeCCCCCCCCcceEEEEEHHHHhcC
Confidence            346777777775556788999999999999865


No 107
>PF07495 Y_Y_Y:  Y_Y_Y domain;  InterPro: IPR011123 This region is mostly found at the end of the beta propellers (IPR011110 from INTERPRO) in a family of two component regulators. However they are also found tandemly repeated in Q891H4 from SWISSPROT without other signal conduction domains being present. It is named after the conserved tyrosines found in the alignment. The exact function is not known.; PDB: 3V9F_D 3VA6_B 3OTT_B 4A2M_D 4A2L_B.
Probab=43.55  E-value=14  Score=23.34  Aligned_cols=20  Identities=15%  Similarity=0.101  Sum_probs=14.3

Q ss_pred             ccCCCCCCCceEEEeeeece
Q psy12064         74 LIGNEEQLEFFELHICVKDY   93 (148)
Q Consensus        74 ~lgne~~p~~yEL~~~VKDY   93 (148)
                      +--+..+|+.|.|+|.+||-
T Consensus        31 ~~~~~L~~G~Y~l~V~a~~~   50 (66)
T PF07495_consen   31 ISYTNLPPGKYTLEVRAKDN   50 (66)
T ss_dssp             EEEES--SEEEEEEEEEEET
T ss_pred             EEEEeCCCEEEEEEEEEECC
Confidence            33456789999999999983


No 108
>cd04033 C2_NEDD4_NEDD4L C2 domain present in the Human neural precursor cell-expressed, developmentally down-regulated 4 (NEDD4) and NEDD4-like (NEDD4L/NEDD42). Nedd4 and Nedd4-2 are two of the nine members of the Human Nedd4 family.  All vertebrates appear to have both Nedd4 and Nedd4-2 genes. They are thought to participate in the regulation of epithelial Na+ channel (ENaC) activity. They also have identical specificity for ubiquitin conjugating enzymes (E2).  Nedd4 and Nedd4-2 are composed of a C2 domain, 2-4 WW domains, and a ubiquitin ligase Hect domain. Their WW domains can bind PPxY (PY) or LPSY motifs, and in vitro studies suggest that WW3 and WW4 of both proteins bind PY motifs in the key substrates, with WW3 generally exhibiting higher affinity. Most Nedd4 family members, especially Nedd4-2, also have multiple splice variants, which might play different roles in regulating their substrates. C2 domains fold into an 8-standed beta-sandwich that can adopt 2 structural arrangemen
Probab=43.32  E-value=31  Score=24.50  Aligned_cols=30  Identities=17%  Similarity=0.153  Sum_probs=25.2

Q ss_pred             eeeeEEeceeeecCCceeEEEEEeehhhhh
Q psy12064        117 KHQICVKDYCFARDDRLVGVAVLQLKDIVE  146 (148)
Q Consensus       117 ScalcVKDyCf~r~dr~vG~~vlql~~i~~  146 (148)
                      .+.+.|.|+--...|..+|.+.+++.++..
T Consensus        68 ~l~~~v~d~~~~~~~~~iG~~~i~l~~l~~   97 (133)
T cd04033          68 RLLFEVFDENRLTRDDFLGQVEVPLNNLPT   97 (133)
T ss_pred             EEEEEEEECCCCCCCCeeEEEEEEHHHCCC
Confidence            467778888877788999999999999864


No 109
>PF08053 Tna_leader:  Tryptophanese operon leader peptide;  InterPro: IPR012620 This entry defines the apparent leader peptides of tryptophanase operons in Escherichia coli, Vibrio cholerae, Photobacterium profundum, Haemophilus influenzae, and related species. It has been suggested that these peptides act in cis to alter the behaviour of the translating ribosome []. The tryptophanese (tna) operon leader peptide catalyses the degradation of L-tryptophan to indole, pyruvate and ammonia, enabling the bacteria to utilise tryptophan as a source of carbon, nitrogen and energy. The tna operon of Escherichia coli contains two major structural genes, tnaA and tnaB. Preceding tnaA in the tna operon is a 319 -nucleotide transcribed regulatory region that contains the coding region for a 24-residue leader peptide, TnaC. The RNA sequence in the vicinity of the tnaC stop codon is rich in Cytidylate residues which is required for efficient Rho -dependent termination in the leader region of the tna operon [].; GO: 0031554 regulation of transcription termination, DNA-dependent, 0031556 transcriptional attenuation by ribosome
Probab=43.31  E-value=23  Score=20.79  Aligned_cols=18  Identities=44%  Similarity=0.811  Sum_probs=14.3

Q ss_pred             EEEeeeeceeeccCCeee
Q psy12064         85 ELHICVKDYCFARDDRLV  102 (148)
Q Consensus        85 EL~~~VKDYCFar~Dr~v  102 (148)
                      -||+||-..+|--+.++|
T Consensus         3 ilhicvtskwfnidnkiv   20 (24)
T PF08053_consen    3 ILHICVTSKWFNIDNKIV   20 (24)
T ss_pred             eEEEEEeeeeEeccCeec
Confidence            378898888888777765


No 110
>cd04014 C2_PKC_epsilon C2 domain in Protein Kinase C (PKC) epsilon. A single C2 domain is found in PKC epsilon. The PKC family of serine/threonine kinases regulates apoptosis, proliferation, migration, motility, chemo-resistance, and differentiation.  There are 3 groups: group 1 (alpha, betaI, beta II, gamma) which require phospholipids and calcium, group 2 (delta, epsilon, theta, eta) which do not require calcium for activation, and group 3 (xi, iota/lambda) which are atypical and can be activated in the absence of diacylglycerol and calcium. C2 domains fold into an 8-standed beta-sandwich that can adopt 2 structural arrangements: Type I and Type II, distinguished by a circular permutation involving their N- and C-terminal beta strands. Many C2 domains are Ca2+-dependent membrane-targeting modules that bind a wide variety of substances including bind phospholipids, inositol polyphosphates, and intracellular proteins.  Most C2 domain proteins are either signal transduction enzymes that
Probab=42.76  E-value=37  Score=24.36  Aligned_cols=33  Identities=12%  Similarity=0.217  Sum_probs=25.7

Q ss_pred             ccceeeeEEeceeeecCCceeEEEEEeehhhhh
Q psy12064        114 EQVKHQICVKDYCFARDDRLVGVAVLQLKDIVE  146 (148)
Q Consensus       114 eKGScalcVKDyCf~r~dr~vG~~vlql~~i~~  146 (148)
                      +...+.+.|.|+--...|.++|.+.++|.++..
T Consensus        72 ~~~~l~~~v~d~~~~~~~~~iG~~~i~l~~l~~  104 (132)
T cd04014          72 NGRNLELTVFHDAAIGPDDFVANCTISFEDLIQ  104 (132)
T ss_pred             CCCEEEEEEEeCCCCCCCceEEEEEEEhHHhcc
Confidence            345677777777656678899999999998875


No 111
>PRK01305 arginyl-tRNA-protein transferase; Provisional
Probab=42.57  E-value=75  Score=26.95  Aligned_cols=62  Identities=21%  Similarity=0.415  Sum_probs=39.2

Q ss_pred             hhhhhHHHHHHHHHhhcccCC----------cccCCCCCCCceEEEeeeeceeeccCCeeeeeeeeeccchhccceeeeE
Q psy12064         52 YTQTTDALIKTFVQSQCNEGR----------DLIGNEEQLEFFELHICVKDYCFARDDRLVGVAVLQLKDIVEQVKHQIC  121 (148)
Q Consensus        52 ytqtTd~LIk~fv~tQ~~qgn----------d~lgne~~p~~yEL~~~VKDYCFar~Dr~vG~av~qL~~iAeKGScalc  121 (148)
                      +|+---.|-++++.+=+.+|.          ++|-+. ..+.+++..-       .+|++|||+|+   |+.+.|--++ 
T Consensus       104 ~~~E~~~Ly~rY~~~rH~dg~m~~~~~~~y~~Fl~~~-~~~t~~~ey~-------~~g~LiaVav~---D~l~d~lSAV-  171 (240)
T PRK01305        104 FTEEHYALYRRYLRARHADGGMDPPSRDQYAQFLEDS-WVNTRFIEFR-------GDGKLVAVAVT---DVLDDGLSAV-  171 (240)
T ss_pred             CCHHHHHHHHHHHHHhcCCCCCCCCCHHHHHHHHhcC-CCCcEEEEEE-------eCCeEEEEEEE---eccCCceeeE-
Confidence            333444677777777776662          155544 3455655433       68999999997   6777776664 


Q ss_pred             Eeceeee
Q psy12064        122 VKDYCFA  128 (148)
Q Consensus       122 VKDyCf~  128 (148)
                         |+|=
T Consensus       172 ---Y~Fy  175 (240)
T PRK01305        172 ---YTFY  175 (240)
T ss_pred             ---EEee
Confidence               6663


No 112
>cd08384 C2B_Rabphilin_Doc2 C2 domain second repeat present in Rabphilin and Double C2 domain. Rabphilin is found neurons and in neuroendrocrine cells, while Doc2 is found not only in the brain but in tissues, including mast cells, chromaffin cells, and osteoblasts.  Rabphilin and Doc2s share highly homologous tandem C2 domains, although their N-terminal structures are completely different: rabphilin contains an N-terminal Rab-binding domain (RBD),7 whereas Doc2 contains an N-terminal Munc13-1-interacting domain (MID). C2 domains fold into an 8-standed beta-sandwich that can adopt 2 structural arrangements: Type I and Type II, distinguished by a circular permutation involving their N- and C-terminal beta strands. Many C2 domains are Ca2+-dependent membrane-targeting modules that bind a wide variety of substances including bind phospholipids, inositol polyphosphates, and intracellular proteins.  Most C2 domain proteins are either signal transduction enzymes that contain a single C2 domai
Probab=42.41  E-value=22  Score=25.39  Aligned_cols=30  Identities=20%  Similarity=0.192  Sum_probs=24.8

Q ss_pred             CceEEEeeeeceeeccCCeeeeeeeeeccc
Q psy12064         82 EFFELHICVKDYCFARDDRLVGVAVLQLKD  111 (148)
Q Consensus        82 ~~yEL~~~VKDYCFar~Dr~vG~av~qL~~  111 (148)
                      ....|++.|.||=....|.++|-+.+.+..
T Consensus        79 ~~~~l~~~V~d~d~~~~~~~lG~~~i~l~~  108 (133)
T cd08384          79 AKKTLEITVWDKDIGKSNDYIGGLQLGINA  108 (133)
T ss_pred             CCCEEEEEEEeCCCCCCccEEEEEEEecCC
Confidence            345689999999877788899999999875


No 113
>cd08688 C2_KIAA0528-like C2 domain found in the Human KIAA0528 cDNA clone. The members of this CD are named after the Human KIAA0528 cDNA clone.  All members here contain a single C2 repeat.  No other information on this protein is currently known. The C2 domain was first identified in PKC.  C2 domains fold into an 8-standed beta-sandwich that can adopt 2 structural arrangements: Type I and Type II, distinguished by a circular permutation involving their N- and C-terminal beta strands. Many C2 domains are Ca2+-dependent membrane-targeting modules that bind a wide variety of substances including bind phospholipids, inositol polyphosphates, and intracellular proteins.  Most C2 domain proteins are either signal transduction enzymes that contain a single C2 domain, such as protein kinase C, or membrane trafficking proteins which contain at least two C2 domains, such as synaptotagmin 1.  However, there are a few exceptions to this including RIM isoforms and some splice variants of piccolo/a
Probab=41.52  E-value=36  Score=23.77  Aligned_cols=31  Identities=19%  Similarity=0.150  Sum_probs=26.8

Q ss_pred             ceeeeEEeceeeecCCceeEEEEEeehhhhh
Q psy12064        116 VKHQICVKDYCFARDDRLVGVAVLQLKDIVE  146 (148)
Q Consensus       116 GScalcVKDyCf~r~dr~vG~~vlql~~i~~  146 (148)
                      ..+.+.|.|+-..+.|.++|-+.+.|++++.
T Consensus        64 ~~l~i~V~d~d~~~~~~~iG~~~~~l~~l~~   94 (110)
T cd08688          64 EPLQIRVMDHDTYSANDAIGKVYIDLNPLLL   94 (110)
T ss_pred             CeEEEEEEeCCCCCCCCceEEEEEeHHHhcc
Confidence            4677888888877888999999999999976


No 114
>PRK09806 tryptophanase leader peptide; Provisional
Probab=41.35  E-value=28  Score=20.81  Aligned_cols=18  Identities=44%  Similarity=0.811  Sum_probs=14.5

Q ss_pred             EEEeeeeceeeccCCeee
Q psy12064         85 ELHICVKDYCFARDDRLV  102 (148)
Q Consensus        85 EL~~~VKDYCFar~Dr~v  102 (148)
                      -||+||-..+|--+.++|
T Consensus         3 ilhicvtskwfnidnkiv   20 (26)
T PRK09806          3 ILHICVTSKWFNIDNKIV   20 (26)
T ss_pred             EEEEEEeeeEEeccCeee
Confidence            378899888888877776


No 115
>PLN03008 Phospholipase D delta
Probab=41.19  E-value=50  Score=33.25  Aligned_cols=32  Identities=25%  Similarity=0.342  Sum_probs=24.6

Q ss_pred             EEEeeeeceeeccCCeeeeeeeeeccchhccce
Q psy12064         85 ELHICVKDYCFARDDRLVGVAVLQLKDIVEQVK  117 (148)
Q Consensus        85 EL~~~VKDYCFar~Dr~vG~av~qL~~iAeKGS  117 (148)
                      +|+++||||=.... .++|.|.+||.++..-..
T Consensus       118 ~L~f~VkD~D~~ga-D~IG~a~IPL~~L~~Ge~  149 (868)
T PLN03008        118 YLEFQVKDDDVFGA-QIIGTAKIPVRDIASGER  149 (868)
T ss_pred             eEEEEEEcCCccCC-ceeEEEEEEHHHcCCCCc
Confidence            78888998877764 589999999998765433


No 116
>PLN03008 Phospholipase D delta
Probab=40.40  E-value=36  Score=34.17  Aligned_cols=50  Identities=18%  Similarity=0.269  Sum_probs=39.9

Q ss_pred             ccCCCCCCCce-EEEeeeeceeeccCCeeeeeeeeeccchhccceeeeEEeceeeecCCceeEEEEEeehhhh
Q psy12064         74 LIGNEEQLEFF-ELHICVKDYCFARDDRLVGVAVLQLKDIVEQVKHQICVKDYCFARDDRLVGVAVLQLKDIV  145 (148)
Q Consensus        74 ~lgne~~p~~y-EL~~~VKDYCFar~Dr~vG~av~qL~~iAeKGScalcVKDyCf~r~dr~vG~~vlql~~i~  145 (148)
                      ++.|+..|.+. ++|+.|.|                   -  ...+.++||||=.... .++|.+.|+|.+|.
T Consensus        95 Vi~n~~NPvWNE~F~f~vah-------------------~--~s~L~f~VkD~D~~ga-D~IG~a~IPL~~L~  145 (868)
T PLN03008         95 VLKNSQEPLWDEKFNISIAH-------------------P--FAYLEFQVKDDDVFGA-QIIGTAKIPVRDIA  145 (868)
T ss_pred             eCCCCCCCCcceeEEEEecC-------------------C--CceEEEEEEcCCccCC-ceeEEEEEEHHHcC
Confidence            56788899999 78887765                   1  1367899999877764 68999999999875


No 117
>cd08521 C2A_SLP C2 domain first repeat present in Synaptotagmin-like proteins. All Slp members basically share an N-terminal Slp homology domain (SHD) and C-terminal tandem C2 domains (named the C2A domain and the C2B domain) with the SHD and C2 domains being separated by a linker sequence of various length.  Slp1/JFC1 and Slp2/exophilin 4 promote granule docking to the plasma membrane.  Additionally, their C2A domains are both Ca2+ independent, unlike the case in Slp3 and Slp4/granuphilin in which their C2A domains are Ca2+ dependent.  It is thought that SHD (except for the Slp4-SHD) functions as a specific Rab27A/B-binding domain. In addition to Slps, rabphilin, Noc2, and  Munc13-4 also function as Rab27-binding proteins. It has been demonstrated that Slp3 and Slp4/granuphilin promote dense-core vesicle exocytosis. Slp5 mRNA has been shown to be restricted to human placenta and liver suggesting a role in Rab27A-dependent membrane trafficking in specific tissues. C2 domains fold into 
Probab=40.28  E-value=41  Score=23.36  Aligned_cols=30  Identities=13%  Similarity=0.051  Sum_probs=24.9

Q ss_pred             cceeeeEEeceeeecCCceeEEEEEeehhh
Q psy12064        115 QVKHQICVKDYCFARDDRLVGVAVLQLKDI  144 (148)
Q Consensus       115 KGScalcVKDyCf~r~dr~vG~~vlql~~i  144 (148)
                      ...+.+.|.|+--...+..+|.+.++|.++
T Consensus        82 ~~~l~i~v~d~~~~~~~~~iG~~~i~l~~l  111 (123)
T cd08521          82 TRTLQLSVWHHDRFGRNTFLGEVEIPLDSW  111 (123)
T ss_pred             CCEEEEEEEeCCCCcCCceeeEEEEecccc
Confidence            346788888887667788999999999887


No 118
>cd04021 C2_E3_ubiquitin_ligase C2 domain present in E3 ubiquitin ligase. E3 ubiquitin ligase is part of the ubiquitylation mechanism responsible for controlling surface expression of membrane proteins.  The sequential action of several enzymes are involved: ubiquitin-activating enzyme E1, ubiquitin-conjugating enzyme E2, and ubiquitin-protein ligase E3 which is responsible for substrate recognition and promoting the transfer of ubiquitin to the target protein.  E3 ubiquitin ligase is composed of an N-terminal C2 domain, 4 WW domains, and a HECTc domain.  C2 domains fold into an 8-standed beta-sandwich that can adopt 2 structural arrangements: Type I and Type II, distinguished by a circular permutation involving their N- and C-terminal beta strands. Many C2 domains are Ca2+-dependent membrane-targeting modules that bind a wide variety of substances including bind phospholipids, inositol polyphosphates, and intracellular proteins.  Most C2 domain proteins are either signal transduction e
Probab=40.12  E-value=43  Score=24.17  Aligned_cols=32  Identities=28%  Similarity=0.304  Sum_probs=26.9

Q ss_pred             ceeeeEEeceeeecCCceeEEEEEeehhhhhc
Q psy12064        116 VKHQICVKDYCFARDDRLVGVAVLQLKDIVEQ  147 (148)
Q Consensus       116 GScalcVKDyCf~r~dr~vG~~vlql~~i~~~  147 (148)
                      ..+.+.|.|+=-.+.|..+|.+.++|.++.+.
T Consensus        61 ~~l~~~V~d~~~~~~~~~iG~~~i~l~~l~~~   92 (125)
T cd04021          61 STLEFKVWSHHTLKADVLLGEASLDLSDILKN   92 (125)
T ss_pred             CEEEEEEEeCCCCCCCcEEEEEEEEHHHhHhh
Confidence            45778888888788899999999999998753


No 119
>PF00168 C2:  C2 domain;  InterPro: IPR000008 The C2 domain is a Ca2+-dependent membrane-targeting module found in many cellular proteins involved in signal transduction or membrane trafficking. C2 domains are unique among membrane targeting domains in that they show wide range of lipid selectivity for the major components of cell membranes, including phosphatidylserine and phosphatidylcholine. This C2 domain is about 116 amino-acid residues and is located between the two copies of the C1 domain in Protein Kinase C (that bind phorbol esters and diacylglycerol) (see PDOC00379 from PROSITEDOC) and the protein kinase catalytic domain (see PDOC00100 from PROSITEDOC). Regions with significant homology [] to the C2-domain have been found in many proteins. The C2 domain is thought to be involved in calcium-dependent phospholipid binding [] and in membrane targetting processes such as subcellular localisation. The 3D structure of the C2 domain of synaptotagmin has been reported [], the domain forms an eight-stranded beta sandwich constructed around a conserved 4-stranded motif, designated a C2 key []. Calcium binds in a cup-shaped depression formed by the N- and C-terminal loops of the C2-key motif. Structural analyses of several C2 domains have shown them to consist of similar ternary structures in which three Ca2+-binding loops are located at the end of an 8 stranded antiparallel beta sandwich. ; GO: 0005515 protein binding; PDB: 1RSY_A 1BYN_A 3NSJ_A 3QR1_D 3HN8_C 1DQV_A 3M7F_B 3KWU_A 3KWT_A 1V27_A ....
Probab=39.55  E-value=30  Score=21.51  Aligned_cols=20  Identities=30%  Similarity=0.210  Sum_probs=18.6

Q ss_pred             EEeeeeceeeccCCeeeeee
Q psy12064         86 LHICVKDYCFARDDRLVGVA  105 (148)
Q Consensus        86 L~~~VKDYCFar~Dr~vG~a  105 (148)
                      |++.|.|+-.-+.|+++|.+
T Consensus        65 l~~~V~~~~~~~~~~~iG~~   84 (85)
T PF00168_consen   65 LSFEVWDKDSFGKDELIGEV   84 (85)
T ss_dssp             EEEEEEEETSSSSEEEEEEE
T ss_pred             eEEEEEECCCCCCCCEEEEE
Confidence            99999999999999999976


No 120
>cd04019 C2C_MCTP_PRT_plant C2 domain third repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP); plant subset. MCTPs are involved in Ca2+ signaling at the membrane.  Plant-MCTPs are composed of a variable N-terminal sequence, four C2 domains, two transmembrane regions (TMRs), and a short C-terminal sequence.  It is one of four protein classes that are anchored to membranes via a transmembrane region; the others being synaptotagmins, extended synaptotagmins, and ferlins. MCTPs are the only membrane-bound C2 domain proteins that contain two functional TMRs. MCTPs are unique in that they bind Ca2+ but not phospholipids. C2 domains fold into an 8-standed beta-sandwich that can adopt 2 structural arrangements: Type I and Type II, distinguished by a circular permutation involving their N- and C-terminal beta strands. Many C2 domains are Ca2+-dependent membrane-targeting modules that bind a wide variety of substances including bind phospholipids, inositol polyphosphates
Probab=39.50  E-value=35  Score=25.93  Aligned_cols=30  Identities=33%  Similarity=0.424  Sum_probs=24.7

Q ss_pred             EEEeeeeceeeccCCeeeeeeeeeccchhc
Q psy12064         85 ELHICVKDYCFARDDRLVGVAVLQLKDIVE  114 (148)
Q Consensus        85 EL~~~VKDYCFar~Dr~vG~av~qL~~iAe  114 (148)
                      +|.+.|+|+=-.+.|..+|.+.++|.++..
T Consensus        63 ~l~v~V~d~~~~~~dd~lG~v~i~L~~l~~   92 (150)
T cd04019          63 HLILSVEDRVGPNKDEPLGRAVIPLNDIER   92 (150)
T ss_pred             eEEEEEEEecCCCCCCeEEEEEEEHHHCcc
Confidence            688888887544578999999999999864


No 121
>cd08682 C2_Rab11-FIP_classI C2 domain found in Rab11-family interacting proteins (FIP) class I. Rab GTPases recruit various effector proteins to organelles and vesicles.  Rab11-family interacting proteins (FIPs) are involved in mediating the role of Rab11. FIPs can be divided into three classes: class I FIPs (Rip11a, Rip11b, RCP, and FIP2) which contain a C2 domain after N-terminus of the protein, class II FIPs (FIP3 and FIP4) which contain two EF-hands and a proline rich region, and class III FIPs (FIP1) which exhibits no homology to known protein domains. All FIP proteins contain a highly conserved, 20-amino acid motif at the C-terminus of the protein, known as Rab11/25 binding domain (RBD).  Class I FIPs are thought to bind to endocytic membranes via their C2 domain, which interacts directly with phospholipids. Class II FIPs do not have any membrane binding domains leaving much to speculate about the mechanism involving FIP3 and FIP4 interactions with endocytic membranes. The member
Probab=38.11  E-value=64  Score=22.92  Aligned_cols=32  Identities=19%  Similarity=0.290  Sum_probs=25.3

Q ss_pred             ccceeeeEEeceeeecCCceeEEEEEeehhhh
Q psy12064        114 EQVKHQICVKDYCFARDDRLVGVAVLQLKDIV  145 (148)
Q Consensus       114 eKGScalcVKDyCf~r~dr~vG~~vlql~~i~  145 (148)
                      +...+.+.|.|+=-...|.++|.+.++|+++.
T Consensus        63 ~~~~l~~~v~d~~~~~~d~~iG~~~i~l~~l~   94 (126)
T cd08682          63 NRATLQLTVMHRNLLGLDKFLGQVSIPLNDLD   94 (126)
T ss_pred             cCCEEEEEEEEccccCCCceeEEEEEEHHHhh
Confidence            44577888888754456889999999999986


No 122
>cd08677 C2A_Synaptotagmin-13 C2 domain. Synaptotagmin is a membrane-trafficking protein characterized by a N-terminal transmembrane region, a linker, and 2 C-terminal C2 domains. Synaptotagmin 13, a member of class 6 synaptotagmins, is located in the brain.  It functions are unknown. It, like synaptotagmins 8 and 12, does not have any consensus Ca2+ binding sites. Previously all synaptotagmins were thought to be calcium sensors in the regulation of neurotransmitter release and hormone secretion, but it has been shown that not all of them bind calcium.  Of the 17 identified synaptotagmins only 8 bind calcium (1-3, 5-7, 9, 10).  The function of the two C2 domains that bind calcium are: regulating the fusion step of synaptic vesicle exocytosis (C2A) and  binding to phosphatidyl-inositol-3,4,5-triphosphate (PIP3) in the absence of calcium ions and to phosphatidylinositol bisphosphate (PIP2) in their presence (C2B).  C2B also regulates also the recycling step of synaptic vesicles. C2 domain
Probab=38.08  E-value=30  Score=26.25  Aligned_cols=40  Identities=20%  Similarity=0.184  Sum_probs=29.2

Q ss_pred             CCCCceEEEeeeecee-eccCCeeeeeeeeeccchhccceee
Q psy12064         79 EQLEFFELHICVKDYC-FARDDRLVGVAVLQLKDIVEQVKHQ  119 (148)
Q Consensus        79 ~~p~~yEL~~~VKDYC-Far~Dr~vG~av~qL~~iAeKGSca  119 (148)
                      ++...-.|+++|-||= |.| +.+||-+.++|.++.......
T Consensus        73 ~~l~~~tL~~~V~d~Drfs~-~d~IG~v~l~l~~~~~~~~~~  113 (118)
T cd08677          73 EESLDGTLTLTLRCCDRFSR-HSTLGELRLKLADVSMMLGAA  113 (118)
T ss_pred             HHhCCcEEEEEEEeCCCCCC-CceEEEEEEccccccCCcccc
Confidence            4455667999998884 455 457999999999986555555


No 123
>PF06041 DUF924:  Bacterial protein of unknown function (DUF924);  InterPro: IPR010323 This entry consists of several hypothetical bacterial proteins of unknown function.; PDB: 2I6H_B.
Probab=37.81  E-value=23  Score=28.51  Aligned_cols=73  Identities=18%  Similarity=0.269  Sum_probs=43.2

Q ss_pred             HHHHHHHHHHHHhhhhcCCCccccc----cccCcchhhHHHHHhhhhhhhHH-------HHHHHHHhhccc-------C-
Q psy12064         11 ALLDASLDSIKNYFHAAGNGLKKTY----LDKSPELASLRYALSLYTQTTDA-------LIKTFVQSQCNE-------G-   71 (148)
Q Consensus        11 avld~aldtiK~yFhagg~GlKk~f----Leks~~l~slryalsLytqtTd~-------LIk~fv~tQ~~q-------g-   71 (148)
                      ..+++|+..|.+-++..=....+.|    |++|.++.....++.|+..--+.       .++.|+.....-       | 
T Consensus        84 ~Al~la~~~i~~g~~~~l~~~~r~F~ymPl~HSE~l~~q~~~v~l~~~l~~~~~~~~~~~~~~~~~~a~~H~~iI~rFGR  163 (188)
T PF06041_consen   84 LALALARRAIERGWDQQLPPVERVFFYMPLMHSEDLEDQERAVRLFERLAEDAPGDARPFFKGFLDFAKRHRDIIERFGR  163 (188)
T ss_dssp             HHHHHHHHHHHTTHHHHS-HHHHGGGTHHHHCSSSHHHHHHHHHHHTTT------HH------HHHHHHHHHHHHHHHSS
T ss_pred             HHHHHHHHHHHcCCcccCCHHHHHHeeeccccCCCHHHHHHHHHHHHHHhcccccchhhhHHHHHHHHHHHHHHHHHhCC
Confidence            3466777777766665555556666    68999999999999999887222       233344333222       4 


Q ss_pred             ----CcccCCCCCCCc
Q psy12064         72 ----RDLIGNEEQLEF   83 (148)
Q Consensus        72 ----nd~lgne~~p~~   83 (148)
                          |.+||.+..|++
T Consensus       164 fPhRN~~LGR~sT~eE  179 (188)
T PF06041_consen  164 FPHRNAALGRESTPEE  179 (188)
T ss_dssp             -GGGCCCCT----HHH
T ss_pred             CcccccccCCCCCHHH
Confidence                889999877754


No 124
>cd04027 C2B_Munc13 C2 domain second repeat in Munc13 (mammalian uncoordinated) proteins. C2-like domains are thought to be involved in phospholipid binding in a Ca2+ independent manner in both Unc13 and Munc13. Caenorabditis elegans Unc13 has a central domain with sequence similarity to PKC, which includes C1 and C2-related domains. Unc13 binds phorbol esters and DAG with high affinity in a phospholipid manner.  Mutations in Unc13 results in abnormal neuronal connections and impairment in cholinergic neurotransmission in the nematode.  Munc13 is the mammalian homolog which are expressed in the brain.  There are 3 isoforms (Munc13-1, -2, -3) and are thought to play a role in neurotransmitter release and are hypothesized to be high-affinity receptors for phorbol esters.  Unc13 and Munc13 contain both C1 and C2 domains.  There are two C2 related domains present, one central and one at the carboxyl end.  Munc13-1 contains a third C2-like domain.  Munc13 interacts with syntaxin, synaptobrev
Probab=36.52  E-value=1.2e+02  Score=21.74  Aligned_cols=31  Identities=13%  Similarity=0.352  Sum_probs=22.9

Q ss_pred             EEEeeeece-----------eeccCCeeeeeeeeeccchhcc
Q psy12064         85 ELHICVKDY-----------CFARDDRLVGVAVLQLKDIVEQ  115 (148)
Q Consensus        85 EL~~~VKDY-----------CFar~Dr~vG~av~qL~~iAeK  115 (148)
                      .|.+.|-|+           |....|..+|.+.++|+++.+.
T Consensus        62 ~l~i~v~d~d~~~~~~~~~~~~~~~~~~iG~~~i~l~~~~~~  103 (127)
T cd04027          62 RIKVRVWDEDDDIKSRLKQKFTRESDDFLGQTIIEVRTLSGE  103 (127)
T ss_pred             EEEEEEEECCCCcccccceeccccCCCcceEEEEEhHHccCC
Confidence            466666665           4456799999999999988543


No 125
>cd08382 C2_Smurf-like C2 domain present in Smad ubiquitination-related factor (Smurf)-like proteins. A single C2 domain is found in Smurf proteins, C2-WW-HECT-domain E3s, which play an important role in the downregulation of the TGF-beta signaling pathway.  Smurf proteins also regulate cell shape, motility, and polarity by degrading small guanosine triphosphatases (GTPases). C2 domains fold into an 8-standed beta-sandwich that can adopt 2 structural arrangements: Type I and Type II, distinguished by a circular permutation involving their N- and C-terminal beta strands. Many C2 domains are Ca2+-dependent membrane-targeting modules that bind a wide variety of substances including bind phospholipids, inositol polyphosphates, and intracellular proteins.  Most C2 domain proteins are either signal transduction enzymes that contain a single C2 domain, such as protein kinase C, or membrane trafficking proteins which contain at least two C2 domains, such as synaptotagmin 1.  However, there are 
Probab=36.14  E-value=50  Score=23.60  Aligned_cols=32  Identities=16%  Similarity=0.140  Sum_probs=23.9

Q ss_pred             ceeeeEEeceeeec--CCceeEEEEEeehhhhhc
Q psy12064        116 VKHQICVKDYCFAR--DDRLVGVAVLQLKDIVEQ  147 (148)
Q Consensus       116 GScalcVKDyCf~r--~dr~vG~~vlql~~i~~~  147 (148)
                      -.+.+.|.|+--..  .|..+|.+.+++.++.+.
T Consensus        60 ~~l~i~V~d~~~~~~~~d~~lG~~~i~l~~l~~~   93 (123)
T cd08382          60 SIITIQVFDQKKFKKKDQGFLGCVRIRANAVLPL   93 (123)
T ss_pred             CEEEEEEEECCCCCCCCCceEeEEEEEHHHcccc
Confidence            36667777775443  378999999999998753


No 126
>cd08378 C2B_MCTP_PRT_plant C2 domain second repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP); plant subset. MCTPs are involved in Ca2+ signaling at the membrane.  Plant-MCTPs are composed of a variable N-terminal sequence, four C2 domains, two transmembrane regions (TMRs), and a short C-terminal sequence.  It is one of four protein classes that are anchored to membranes via a transmembrane region; the others being synaptotagmins, extended synaptotagmins, and ferlins. MCTPs are the only membrane-bound C2 domain proteins that contain two functional TMRs. MCTPs are unique in that they bind Ca2+ but not phospholipids. C2 domains fold into an 8-standed beta-sandwich that can adopt 2 structural arrangements: Type I and Type II, distinguished by a circular permutation involving their N- and C-terminal beta strands. Many C2 domains are Ca2+-dependent membrane-targeting modules that bind a wide variety of substances including bind phospholipids, inositol polyphosphate
Probab=35.85  E-value=46  Score=24.01  Aligned_cols=38  Identities=24%  Similarity=0.325  Sum_probs=28.6

Q ss_pred             CCCCCceEEEeeeeceeeccCCeeeeeeeeeccchhccc
Q psy12064         78 EEQLEFFELHICVKDYCFARDDRLVGVAVLQLKDIVEQV  116 (148)
Q Consensus        78 e~~p~~yEL~~~VKDYCFar~Dr~vG~av~qL~~iAeKG  116 (148)
                      ...|..-.|++.|.|+=-. .|.++|.+.++|.++...+
T Consensus        51 ~~~~~~~~L~~~v~d~d~~-~~~~lG~~~i~l~~l~~~~   88 (121)
T cd08378          51 KDRLQGSTLEVSVWDKDKA-KDDFLGGVCFDLSEVPTRV   88 (121)
T ss_pred             cCCCcCCEEEEEEEeCCCC-cCceeeeEEEEhHhCcCCC
Confidence            3445566788888887322 6889999999999997643


No 127
>cd04043 C2_Munc13_fungal C2 domain in Munc13 (mammalian uncoordinated) proteins; fungal group. C2-like domains are thought to be involved in phospholipid binding in a Ca2+ independent manner in both Unc13 and Munc13. Caenorabditis elegans Unc13 has a central domain with sequence similarity to PKC, which includes C1 and C2-related domains. Unc13 binds phorbol esters and DAG with high affinity in a phospholipid manner.  Mutations in Unc13 results in abnormal neuronal connections and impairment in cholinergic neurotransmission in the nematode.  Munc13 is the mammalian homolog which are expressed in the brain.  There are 3 isoforms (Munc13-1, -2, -3) and are thought to play a role in neurotransmitter release and are hypothesized to be high-affinity receptors for phorbol esters.  Unc13 and Munc13 contain both C1 and C2 domains.  There are two C2 related domains present, one central and one at the carboxyl end.  Munc13-1 contains a third C2-like domain.  Munc13 interacts with syntaxin, synap
Probab=35.81  E-value=51  Score=23.14  Aligned_cols=31  Identities=26%  Similarity=0.217  Sum_probs=25.6

Q ss_pred             ceEEEeeeeceeeccCCeeeeeeeeeccchh
Q psy12064         83 FFELHICVKDYCFARDDRLVGVAVLQLKDIV  113 (148)
Q Consensus        83 ~yEL~~~VKDYCFar~Dr~vG~av~qL~~iA  113 (148)
                      .-.|.+.|.|+=....|.++|.+.++|.++.
T Consensus        64 ~~~L~i~v~d~d~~~~~~~iG~~~i~l~~~~   94 (126)
T cd04043          64 PLWISATVWDRSFVGKHDLCGRASLKLDPKR   94 (126)
T ss_pred             CCEEEEEEEECCCCCCCceEEEEEEecCHHH
Confidence            3478888888876678999999999998864


No 128
>cd00275 C2_PLC_like C2 domain present in Phosphoinositide-specific phospholipases C (PLC). PLCs are involved in the hydrolysis of phosphatidylinositol-4,5-bisphosphate (PIP2) to d-myo-inositol-1,4,5-trisphosphate (1,4,5-IP3) and sn-1,2-diacylglycerol (DAG).   1,4,5-IP3 and DAG are second messengers in eukaryotic signal transduction cascades. PLC is composed of a N-terminal PH domain followed by a series of EF hands, a catalytic TIM barrel and a C-terminal C2 domain. C2 domains fold into an 8-standed beta-sandwich that can adopt 2 structural arrangements: Type I and Type II, distinguished by a circular permutation involving their N- and C-terminal beta strands. Many C2 domains are Ca2+-dependent membrane-targeting modules that bind a wide variety of substances including bind phospholipids, inositol polyphosphates, and intracellular proteins.  Most C2 domain proteins are either signal transduction enzymes that contain a single C2 domain, such as protein kinase C, or membrane trafficking 
Probab=35.56  E-value=49  Score=22.97  Aligned_cols=28  Identities=29%  Similarity=0.300  Sum_probs=23.1

Q ss_pred             eeeeEEeceeeecCCceeEEEEEeehhhh
Q psy12064        117 KHQICVKDYCFARDDRLVGVAVLQLKDIV  145 (148)
Q Consensus       117 ScalcVKDyCf~r~dr~vG~~vlql~~i~  145 (148)
                      .+.+.|.|+... .|.++|.+.++|+++.
T Consensus        73 ~l~~~V~d~~~~-~~~~iG~~~~~l~~l~  100 (128)
T cd00275          73 FLRFVVYDEDSG-DDDFLGQACLPLDSLR  100 (128)
T ss_pred             EEEEEEEeCCCC-CCcEeEEEEEEhHHhc
Confidence            366788888877 7889999999999874


No 129
>cd00276 C2B_Synaptotagmin C2 domain second repeat present in Synaptotagmin. Synaptotagmin is a membrane-trafficking protein characterized by a N-terminal transmembrane region, a linker, and 2 C-terminal C2 domains. There are several classes of Synaptotagmins. Previously all synaptotagmins were thought to be calcium sensors in the regulation of neurotransmitter release and hormone secretion, but it has been shown that not all of them bind calcium.  Of the 17 identified synaptotagmins only 8 bind calcium (1-3, 5-7, 9, 10).  The function of the two C2 domains that bind calcium are: regulating the fusion step of synaptic vesicle exocytosis (C2A) and  binding to phosphatidyl-inositol-3,4,5-triphosphate (PIP3) in the absence of calcium ions and to phosphatidylinositol bisphosphate (PIP2) in their presence (C2B).  C2B also regulates also the recycling step of synaptic vesicles. C2 domains fold into an 8-standed beta-sandwich that can adopt 2 structural arrangements: Type I and Type II, distin
Probab=35.38  E-value=48  Score=23.20  Aligned_cols=30  Identities=27%  Similarity=0.266  Sum_probs=26.3

Q ss_pred             ccceeeeEEeceeeecCCceeEEEEEeehh
Q psy12064        114 EQVKHQICVKDYCFARDDRLVGVAVLQLKD  143 (148)
Q Consensus       114 eKGScalcVKDyCf~r~dr~vG~~vlql~~  143 (148)
                      +...+.+.|.|+-....++++|.+.++|.+
T Consensus        80 ~~~~l~~~v~d~~~~~~~~~lG~~~i~l~~  109 (134)
T cd00276          80 EEVSLVITVVDKDSVGRNEVIGQVVLGPDS  109 (134)
T ss_pred             CCcEEEEEEEecCCCCCCceeEEEEECCCC
Confidence            457789999999887889999999999987


No 130
>cd04015 C2_plant_PLD C2 domain present in plant phospholipase D (PLD). PLD hydrolyzes terminal phosphodiester bonds in diester glycerophospholipids resulting in the degradation of phospholipids.  In vitro PLD transfers phosphatidic acid to primary alcohols.  In plants PLD plays a role in germination, seedling growth, phosphatidylinositol metabolism, and changes in phospholipid composition.  There is a single Ca(2+)/phospholipid-binding C2 domain in PLD. C2 domains fold into an 8-standed beta-sandwich that can adopt 2 structural arrangements: Type I and Type II, distinguished by a circular permutation involving their N- and C-terminal beta strands. Many C2 domains are Ca2+-dependent membrane-targeting modules that bind a wide variety of substances including bind phospholipids, inositol polyphosphates, and intracellular proteins.  Most C2 domain proteins are either signal transduction enzymes that contain a single C2 domain, such as protein kinase C, or membrane trafficking proteins whic
Probab=34.99  E-value=51  Score=25.14  Aligned_cols=29  Identities=24%  Similarity=0.415  Sum_probs=23.1

Q ss_pred             eeeeEEeceeeecCCceeEEEEEeehhhhh
Q psy12064        117 KHQICVKDYCFARDDRLVGVAVLQLKDIVE  146 (148)
Q Consensus       117 ScalcVKDyCf~r~dr~vG~~vlql~~i~~  146 (148)
                      ++.+.|||+-... +.++|.+.++|.++..
T Consensus        99 ~l~~~V~d~d~~~-~~~IG~~~i~l~~l~~  127 (158)
T cd04015          99 HVEFTVKDNDVVG-AQLIGRAYIPVEDLLS  127 (158)
T ss_pred             EEEEEEEeCCCcC-CcEEEEEEEEhHHccC
Confidence            5678888887654 5699999999998864


No 131
>PF04377 ATE_C:  Arginine-tRNA-protein transferase, C terminus;  InterPro: IPR007472 Arginine-tRNA-protein transferase catalyses the post-translational conjugation of arginine to the N terminus of a protein. In eukaryotes, this functions as part of the N terminus rule pathway of protein degradation by conjugating a destabilising amino acid to the N-terminal aspartate or glutamate of a protein, targeting the protein for ubiquitin-dependent proteolysis. N-terminal cysteine is sometimes modified []. In Saccharomyces cerevisiae, Cys20, 23, 94 and/or 95 are thought to be important for activity []. Of these, only Cys 94 appears to be completely conserved in this family.  This entry represents the C-terminal region of the enzyme arginine-tRNA-protein transferase, found in both eukaryotic and prokaryotic enzymes.; GO: 0004057 arginyltransferase activity, 0016598 protein arginylation
Probab=34.06  E-value=1.1e+02  Score=23.51  Aligned_cols=42  Identities=21%  Similarity=0.409  Sum_probs=25.7

Q ss_pred             HHHHHHHhhcccCCc----------ccCCCCCCCceEEEeeeeceeeccCCeeeeeeeee
Q psy12064         59 LIKTFVQSQCNEGRD----------LIGNEEQLEFFELHICVKDYCFARDDRLVGVAVLQ  108 (148)
Q Consensus        59 LIk~fv~tQ~~qgnd----------~lgne~~p~~yEL~~~VKDYCFar~Dr~vG~av~q  108 (148)
                      |-+++...-+..|..          +|-+. ..+.+++..       -.+||+|||+|+-
T Consensus         6 Ly~rY~~~rH~~~~~~~~~~~~y~~fl~~~-~~~t~~~~~-------~~~~kLiav~v~D   57 (128)
T PF04377_consen    6 LYERYQMARHPDGDMDPPSQEQYRRFLCSS-PLGTYHLEY-------RLDGKLIAVAVVD   57 (128)
T ss_pred             HHHHHHHHhCCCCCCCCcCHHHHHHHHhCC-CCCCEEEEE-------EeCCeEEEEEEee
Confidence            455666666666522          34332 345555543       3899999999974


No 132
>cd08405 C2B_Synaptotagmin-7 C2 domain second repeat present in Synaptotagmin 7. Synaptotagmin is a membrane-trafficking protein characterized by a N-terminal transmembrane region, a linker, and 2 C-terminal C2 domains. Synaptotagmin 7, a member of class 2 synaptotagmins, is located in presynaptic plasma membranes in neurons, dense-core vesicles in endocrine cells, and lysosomes in fibroblasts.  It has been shown to play a role in regulation of Ca2+-dependent lysosomal exocytosis in fibroblasts and may also function as a vesicular Ca2+-sensor.  It is distinguished from the other synaptotagmins by having over 12 splice forms. Previously all synaptotagmins were thought to be calcium sensors in the regulation of neurotransmitter release and hormone secretion, but it has been shown that not all of them bind calcium.  Of the 17 identified synaptotagmins only 8 bind calcium (1-3, 5-7, 9, 10).  The function of the two C2 domains that bind calcium are: regulating the fusion step of synaptic ves
Probab=33.06  E-value=38  Score=24.41  Aligned_cols=31  Identities=26%  Similarity=0.104  Sum_probs=24.5

Q ss_pred             CceEEEeeeeceeeccCCeeeeeeeeeccch
Q psy12064         82 EFFELHICVKDYCFARDDRLVGVAVLQLKDI  112 (148)
Q Consensus        82 ~~yEL~~~VKDYCFar~Dr~vG~av~qL~~i  112 (148)
                      ..-.|.+.|.|+--.+.|.++|-+.+++++.
T Consensus        81 ~~~~l~~~v~d~~~~~~~~~lG~~~i~~~~~  111 (136)
T cd08405          81 RETTLIITVMDKDRLSRNDLIGKIYLGWKSG  111 (136)
T ss_pred             CCCEEEEEEEECCCCCCCcEeEEEEECCccC
Confidence            3456889999987666778999999998875


No 133
>cd01249 PH_oligophrenin Oligophrenin Pleckstrin homology (PH) domain. Oligophrenin Pleckstrin homology (PH) domain. Oligophrenin is composed of a  PH domain, a rhoGAP domain and a proline rich region. Closely related proteins have a C-terminal SH3 domain. PH domains a share little sequence conservation, but all have a common fold, which is electrostatically polarized. PH domains also have diverse functions. They are often involved in targeting proteins to the plasma membrane, but few display strong specificity in lipid binding.  Any specificity is usually determined by loop regions or insertions in the N-terminus of the domain, which are not conserved across all PH domains. PH domains are found in cellular signaling proteins such as serine/threonine kinase, tyrosine kinsases, regulators of G-proteins, endocytotic GTPases, adaptors, as well as cytoskeletal associated molecules and in lipid associated enzymes.
Probab=32.47  E-value=51  Score=24.99  Aligned_cols=24  Identities=21%  Similarity=0.430  Sum_probs=18.4

Q ss_pred             eeEEeceee-ecCCceeEEEEEeeh
Q psy12064        119 QICVKDYCF-ARDDRLVGVAVLQLK  142 (148)
Q Consensus       119 alcVKDyCf-~r~dr~vG~~vlql~  142 (148)
                      ..|||.||+ -+++++.||.++--+
T Consensus        15 ~~Wvk~y~~~~~~~~~f~m~~~~q~   39 (104)
T cd01249          15 GSWTKYYCTYSKETRIFTMVPFNQK   39 (104)
T ss_pred             CeEEEEEEEEEcCCcEEEEEecccc
Confidence            479999997 556888888776544


No 134
>KOG1936|consensus
Probab=31.70  E-value=47  Score=31.62  Aligned_cols=27  Identities=33%  Similarity=0.573  Sum_probs=24.6

Q ss_pred             CCCCCchhhHHHHHHHHHHHHhhhhcC
Q psy12064          2 EKSLSPKQCALLDASLDSIKNYFHAAG   28 (148)
Q Consensus         2 ~k~LtpkQCavld~aldtiK~yFhagg   28 (148)
                      +|.++|+||++=+-++++|++-|.--|
T Consensus        66 TrD~~p~qm~lRe~if~~i~~vFkrhG   92 (518)
T KOG1936|consen   66 TRDFSPEQMALREKIFSTIKEVFKRHG   92 (518)
T ss_pred             CCcCCHHHHHHHHHHHHHHHHHHHHcC
Confidence            578999999999999999999998755


No 135
>cd08387 C2A_Synaptotagmin-8 C2A domain first repeat present in Synaptotagmin 8. Synaptotagmin is a membrane-trafficking protein characterized by a N-terminal transmembrane region, a linker, and 2 C-terminal C2 domains. Previously all synaptotagmins were thought to be calcium sensors in the regulation of neurotransmitter release and hormone secretion, but it has been shown that not all of them bind calcium.  Of the 17 identified synaptotagmins only 8 bind calcium (1-3, 5-7, 9, 10).  The function of the two C2 domains that bind calcium are: regulating the fusion step of synaptic vesicle exocytosis (C2A) and  binding to phosphatidyl-inositol-3,4,5-triphosphate (PIP3) in the absence of calcium ions and to phosphatidylinositol bisphosphate (PIP2) in their presence (C2B).  C2B also regulates also the recycling step of synaptic vesicles.  C2 domains fold into an 8-standed beta-sandwich that can adopt 2 structural arrangements: Type I and Type II, distinguished by a circular permutation involv
Probab=31.14  E-value=73  Score=22.40  Aligned_cols=32  Identities=19%  Similarity=0.255  Sum_probs=26.0

Q ss_pred             cceeeeEEeceeeecCCceeEEEEEeehhhhh
Q psy12064        115 QVKHQICVKDYCFARDDRLVGVAVLQLKDIVE  146 (148)
Q Consensus       115 KGScalcVKDyCf~r~dr~vG~~vlql~~i~~  146 (148)
                      ...+.+.|.||=..+.|..+|.+.++|.++..
T Consensus        81 ~~~l~i~V~d~~~~~~~~~iG~~~i~l~~~~~  112 (124)
T cd08387          81 KRTLEVLLYDFDQFSRDECIGVVELPLAEVDL  112 (124)
T ss_pred             CCEEEEEEEECCCCCCCceeEEEEEecccccC
Confidence            34688888888666778999999999998853


No 136
>cd04028 C2B_RIM1alpha C2 domain second repeat contained in Rab3-interacting molecule (RIM) proteins. RIMs are believed to organize specialized sites of the plasma membrane called active zones.  They also play a role in controlling neurotransmitter release, plasticity processes, as well as memory and learning.  RIM contains an N-terminal zinc finger domain, a PDZ domain, and two C-terminal C2 domains (C2A, C2B).  C2 domains fold into an 8-standed beta-sandwich that can adopt 2 structural arrangements: Type I and Type II, distinguished by a circular permutation involving their N- and C-terminal beta strands. Many C2 domains are Ca2+-dependent membrane-targeting modules that bind a wide variety of substances including bind phospholipids, inositol polyphosphates, and intracellular proteins.  Most C2 domain proteins are either signal transduction enzymes that contain a single C2 domain, such as protein kinase C, or membrane trafficking proteins which contain at least two C2 domains, such as
Probab=30.61  E-value=83  Score=24.29  Aligned_cols=32  Identities=28%  Similarity=0.327  Sum_probs=26.3

Q ss_pred             hccceeeeEEe-ceeeecCCceeEEEEEeehhh
Q psy12064        113 VEQVKHQICVK-DYCFARDDRLVGVAVLQLKDI  144 (148)
Q Consensus       113 AeKGScalcVK-DyCf~r~dr~vG~~vlql~~i  144 (148)
                      .....+.++|. ||=+.+.+..+|.+.++|.++
T Consensus        92 l~~~~L~v~V~~d~~~~~~~~~iG~~~i~L~~l  124 (146)
T cd04028          92 PTGKTLQVIVWGDYGRMDKKVFMGVAQILLDDL  124 (146)
T ss_pred             CCCCEEEEEEEeCCCCCCCCceEEEEEEEcccc
Confidence            35668999999 676667778999999999987


No 137
>TIGR00498 lexA SOS regulatory protein LexA. LexA acts as a homodimer to repress a number of genes involved in the response to DNA damage (SOS response), including itself and RecA. RecA, in the presence of single-stranded DNA, acts as a co-protease to activate a latent autolytic protease activity (EC 3.4.21.88) of LexA, where the active site Ser is part of LexA. The autolytic cleavage site is an Ala-Gly bond in LexA (at position 84-85 in E. coli LexA; this sequence is replaced by Gly-Gly in Synechocystis). The cleavage leads to derepression of the SOS regulon and eventually to DNA repair. LexA in Bacillus subtilis is called DinR. LexA is much less broadly distributed than RecA.
Probab=29.93  E-value=47  Score=25.73  Aligned_cols=19  Identities=32%  Similarity=0.394  Sum_probs=14.7

Q ss_pred             CCCCchhhHHHHHHHHHHH
Q psy12064          3 KSLSPKQCALLDASLDSIK   21 (148)
Q Consensus         3 k~LtpkQCavld~aldtiK   21 (148)
                      ++|||+|.+||+...+.+.
T Consensus         2 ~~lt~~q~~iL~~l~~~~~   20 (199)
T TIGR00498         2 KPLTARQQEVLDLIRAHIE   20 (199)
T ss_pred             CccCHHHHHHHHHHHHHHH
Confidence            5799999999877765543


No 138
>cd00236 FinO_conjug_rep FinO bacterial conjugation repressor domain;  the basic protein FinO is part of the the two component FinOP system which is responsible for repressing bacterial conjugation; the FinOP system represses the transfer (tra) operon of the F-plasmid which encodes the proteins responsible for conjugative transfer of this plasmid from host to recipient Escherichia coli cells; antisense RNA, FinP is thought to interact with traJ mRNA to occlude its ribosome binding site, blocking traJ translation and thereby inhibiting transcription of the tra operon; FinO protects FinP against degradation by binding to FinP and sterically blocking the cellular endonuclease RNase E; FinO also also binds to the complementary stem-loop structures in traJ mRNA and promotes duplex formation between FinP and traJ RNA in vitro;  this domain contains two independent RNA binding regions
Probab=28.87  E-value=62  Score=25.85  Aligned_cols=49  Identities=22%  Similarity=0.438  Sum_probs=34.2

Q ss_pred             HHHHHHHHHHh----hhhcC-----CCcccccc---ccCcch----hhHHHHHhhhhhhhHHHHH
Q psy12064         13 LDASLDSIKNY----FHAAG-----NGLKKTYL---DKSPEL----ASLRYALSLYTQTTDALIK   61 (148)
Q Consensus        13 ld~aldtiK~y----Fhagg-----~GlKk~fL---eks~~l----~slryalsLytqtTd~LIk   61 (148)
                      .|-++.+|+.+    |-.|+     .||++..+   +.+|++    ..||-||+.||.++.=|-.
T Consensus        36 ~e~~v~~l~~~fP~lF~~~~~~PLKiGI~~di~~dl~~~~~~~lsk~~Lr~AL~~~t~s~rYL~~  100 (146)
T cd00236          36 VEYAVECLKKWFPGLFPGDTPRLLKCGIKDGILQDVAQHPNIPLTHEELRCAVKAITRRESYLQA  100 (146)
T ss_pred             ccHHHHHHHHHHHHhcCCCCCcccccChHHHHHHHHHhCccCCCCHHHHHHHHHHHhCCHHHHHH
Confidence            45667777774    44544     38888555   354653    6799999999999986644


No 139
>cd00030 C2 C2 domain. The C2 domain was first identified in PKC. C2 domains fold into an 8-standed beta-sandwich that can adopt 2 structural arrangements: Type I and Type II, distinguished by a circular permutation involving their N- and C-terminal beta strands. Many C2 domains are Ca2+-dependent membrane-targeting modules that bind a wide variety of substances including bind phospholipids, inositol polyphosphates, and intracellular proteins.  Most C2 domain proteins are either signal transduction enzymes that contain a single C2 domain, such as protein kinase C, or membrane trafficking proteins which contain at least two C2 domains, such as synaptotagmin 1.  However, there are a few exceptions to this including RIM isoforms and some splice variants of piccolo/aczonin and intersectin which only have a single C2 domain.  C2 domains with a calcium binding region have negatively charged residues, primarily aspartates, that serve as ligands for calcium ions.
Probab=28.86  E-value=97  Score=18.85  Aligned_cols=31  Identities=19%  Similarity=0.170  Sum_probs=19.0

Q ss_pred             ceEEEeeeeceeeccCCeeeeeeeeeccchh
Q psy12064         83 FFELHICVKDYCFARDDRLVGVAVLQLKDIV  113 (148)
Q Consensus        83 ~yEL~~~VKDYCFar~Dr~vG~av~qL~~iA  113 (148)
                      .-.|++.|-|.==...++++|.+.+++.++.
T Consensus        60 ~~~l~i~v~~~~~~~~~~~ig~~~~~l~~l~   90 (102)
T cd00030          60 SDTLTVEVWDKDRFSKDDFLGEVEIPLSELL   90 (102)
T ss_pred             CCEEEEEEEecCCCCCCceeEEEEEeHHHhh
Confidence            3455555544433335677888887777776


No 140
>cd08392 C2A_SLP-3 C2 domain first repeat present in Synaptotagmin-like protein 3. All Slp members basically share an N-terminal Slp homology domain (SHD) and C-terminal tandem C2 domains (named the C2A domain and the C2B domain) with the SHD and C2 domains being separated by a linker sequence of various length. SHD of Slp (except for the Slp4-SHD) function as a specific Rab27A/B-binding domain.  In addition to Slp, rabphilin, Noc2, and  Munc13-4 also function as Rab27-binding proteins. Little is known about the expression or localization of Slp3.  The C2A domain of Slp3 is Ca2+ dependent.  It has been demonstrated that Slp3 promotes dense-core vesicle exocytosis.  C2 domains fold into an 8-standed beta-sandwich that can adopt 2 structural arrangements: Type I and Type II, distinguished by a circular permutation involving their N- and C-terminal beta strands. Many C2 domains are Ca2+-dependent membrane-targeting modules that bind a wide variety of substances including bind phospholipids
Probab=28.63  E-value=78  Score=23.28  Aligned_cols=31  Identities=16%  Similarity=0.177  Sum_probs=25.6

Q ss_pred             ccceeeeEEeceeeecCCceeEEEEEeehhh
Q psy12064        114 EQVKHQICVKDYCFARDDRLVGVAVLQLKDI  144 (148)
Q Consensus       114 eKGScalcVKDyCf~r~dr~vG~~vlql~~i  144 (148)
                      +.-++.+.|.|+=-.+.+.++|.+.|+|.++
T Consensus        82 ~~~~L~v~V~~~~~~~~~~~lG~~~i~L~~~  112 (128)
T cd08392          82 SSRQLQVSVWHSRTLKRRVFLGEVLIPLADW  112 (128)
T ss_pred             CCcEEEEEEEeCCCCcCcceEEEEEEEcCCc
Confidence            3468888898877566788999999999887


No 141
>cd08375 C2_Intersectin C2 domain present in Intersectin. A single instance of the C2 domain is located C terminally in the intersectin protein.  Intersectin functions as a scaffolding protein, providing a link between the actin cytoskeleton and the components of endocytosis and plays a role in signal transduction.   In addition to C2, intersectin contains several additional domains including: Eps15 homology domains, SH3 domains, a RhoGEF domain, and a PH domain.  C2 domains fold into an 8-standed beta-sandwich that can adopt 2 structural arrangements: Type I and Type II, distinguished by a circular permutation involving their N- and C-terminal beta strands. Many C2 domains are Ca2+-dependent membrane-targeting modules that bind a wide variety of substances including bind phospholipids, inositol polyphosphates, and intracellular proteins.  Most C2 domain proteins are either signal transduction enzymes that contain a single C2 domain, such as protein kinase C, or membrane trafficking pro
Probab=28.50  E-value=74  Score=23.59  Aligned_cols=31  Identities=26%  Similarity=0.293  Sum_probs=25.9

Q ss_pred             ceeeeEEeceeeecCCceeEEEEEeehhhhh
Q psy12064        116 VKHQICVKDYCFARDDRLVGVAVLQLKDIVE  146 (148)
Q Consensus       116 GScalcVKDyCf~r~dr~vG~~vlql~~i~~  146 (148)
                      ..+.+.|.|+-....|.++|-+.++|.++..
T Consensus        76 ~~l~i~V~D~d~~~~d~~lG~~~i~l~~l~~  106 (136)
T cd08375          76 DVLCITVFDRDFFSPDDFLGRTEIRVADILK  106 (136)
T ss_pred             CEEEEEEEECCCCCCCCeeEEEEEEHHHhcc
Confidence            4677778888777788999999999999875


No 142
>cd08404 C2B_Synaptotagmin-4 C2 domain second repeat present in Synaptotagmin 4. Synaptotagmin is a membrane-trafficking protein characterized by a N-terminal transmembrane region, a linker, and 2 C-terminal C2 domains.  Synaptotagmin 4, a member of class 4 synaptotagmins, is located in the brain.  It functions are unknown. It, like synaptotagmin-11, has an Asp to Ser substitution in its C2A domain. Previously all synaptotagmins were thought to be calcium sensors in the regulation of neurotransmitter release and hormone secretion, but it has been shown that not all of them bind calcium.  Of the 17 identified synaptotagmins only 8 bind calcium (1-3, 5-7, 9, 10).  The function of the two C2 domains that bind calcium are: regulating the fusion step of synaptic vesicle exocytosis (C2A) and  binding to phosphatidyl-inositol-3,4,5-triphosphate (PIP3) in the absence of calcium ions and to phosphatidylinositol bisphosphate (PIP2) in their presence (C2B).  C2B also regulates also the recycling s
Probab=28.01  E-value=61  Score=23.41  Aligned_cols=29  Identities=21%  Similarity=0.167  Sum_probs=24.4

Q ss_pred             ceEEEeeeeceeeccCCeeeeeeeeeccc
Q psy12064         83 FFELHICVKDYCFARDDRLVGVAVLQLKD  111 (148)
Q Consensus        83 ~yEL~~~VKDYCFar~Dr~vG~av~qL~~  111 (148)
                      .-.|.+.|.||--.+.|.++|-+.+++..
T Consensus        82 ~~~l~~~v~d~d~~~~~~~iG~~~~~~~~  110 (136)
T cd08404          82 DISVEFLVLDSDRVTKNEVIGRLVLGPKA  110 (136)
T ss_pred             CCEEEEEEEECCCCCCCccEEEEEECCcC
Confidence            34578889999877788899999999988


No 143
>cd08381 C2B_PI3K_class_II C2 domain second repeat present in class II phosphatidylinositol 3-kinases (PI3Ks). There are 3 classes of PI3Ks based on structure, regulation, and specificity.  All classes contain a N-terminal C2 domain, a PIK domain, and a kinase catalytic domain. Unlike class I and class III, class II PI3Ks have additionally a PX domain and a C-terminal C2 domain containing a nuclear localization signal both of which bind phospholipids though in a slightly different fashion.  PI3Ks (AKA phosphatidylinositol (PtdIns) 3-kinases) regulate cell processes such as cell growth, differentiation, proliferation, and motility. PI3Ks work on phosphorylation of phosphatidylinositol, phosphatidylinositide (4)P (PtdIns (4)P),2 or PtdIns(4,5)P2. Specifically they phosphorylate the D3 hydroxyl group of phosphoinositol lipids on the inositol ring. C2 domains fold into an 8-standed beta-sandwich that can adopt 2 structural arrangements: Type I and Type II, distinguished by a circular permut
Probab=27.98  E-value=85  Score=22.65  Aligned_cols=33  Identities=18%  Similarity=0.186  Sum_probs=27.4

Q ss_pred             hccceeeeEEeceeeecCCceeEEEEEeehhhh
Q psy12064        113 VEQVKHQICVKDYCFARDDRLVGVAVLQLKDIV  145 (148)
Q Consensus       113 AeKGScalcVKDyCf~r~dr~vG~~vlql~~i~  145 (148)
                      .+...+.+.|+||=-.+.+..+|-+.+.|+++.
T Consensus        78 l~~~~L~~~V~d~d~~~~~~~lG~~~i~l~~l~  110 (122)
T cd08381          78 LQQRVLQVSVWSHDSLVENEFLGGVCIPLKKLD  110 (122)
T ss_pred             hCCCEEEEEEEeCCCCcCCcEEEEEEEeccccc
Confidence            345688899999877778889999999999875


No 144
>cd08403 C2B_Synaptotagmin-3-5-6-9-10 C2 domain second repeat present in Synaptotagmins 3, 5, 6, 9, and 10. Synaptotagmin is a membrane-trafficking protein characterized by a N-terminal transmembrane region, a linker, and 2 C-terminal C2 domains. Synaptotagmin 3, a member of class 3 synaptotagmins, is located in the brain and localized to the active zone and plasma membrane.  It functions as a Ca2+ sensor for fast exocytosis. It, along with synaptotagmins 5,6, and 10, has disulfide bonds at its N-terminus. Synaptotagmin 9, a class 5 synaptotagmins, is located in the brain and localized to the synaptic vesicles.  It is thought to be a Ca2+-sensor for dense-core vesicle exocytosis. Previously all synaptotagmins were thought to be calcium sensors in the regulation of neurotransmitter release and hormone secretion, but it has been shown that not all of them bind calcium.  Of the 17 identified synaptotagmins only 8 bind calcium (1-3, 5-7, 9, 10).  The function of the two C2 domains that bind
Probab=27.23  E-value=78  Score=22.72  Aligned_cols=28  Identities=29%  Similarity=0.355  Sum_probs=23.9

Q ss_pred             cceeeeEEeceeeecCCceeEEEEEeeh
Q psy12064        115 QVKHQICVKDYCFARDDRLVGVAVLQLK  142 (148)
Q Consensus       115 KGScalcVKDyCf~r~dr~vG~~vlql~  142 (148)
                      ...+.+.|+||--.+.|+++|-+.+.+.
T Consensus        81 ~~~l~~~v~d~~~~~~~~~IG~~~l~~~  108 (134)
T cd08403          81 NVSLIIAVVDYDRVGHNELIGVCRVGPN  108 (134)
T ss_pred             CCEEEEEEEECCCCCCCceeEEEEECCC
Confidence            3467899999998889999999998765


No 145
>cd08400 C2_Ras_p21A1 C2 domain present in RAS p21 protein activator 1 (RasA1). RasA1 is a GAP1 (GTPase activating protein 1), a Ras-specific GAP member, which suppresses Ras function by enhancing the GTPase activity of Ras proteins resulting in the inactive GDP-bound form of Ras.  In this way it can control cellular proliferation and differentiation.  RasA1 contains a C2 domain,  a Ras-GAP domain, a pleckstrin homology (PH)-like domain, a SH3 domain, and 2 SH2 domains. C2 domains fold into an 8-standed beta-sandwich that can adopt 2 structural arrangements: Type I and Type II, distinguished by a circular permutation involving their N- and C-terminal beta strands. Many C2 domains are Ca2+-dependent membrane-targeting modules that bind a wide variety of substances including bind phospholipids, inositol polyphosphates, and intracellular proteins.  Most C2 domain proteins are either signal transduction enzymes that contain a single C2 domain, such as protein kinase C, or membrane trafficki
Probab=26.80  E-value=1.2e+02  Score=21.77  Aligned_cols=31  Identities=13%  Similarity=0.170  Sum_probs=23.9

Q ss_pred             ceeeeEEeceeeecCCceeEEEEEeehhhhh
Q psy12064        116 VKHQICVKDYCFARDDRLVGVAVLQLKDIVE  146 (148)
Q Consensus       116 GScalcVKDyCf~r~dr~vG~~vlql~~i~~  146 (148)
                      ..+.+.|.|+-=...|..+|.+.++|.++..
T Consensus        62 ~~l~v~v~d~~~~~~d~~iG~v~i~l~~l~~   92 (126)
T cd08400          62 NSFTISLSNKAKRSKDSEIAEVTVQLSKLQN   92 (126)
T ss_pred             CEEEEEEEECCCCCCCCeEEEEEEEHhHccC
Confidence            3566777777656678999999999988754


No 146
>PF12194 Ste5_C:  Protein kinase Fus3-binding;  InterPro: IPR021106 The Saccharomyces cerevisiae pheromone response pathway involves a cascade of 3 MAP kinases Ste11, Ste7, and Fus3. Ste5 is an essential element of this cascade, acting as a scaffold for each of the MAP kinases prior to signalling []. This entry represents the Fus3-binding domain of Ste5, also known as the minimal scaffold domain. It acts as a co-catalyst, binding Fus3 and promoting its phosphorylation by Ste7 []. In the absence of this domain, Fus3 is an extremely poor substrate for Ste7. The requirement for both Ste7 and this domain in Fus3 activation ensures that Fus3 is selectively activated by the mating pathway and not by other pathways that also utilise Ste7.; PDB: 3FZE_A.
Probab=26.74  E-value=27  Score=29.38  Aligned_cols=30  Identities=27%  Similarity=0.360  Sum_probs=14.7

Q ss_pred             eeeeeeeccchhccceeeeEEece-eeecCCce
Q psy12064        102 VGVAVLQLKDIVEQVKHQICVKDY-CFARDDRL  133 (148)
Q Consensus       102 vG~av~qL~~iAeKGScalcVKDy-Cf~r~dr~  133 (148)
                      +|++|+.=..+-+..||-  .+|| ||++.||.
T Consensus       108 lGI~viSNs~Me~~kS~L--fmDy~~F~~~GRr  138 (191)
T PF12194_consen  108 LGIVVISNSSMEEDKSCL--FMDYSPFASIGRR  138 (191)
T ss_dssp             EEEEEEE-S---TTT-GG--GS--GGG------
T ss_pred             eeEEEEeCCccccCceEE--EecchhhcccccC
Confidence            899999988888888886  6888 99999997


No 147
>cd04018 C2C_Ferlin C2 domain third repeat in Ferlin. Ferlins are involved in vesicle fusion events.  Ferlins and other proteins, such as Synaptotagmins, are implicated in facilitating the fusion process when cell membranes fuse together.  There are six known human Ferlins: Dysferlin (Fer1L1), Otoferlin (Fer1L2), Myoferlin (Fer1L3), Fer1L4, Fer1L5, and Fer1L6.  Defects in these genes can lead to a wide range of diseases including muscular dystrophy (dysferlin), deafness (otoferlin), and infertility (fer-1, fertilization factor-1).  Structurally they have 6 tandem C2 domains, designated as (C2A-C2F) and a single C-terminal transmembrane domain, though there is a new study that disputes this and claims that there are actually 7 tandem C2 domains with another C2 domain inserted between C2D and C2E.   In a subset of them (Dysferlin, Myoferlin, and Fer1) there is an additional conserved domain called DysF. C2 domains fold into an 8-standed beta-sandwich that can adopt 2 structural arrangemen
Probab=26.09  E-value=85  Score=24.25  Aligned_cols=31  Identities=19%  Similarity=0.439  Sum_probs=26.1

Q ss_pred             eeeeEEeceeeecCCceeEEEEEeehhhhhc
Q psy12064        117 KHQICVKDYCFARDDRLVGVAVLQLKDIVEQ  147 (148)
Q Consensus       117 ScalcVKDyCf~r~dr~vG~~vlql~~i~~~  147 (148)
                      .+.+.|.||=....|.++|-+.++|.+|...
T Consensus        77 ~l~~~v~D~d~~~~dd~iG~~~l~l~~l~~~  107 (151)
T cd04018          77 RIKIQIRDWDRVGNDDVIGTHFIDLSKISNS  107 (151)
T ss_pred             EEEEEEEECCCCCCCCEEEEEEEeHHHhccC
Confidence            4668888887778899999999999998764


No 148
>cd04037 C2E_Ferlin C2 domain fifth repeat in Ferlin. Ferlins are involved in vesicle fusion events.  Ferlins and other proteins, such as Synaptotagmins, are implicated in facilitating the fusion process when cell membranes fuse together.  There are six known human Ferlins: Dysferlin (Fer1L1), Otoferlin (Fer1L2), Myoferlin (Fer1L3), Fer1L4, Fer1L5, and Fer1L6.  Defects in these genes can lead to a wide range of diseases including muscular dystrophy (dysferlin), deafness (otoferlin), and infertility (fer-1, fertilization factor-1).  Structurally they have 6 tandem C2 domains, designated as (C2A-C2F) and a single C-terminal transmembrane domain, though there is a new study that disputes this and claims that there are actually 7 tandem C2 domains with another C2 domain inserted between C2D and C2E.   In a subset of them (Dysferlin, Myoferlin, and Fer1) there is an additional conserved domain called DysF. C2 domains fold into an 8-standed beta-sandwich that can adopt 2 structural arrangemen
Probab=25.89  E-value=99  Score=22.22  Aligned_cols=30  Identities=33%  Similarity=0.486  Sum_probs=24.7

Q ss_pred             ceeeeEEeceeeecCCceeEEEEEeehhhh
Q psy12064        116 VKHQICVKDYCFARDDRLVGVAVLQLKDIV  145 (148)
Q Consensus       116 GScalcVKDyCf~r~dr~vG~~vlql~~i~  145 (148)
                      ..+.+.|.|+=....|+.+|.+.++|++.-
T Consensus        63 ~~L~~~V~d~d~~~~dd~iG~~~i~l~~~~   92 (124)
T cd04037          63 SILKISVMDYDLLGSDDLIGETVIDLEDRF   92 (124)
T ss_pred             CEEEEEEEECCCCCCCceeEEEEEeecccc
Confidence            457778888877778899999999998764


No 149
>cd04035 C2A_Rabphilin_Doc2 C2 domain first repeat present in Rabphilin and Double C2 domain. Rabphilin is found neurons and in neuroendrocrine cells, while Doc2 is found not only in the brain but in tissues, including mast cells, chromaffin cells, and osteoblasts.  Rabphilin and Doc2s share highly homologous tandem C2 domains, although their N-terminal structures are completely different: rabphilin contains an N-terminal Rab-binding domain (RBD),7 whereas Doc2 contains an N-terminal Munc13-1-interacting domain (MID). C2 domains fold into an 8-standed beta-sandwich that can adopt 2 structural arrangements: Type I and Type II, distinguished by a circular permutation involving their N- and C-terminal beta strands. Many C2 domains are Ca2+-dependent membrane-targeting modules that bind a wide variety of substances including bind phospholipids, inositol polyphosphates, and intracellular proteins.  Most C2 domain proteins are either signal transduction enzymes that contain a single C2 domain
Probab=25.23  E-value=90  Score=21.90  Aligned_cols=30  Identities=17%  Similarity=0.183  Sum_probs=23.7

Q ss_pred             eeeeEEeceeeecCCceeEEEEEeehhhhhc
Q psy12064        117 KHQICVKDYCFARDDRLVGVAVLQLKDIVEQ  147 (148)
Q Consensus       117 ScalcVKDyCf~r~dr~vG~~vlql~~i~~~  147 (148)
                      .+.+.|.|+--. .+..+|-+.+.|+++...
T Consensus        85 ~l~~~v~d~~~~-~~~~iG~~~i~l~~l~~~  114 (123)
T cd04035          85 TLRLLVLDEDRF-GNDFLGETRIPLKKLKPN  114 (123)
T ss_pred             EEEEEEEEcCCc-CCeeEEEEEEEcccCCCC
Confidence            466777787655 788999999999998654


No 150
>cd08393 C2A_SLP-1_2 C2 domain first repeat present in Synaptotagmin-like proteins 1 and 2. All Slp members basically share an N-terminal Slp homology domain (SHD) and C-terminal tandem C2 domains (named the C2A domain and the C2B domain) with the SHD and C2 domains being separated by a linker sequence of various length.  Slp1/JFC1 and Slp2/exophilin 4 promote granule docking to the plasma membrane.  Additionally, their C2A domains are both Ca2+ independent, unlike Slp3 and Slp4/granuphilin which are Ca2+ dependent.  It is thought that SHD (except for the Slp4-SHD) functions as a specific Rab27A/B-binding domain.  In addition to Slps, rabphilin, Noc2, and  Munc13-4 also function as Rab27-binding proteins.  C2 domains fold into an 8-standed beta-sandwich that can adopt 2 structural arrangements: Type I and Type II, distinguished by a circular permutation involving their N- and C-terminal beta strands. Many C2 domains are Ca2+-dependent membrane-targeting modules that bind a wide variety 
Probab=25.14  E-value=1e+02  Score=22.19  Aligned_cols=31  Identities=10%  Similarity=0.008  Sum_probs=25.5

Q ss_pred             ccceeeeEEeceeeecCCceeEEEEEeehhh
Q psy12064        114 EQVKHQICVKDYCFARDDRLVGVAVLQLKDI  144 (148)
Q Consensus       114 eKGScalcVKDyCf~r~dr~vG~~vlql~~i  144 (148)
                      ..-.+.+.|.||=-...+..+|-+.++|.++
T Consensus        82 ~~~~L~~~V~d~~~~~~~~~iG~~~i~L~~~  112 (125)
T cd08393          82 PTRVLNLSVWHRDSLGRNSFLGEVEVDLGSW  112 (125)
T ss_pred             CCCEEEEEEEeCCCCCCCcEeEEEEEecCcc
Confidence            3457899999986666778999999999987


No 151
>cd08401 C2A_RasA2_RasA3 C2 domain first repeat present in RasA2 and RasA3. RasA2 and RasA3 are GAP1s (GTPase activating protein 1s ), Ras-specific GAP members, which suppresses Ras function by enhancing the GTPase activity of Ras proteins resulting in the inactive GDP-bound form of Ras. In this way it can control cellular proliferation and differentiation.  RasA2 and RasA3 are both inositol 1,3,4,5-tetrakisphosphate-binding proteins and contain an N-terminal C2 domain, a Ras-GAP domain, a pleckstrin-homology (PH) domain which localizes it to the plasma membrane, and Bruton's Tyrosine Kinase (BTK) a zinc binding domain. C2 domains fold into an 8-standed beta-sandwich that can adopt 2 structural arrangements: Type I and Type II, distinguished by a circular permutation involving their N- and C-terminal beta strands. Many C2 domains are Ca2+-dependent membrane-targeting modules that bind a wide variety of substances including bind phospholipids, inositol polyphosphates, and intracellular p
Probab=24.24  E-value=1.1e+02  Score=21.94  Aligned_cols=31  Identities=16%  Similarity=0.281  Sum_probs=24.1

Q ss_pred             ceeeeEEeceeeecCCceeEEEEEeehhhhh
Q psy12064        116 VKHQICVKDYCFARDDRLVGVAVLQLKDIVE  146 (148)
Q Consensus       116 GScalcVKDyCf~r~dr~vG~~vlql~~i~~  146 (148)
                      ..+.+.|.|+=-...|..+|.+.++|.++..
T Consensus        62 ~~l~~~v~d~~~~~~~~~iG~~~i~l~~l~~   92 (121)
T cd08401          62 RHLSFYIYDRDVLRRDSVIGKVAIKKEDLHK   92 (121)
T ss_pred             CEEEEEEEECCCCCCCceEEEEEEEHHHccC
Confidence            4566777676666788999999999988753


No 152
>cd08686 C2_ABR C2 domain in the Active BCR (Breakpoint cluster region) Related protein. The ABR protein is similar to the breakpoint cluster region protein.  It has homology to guanine nucleotide exchange proteins and GTPase-activating proteins (GAPs).  ABR is expressed primarily in the brain, but also includes non-neuronal tissues such as the heart.  It has been associated with human diseases such as Miller-Dieker syndrome in which mental retardation and malformations of the heart are present.  ABR contains a RhoGEF domain and a PH-like domain upstream of its C2 domain and a RhoGAP domain downstream of this domain.  A few members also contain a Bcr-Abl oncoprotein oligomerization domain at the very N-terminal end. Splice variants of ABR have been identified. ABR is found in a wide variety of organisms including chimpanzee, dog, mouse, rat, fruit fly, and mosquito. The C2 domain was first identified in PKC. C2 domains fold into an 8-standed beta-sandwich that can adopt 2 structural arr
Probab=23.74  E-value=1.1e+02  Score=23.24  Aligned_cols=30  Identities=20%  Similarity=0.286  Sum_probs=23.7

Q ss_pred             ccceeeeEEecee-------eecCCceeEEEEEeehh
Q psy12064        114 EQVKHQICVKDYC-------FARDDRLVGVAVLQLKD  143 (148)
Q Consensus       114 eKGScalcVKDyC-------f~r~dr~vG~~vlql~~  143 (148)
                      +.-.+.+.|=|++       -.+.|+++|-+.++|..
T Consensus        56 ~s~~L~~~v~d~~~~~~~~d~~~~d~~~G~g~i~Ld~   92 (118)
T cd08686          56 GSQTLRILCYEKCYSKVKLDGEGTDAIMGKGQIQLDP   92 (118)
T ss_pred             CCCEEEEEEEEcccccccccccCcccEEEEEEEEECH
Confidence            3457788888887       34789999999999964


No 153
>cd08407 C2B_Synaptotagmin-13 C2 domain second repeat present in Synaptotagmin 13. Synaptotagmin is a membrane-trafficking protein characterized by a N-terminal transmembrane region, a linker, and 2 C-terminal C2 domains. Synaptotagmin 13, a member of class 6 synaptotagmins, is located in the brain.  It functions are unknown. It, like synaptotagmins 8 and 12, does not have any consensus Ca2+ binding sites. Previously all synaptotagmins were thought to be calcium sensors in the regulation of neurotransmitter release and hormone secretion, but it has been shown that not all of them bind calcium.  Of the 17 identified synaptotagmins only 8 bind calcium (1-3, 5-7, 9, 10).  The function of the two C2 domains that bind calcium are: regulating the fusion step of synaptic vesicle exocytosis (C2A) and  binding to phosphatidyl-inositol-3,4,5-triphosphate (PIP3) in the absence of calcium ions and to phosphatidylinositol bisphosphate (PIP2) in their presence (C2B).  C2B also regulates also the recy
Probab=23.69  E-value=59  Score=24.70  Aligned_cols=33  Identities=18%  Similarity=0.089  Sum_probs=25.6

Q ss_pred             CCCCceEEEeeeeceeeccCCeeeeeeeeeccc
Q psy12064         79 EQLEFFELHICVKDYCFARDDRLVGVAVLQLKD  111 (148)
Q Consensus        79 ~~p~~yEL~~~VKDYCFar~Dr~vG~av~qL~~  111 (148)
                      +..+...|.++|.||=-.+.|.++|-+++.+..
T Consensus        80 ~~L~~~~L~~~V~d~d~~~~~d~iG~v~lg~~~  112 (138)
T cd08407          80 ELLAASSVELEVLNQDSPGQSLPLGRCSLGLHT  112 (138)
T ss_pred             HHhCccEEEEEEEeCCCCcCcceeceEEecCcC
Confidence            345567799999999655666789999999863


No 154
>cd08388 C2A_Synaptotagmin-4-11 C2A domain first repeat present in Synaptotagmins 4 and 11. Synaptotagmin is a membrane-trafficking protein characterized by a N-terminal transmembrane region, a linker, and 2 C-terminal C2 domains.  Synaptotagmins 4 and 11, class 4 synaptotagmins, are located in the brain.  Their functions are unknown. They are distinguished from the other synaptotagmins by having and Asp to Ser substitution in their C2A domains. Previously all synaptotagmins were thought to be calcium sensors in the regulation of neurotransmitter release and hormone secretion, but it has been shown that not all of them bind calcium.  Of the 17 identified synaptotagmins only 8 bind calcium (1-3, 5-7, 9, 10).  The function of the two C2 domains that bind calcium are: regulating the fusion step of synaptic vesicle exocytosis (C2A) and  binding to phosphatidyl-inositol-3,4,5-triphosphate (PIP3) in the absence of calcium ions and to phosphatidylinositol bisphosphate (PIP2) in their presence 
Probab=22.68  E-value=1.2e+02  Score=22.06  Aligned_cols=29  Identities=17%  Similarity=0.222  Sum_probs=22.4

Q ss_pred             ceeeeEEeceeeecCCceeEEEEEeehhh
Q psy12064        116 VKHQICVKDYCFARDDRLVGVAVLQLKDI  144 (148)
Q Consensus       116 GScalcVKDyCf~r~dr~vG~~vlql~~i  144 (148)
                      ..+.+.|.||=..+.|.++|-+.++|.++
T Consensus        84 ~~L~~~V~d~d~~~~d~~lG~~~i~L~~l  112 (128)
T cd08388          84 LSLHFAVLSFDRYSRDDVIGEVVCPLAGA  112 (128)
T ss_pred             CEEEEEEEEcCCCCCCceeEEEEEecccc
Confidence            35777787764445677999999999987


No 155
>cd04045 C2C_Tricalbin-like C2 domain third repeat present in Tricalbin-like proteins. 5 to 6 copies of the C2 domain are present in Tricalbin, a yeast homolog of Synaptotagmin, which is involved in membrane trafficking and sorting.  C2 domains fold into an 8-standed beta-sandwich that can adopt 2 structural arrangements: Type I and Type II, distinguished by a circular permutation involving their N- and C-terminal beta strands. Many C2 domains are Ca2+-dependent membrane-targeting modules that bind a wide variety of substances including bind phospholipids, inositol polyphosphates, and intracellular proteins.  Most C2 domain proteins are either signal transduction enzymes that contain a single C2 domain, such as protein kinase C, or membrane trafficking proteins which contain at least two C2 domains, such as synaptotagmin 1.  However, there are a few exceptions to this including RIM isoforms and some splice variants of piccolo/aczonin and intersectin which only have a single C2 domain.  
Probab=22.63  E-value=1.1e+02  Score=21.92  Aligned_cols=31  Identities=26%  Similarity=0.433  Sum_probs=24.9

Q ss_pred             eeeeEEeceeeecCCceeEEEEEeehhhhhc
Q psy12064        117 KHQICVKDYCFARDDRLVGVAVLQLKDIVEQ  147 (148)
Q Consensus       117 ScalcVKDyCf~r~dr~vG~~vlql~~i~~~  147 (148)
                      .+.+.|.|+--...|..+|-+.+.|.++++.
T Consensus        63 ~L~v~v~d~~~~~~d~~IG~~~~~l~~l~~~   93 (120)
T cd04045          63 KITLEVMDYEKVGKDRSLGSVEINVSDLIKK   93 (120)
T ss_pred             EEEEEEEECCCCCCCCeeeEEEEeHHHhhCC
Confidence            6677777776666788999999999998763


No 156
>PF15418 DUF4625:  Domain of unknown function (DUF4625)
Probab=22.57  E-value=78  Score=24.42  Aligned_cols=19  Identities=21%  Similarity=0.212  Sum_probs=17.8

Q ss_pred             ccCCCCCCCceEEEeeeec
Q psy12064         74 LIGNEEQLEFFELHICVKD   92 (148)
Q Consensus        74 ~lgne~~p~~yEL~~~VKD   92 (148)
                      .|+.+-.|+.|.+++.|.|
T Consensus        99 ~IPa~a~~G~YH~~i~VtD  117 (132)
T PF15418_consen   99 DIPADAPAGDYHFMITVTD  117 (132)
T ss_pred             eCCCCCCCcceEEEEEEEE
Confidence            6888899999999999998


No 157
>COG3651 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=22.11  E-value=82  Score=24.89  Aligned_cols=16  Identities=19%  Similarity=0.374  Sum_probs=14.1

Q ss_pred             HHHHHHHHhhcccCCc
Q psy12064         58 ALIKTFVQSQCNEGRD   73 (148)
Q Consensus        58 ~LIk~fv~tQ~~qgnd   73 (148)
                      ....+|+.-|+++|||
T Consensus        48 ~mT~eFLafsks~GND   63 (125)
T COG3651          48 VMTAEFLAFSKSRGND   63 (125)
T ss_pred             HHHHHHHHHHHhcCCC
Confidence            4567899999999999


No 158
>cd04016 C2_Tollip C2 domain present in Toll-interacting protein (Tollip). Tollip is a part of the Interleukin-1 receptor (IL-1R) signaling pathway. Tollip is proposed to link serine/threonine kinase IRAK to IL-1Rs as well as inhibiting phosphorylation of IRAK. There is a single C2 domain present in Tollip. C2 domains fold into an 8-standed beta-sandwich that can adopt 2 structural arrangements: Type I and Type II, distinguished by a circular permutation involving their N- and C-terminal beta strands. Many C2 domains are Ca2+-dependent membrane-targeting modules that bind a wide variety of substances including bind phospholipids, inositol polyphosphates, and intracellular proteins.  Most C2 domain proteins are either signal transduction enzymes that contain a single C2 domain, such as protein kinase C, or membrane trafficking proteins which contain at least two C2 domains, such as synaptotagmin 1.  However, there are a few exceptions to this including RIM isoforms and some splice varian
Probab=21.96  E-value=1.8e+02  Score=21.50  Aligned_cols=28  Identities=11%  Similarity=-0.041  Sum_probs=23.5

Q ss_pred             ceeeeEEeceeeecCCceeEEEEEeehh
Q psy12064        116 VKHQICVKDYCFARDDRLVGVAVLQLKD  143 (148)
Q Consensus       116 GScalcVKDyCf~r~dr~vG~~vlql~~  143 (148)
                      -++.+.|+|+=-...|..+|.+.++|.+
T Consensus        62 ~~l~~~V~d~d~~~~dd~iG~~~i~l~~   89 (121)
T cd04016          62 DSIYIEIFDERAFTMDERIAWTHITIPE   89 (121)
T ss_pred             cEEEEEEEeCCCCcCCceEEEEEEECch
Confidence            4678899988777789999999999964


No 159
>cd08676 C2A_Munc13-like C2 domain first repeat in Munc13 (mammalian uncoordinated)-like proteins. C2-like domains are thought to be involved in phospholipid binding in a Ca2+ independent manner in both Unc13 and Munc13. Caenorabditis elegans Unc13 has a central domain with sequence similarity to PKC, which includes C1 and C2-related domains. Unc13 binds phorbol esters and DAG with high affinity in a phospholipid manner.  Mutations in Unc13 results in abnormal neuronal connections and impairment in cholinergic neurotransmission in the nematode.  Munc13 is the mammalian homolog which are expressed in the brain.  There are 3 isoforms (Munc13-1, -2, -3) and are thought to play a role in neurotransmitter release and are hypothesized to be high-affinity receptors for phorbol esters.  Unc13 and Munc13 contain both C1 and C2 domains.  There are two C2 related domains present, one central and one at the carboxyl end.  Munc13-1 contains a third C2-like domain.  Munc13 interacts with syntaxin, sy
Probab=21.87  E-value=1.1e+02  Score=23.75  Aligned_cols=30  Identities=27%  Similarity=0.283  Sum_probs=22.6

Q ss_pred             ceEEEeeeeceeeccCCeeeeeeeeeccchhccc
Q psy12064         83 FFELHICVKDYCFARDDRLVGVAVLQLKDIVEQV  116 (148)
Q Consensus        83 ~yEL~~~VKDYCFar~Dr~vG~av~qL~~iAeKG  116 (148)
                      .-.|.+.|.|+=    |.++|-+.+++.++...|
T Consensus       117 ~~~L~i~V~D~d----d~~IG~v~i~l~~l~~~~  146 (153)
T cd08676         117 NDQLHLDIWDHD----DDFLGCVNIPLKDLPSCG  146 (153)
T ss_pred             CCEEEEEEEecC----CCeEEEEEEEHHHhCCCC
Confidence            346777777773    889999999999988443


No 160
>PF13170 DUF4003:  Protein of unknown function (DUF4003)
Probab=21.80  E-value=1.7e+02  Score=25.21  Aligned_cols=51  Identities=12%  Similarity=0.214  Sum_probs=38.7

Q ss_pred             HHHHHHHHHHhhhhcCCCccccccccCcchhhHHHHHhhhhhhhHHHHHHHHHhh
Q psy12064         13 LDASLDSIKNYFHAAGNGLKKTYLDKSPELASLRYALSLYTQTTDALIKTFVQSQ   67 (148)
Q Consensus        13 ld~aldtiK~yFhagg~GlKk~fLeks~~l~slryalsLytqtTd~LIk~fv~tQ   67 (148)
                      .|...+.+-+||+.    |++.-+.|+-+||.|-++|+|..-..+.=+++.++..
T Consensus       155 ~e~l~~~~E~~Y~~----L~~~~f~kgn~LQ~LS~iLaL~~~~~~~~v~r~~~l~  205 (297)
T PF13170_consen  155 VEELAERMEQCYQK----LADAGFKKGNDLQFLSHILALSEGDDQEKVARVIELY  205 (297)
T ss_pred             HHHHHHHHHHHHHH----HHHhCCCCCcHHHHHHHHHHhccccchHHHHHHHHHH
Confidence            46667888899887    6665667888999999999998776655577665543


No 161
>cd05023 S-100A11 S-100A11: S-100A11 domain found in proteins similar to S100A11. S100A11 is a member of the S-100 domain family within EF-hand Ca2+-binding proteins superfamily. Note that the S-100 hierarchy, to which this S-100A11 group belongs, contains only S-100 EF-hand domains, other EF-hands have been modeled separately. S100 proteins exhibit unique patterns of tissue- and cell type-specific expression and have been implicated in the Ca2+-dependent regulation of diverse physiological processes, including cell cycle regulation, differentiation, growth, and metabolic control . S100 proteins have also been associated with a variety of pathological events, including neoplastic transformation and neurodegenerative diseases such as Alzheimer's, usually via over expression of the protein. S100A11 is expressed in smooth muscle and other tissues and involves in calcium-dependent membrane aggregation, which is important for cell vesiculation . As is the case for many other S100 proteins, S
Probab=21.37  E-value=83  Score=22.20  Aligned_cols=50  Identities=16%  Similarity=0.262  Sum_probs=24.3

Q ss_pred             HHHHHHHHHHhhhh----cCCCccccccccCcchhhHHHHHh---hhhhhhHHHHHHHHHh
Q psy12064         13 LDASLDSIKNYFHA----AGNGLKKTYLDKSPELASLRYALS---LYTQTTDALIKTFVQS   66 (148)
Q Consensus        13 ld~aldtiK~yFha----gg~GlKk~fLeks~~l~slryals---LytqtTd~LIk~fv~t   66 (148)
                      ||-++.+|..-||-    +|+   +.+|++ .||++|-...-   +.++..+.-+...++.
T Consensus         4 le~~i~~l~~~F~~y~~~dg~---~~~Ls~-~Elk~ll~~e~~~~~~~~~~~~~~~~ll~~   60 (89)
T cd05023           4 TERCIESLIAVFQKYAGKDGD---SYQLSK-TEFLSFMNTELASFTKNQKDPGVLDRMMKK   60 (89)
T ss_pred             HHHHHHHHHHHHHHHhccCCC---cCeECH-HHHHHHHHHhhhHhhcCCCCHHHHHHHHHH
Confidence            55666666666655    443   345666 35555433321   2233334445554443


No 162
>KOG0997|consensus
Probab=21.00  E-value=67  Score=30.72  Aligned_cols=55  Identities=35%  Similarity=0.515  Sum_probs=37.4

Q ss_pred             HHHHHHHhhhhcC--------CCccccccccCcch-----------hhHHHH-Hhhhhh-----hhHHHHHHHHHhhccc
Q psy12064         16 SLDSIKNYFHAAG--------NGLKKTYLDKSPEL-----------ASLRYA-LSLYTQ-----TTDALIKTFVQSQCNE   70 (148)
Q Consensus        16 aldtiK~yFhagg--------~GlKk~fLeks~~l-----------~slrya-lsLytq-----tTd~LIk~fv~tQ~~q   70 (148)
                      +++++-+|||.+|        .|.|-.||.|||=+           +.|.-= +-||.|     |--+|-+.|-..|.++
T Consensus       146 v~~alISf~q~~~~~i~si~a~g~k~vfl~kspl~LvA~s~t~~Sa~qL~~qL~~ly~QIlS~LT~~ql~~if~~r~NfD  225 (523)
T KOG0997|consen  146 VMQALISFFQVSGLAITSIHAFGNKLVFLQKSPLLLVAVSRTSQSAAQLLQQLLLLYCQILSILTASQLQRIFNKRQNFD  225 (523)
T ss_pred             HHHHHHHHHhhCCceEEEEEecCceEEEEecCcEEEEEEcccccCHHHHHHHHHHHHHHHHHHHHHHHHHHHHhcccCch
Confidence            4678889999999        58889999999854           122211 125555     4456667777777766


No 163
>cd04020 C2B_SLP_1-2-3-4 C2 domain second repeat present in Synaptotagmin-like proteins 1-4. All Slp members basically share an N-terminal Slp homology domain (SHD) and C-terminal tandem C2 domains (named the C2A domain and the C2B domain) with the SHD and C2 domains being separated by a linker sequence of various length.  Slp1/JFC1 and Slp2/exophilin 4 promote granule docking to the plasma membrane.  Additionally, their C2A domains are both Ca2+ independent, unlike the case in Slp3 and Slp4/granuphilin in which their C2A domains are Ca2+ dependent.  It is thought that SHD (except for the Slp4-SHD) functions as a specific Rab27A/B-binding domain. In addition to Slps, rabphilin, Noc2, and  Munc13-4 also function as Rab27-binding proteins. It has been demonstrated that Slp3 and Slp4/granuphilin promote dense-core vesicle exocytosis. C2 domains fold into an 8-standed beta-sandwich that can adopt 2 structural arrangements: Type I and Type II, distinguished by a circular permutation involvin
Probab=20.82  E-value=1.3e+02  Score=23.13  Aligned_cols=31  Identities=16%  Similarity=0.018  Sum_probs=26.2

Q ss_pred             ceeeeEEeceeeecCCceeEEEEEeehhhhh
Q psy12064        116 VKHQICVKDYCFARDDRLVGVAVLQLKDIVE  146 (148)
Q Consensus       116 GScalcVKDyCf~r~dr~vG~~vlql~~i~~  146 (148)
                      -.+.+.|.|+-..+.|..+|-+.+.+.++..
T Consensus        96 ~~L~i~V~d~d~~~~d~~lG~v~i~l~~~~~  126 (162)
T cd04020          96 ACLELTVWDHDKLSSNDFLGGVRLGLGTGKS  126 (162)
T ss_pred             CEEEEEEEeCCCCCCCceEEEEEEeCCcccc
Confidence            4688889998877889999999999998753


No 164
>cd04029 C2A_SLP-4_5 C2 domain first repeat present in Synaptotagmin-like proteins 4 and 5. All Slp members basically share an N-terminal Slp homology domain (SHD) and C-terminal tandem C2 domains (named the C2A domain and the C2B domain) with the SHD and C2 domains being separated by a linker sequence of various length. SHD of Slp (except for the Slp4-SHD) function as a specific Rab27A/B-binding domain.  In addition to Slp, rabphilin, Noc2, and  Munc13-4 also function as Rab27-binding proteins. It has been demonstrated that Slp4/granuphilin promotes dense-core vesicle exocytosis. The C2A domain of Slp4 is Ca2+ dependent. Slp5 mRNA has been shown to be restricted to human placenta and liver suggesting a role in Rab27A-dependent membrane trafficking in specific tissues. C2 domains fold into an 8-standed beta-sandwich that can adopt 2 structural arrangements: Type I and Type II, distinguished by a circular permutation involving their N- and C-terminal beta strands. Many C2 domains are Ca2
Probab=20.46  E-value=1.4e+02  Score=21.56  Aligned_cols=32  Identities=19%  Similarity=0.167  Sum_probs=26.7

Q ss_pred             ccceeeeEEeceeeecCCceeEEEEEeehhhh
Q psy12064        114 EQVKHQICVKDYCFARDDRLVGVAVLQLKDIV  145 (148)
Q Consensus       114 eKGScalcVKDyCf~r~dr~vG~~vlql~~i~  145 (148)
                      +.-++.+.|.||=..+.+..+|-+.+.|.++.
T Consensus        82 ~~~~L~~~V~d~~~~~~~~~lG~~~i~l~~~~  113 (125)
T cd04029          82 ETRTLQLSVWHYDRFGRNTFLGEVEIPLDSWN  113 (125)
T ss_pred             CCCEEEEEEEECCCCCCCcEEEEEEEeCCccc
Confidence            44578899999877778889999999998873


Done!