Query         psy12066
Match_columns 164
No_of_seqs    78 out of 80
Neff          2.1 
Searched_HMMs 46136
Date          Fri Aug 16 17:48:01 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy12066.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/12066hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG3841|consensus              100.0 3.5E-39 7.7E-44  287.5   7.7  108    7-126    34-144 (455)
  2 smart00426 TEA TEA domain.     100.0 2.8E-31 6.2E-36  188.7   3.0   66   57-123     1-68  (68)
  3 PF01285 TEA:  TEA/ATTS domain   99.9 1.6E-28 3.5E-33  216.8   0.4   81   55-138    45-134 (431)
  4 TIGR01557 myb_SHAQKYF myb-like  68.8     4.5 9.7E-05   27.5   2.2   20   60-79      4-23  (57)
  5 cd06407 PB1_NLP A PB1 domain i  57.7     6.1 0.00013   28.3   1.3   38   51-88     41-79  (82)
  6 PF00515 TPR_1:  Tetratricopept  56.5     9.9 0.00021   21.1   1.8   16   64-79     18-33  (34)
  7 COG2877 KdsA 3-deoxy-D-manno-o  55.1       7 0.00015   34.9   1.5   28   76-103   153-180 (279)
  8 PF13926 DUF4211:  Domain of un  48.6      21 0.00046   27.2   3.1   20   58-81     88-107 (153)
  9 PF00249 Myb_DNA-binding:  Myb-  47.6      24 0.00053   21.8   2.7   21   60-80      2-22  (48)
 10 PF07719 TPR_2:  Tetratricopept  46.7      26 0.00056   18.9   2.5   16   65-80     19-34  (34)
 11 PF12218 End_N_terminal:  N ter  44.9      25 0.00055   25.7   2.8   44   67-138    10-55  (67)
 12 smart00028 TPR Tetratricopepti  36.5      42 0.00091   15.6   2.1   16   64-79     18-33  (34)
 13 KOG4132|consensus               36.3      15 0.00033   32.5   0.7   52   63-114    63-134 (260)
 14 PF10488 PP1c_bdg:  Phosphatase  31.3      76  0.0016   28.7   4.2   27   10-36     82-108 (307)
 15 PF00877 NLPC_P60:  NlpC/P60 fa  29.5      43 0.00093   23.2   1.9   26  138-163    46-77  (105)
 16 PF15163 Meiosis_expr:  Meiosis  28.4      37 0.00079   25.4   1.5   16   60-75      5-20  (77)
 17 cd08867 START_STARD4_5_6-like   25.8 1.7E+02  0.0036   22.8   4.8   77   66-145     7-87  (206)
 18 PF00665 rve:  Integrase core d  24.8      49  0.0011   22.2   1.5   41   63-105    49-89  (120)
 19 PRK10424 ilvG operon leader pe  23.3      26 0.00057   22.5  -0.1    7   75-81     18-24  (32)
 20 PF07533 BRK:  BRK domain;  Int  23.2      40 0.00087   22.3   0.8   28  107-134    13-46  (46)
 21 PF11330 DUF3132:  Protein of u  22.8      62  0.0014   25.7   1.9   17  144-160    76-94  (124)
 22 PF08302 tRNA_lig_CPD:  Fungal   21.3      62  0.0013   27.4   1.7   16   63-78     27-43  (257)
 23 PRK01388 arginine deiminase; P  21.0      94   0.002   28.1   2.9   32  130-162   201-232 (406)
 24 PF00778 DIX:  DIX domain;  Int  20.9      35 0.00075   25.0   0.2   34  122-159    46-80  (84)
 25 smart00678 WWE Domain in Delte  20.5      61  0.0013   21.5   1.3   10   63-72     20-29  (73)
 26 PF13230 GATase_4:  Glutamine a  20.2      42 0.00091   28.2   0.5   28  127-154   230-258 (271)

No 1  
>KOG3841|consensus
Probab=100.00  E-value=3.5e-39  Score=287.48  Aligned_cols=108  Identities=44%  Similarity=0.641  Sum_probs=85.9

Q ss_pred             cccccccccCCCcCCCCCCCCCCCCCCCCCCCCccccCCCCcccccc-ccCCCCCCCChhHHHHHHHHHHhcCCCCccee
Q psy12066          7 FGLVTGTISSPWTPGSAAVPPGADTNGSGGDSKHALDVGDLDDDKDL-AAADAEGVWSPDIEQSFQEALAIYPPCGRRKI   85 (164)
Q Consensus         7 ~~~~~gTIsspWTp~~~g~p~g~~w~~~~s~~~~~~~~~~~~~~~~~-~~~d~e~VWs~DIEqAF~EALaIyPp~GRrKI   85 (164)
                      .+-+|++..+.|++.+.|.+||+.  +..         +++..++.. .+.|+|+||||||||||||||+||||||||||
T Consensus        34 ~ag~a~~n~~q~~~~~~~~g~~s~--~~~---------~p~~~~~~~D~~~daegvWSpdIEqsFqEALaiyppcGrrKI  102 (455)
T KOG3841|consen   34 VAGAAGDNIPQWELVNTGLGAGSA--DLK---------GPEAKDKFTDNQRDAEGVWSPDIEQSFQEALAIYPPCGRRKI  102 (455)
T ss_pred             hccccccCCcCceecCCCCCCCcc--ccC---------CccccccCCccccccccccChhHHHHHHHHHhhcCCCCceeE
Confidence            455677888999998887654432  111         111112221 13399999999999999999999999999999


Q ss_pred             eeCCCCcccccchhhhhccccccCCCccccc--chhhhHHHhh
Q psy12066         86 ILSDEGKMYETVGTFGRKKNPTKGGKGAVGG--IDLMGFLKAQ  126 (164)
Q Consensus        86 iLSdeGK~yGRNELIa~YI~~~tgGK~R~~~--~~l~~~lK~~  126 (164)
                      |||||||||||||||||||++| |||+|||+  ++|+|+|++.
T Consensus       103 ilsdegkmyGRNELIarYIKlr-tgktRTrKQVSSHIQVlarr  144 (455)
T KOG3841|consen  103 ILSDEGKMYGRNELIARYIKLR-TGKTRTRKQVSSHIQVLARR  144 (455)
T ss_pred             EEccCccccchHHHHHHHHHHh-cCCchhHHHHHHHHHHHHHH
Confidence            9999999999999999999976 59999988  7899999875


No 2  
>smart00426 TEA TEA domain.
Probab=99.96  E-value=2.8e-31  Score=188.67  Aligned_cols=66  Identities=62%  Similarity=0.960  Sum_probs=61.0

Q ss_pred             CCCCCCChhHHHHHHHHHHhcCCCCcceeeeCCCCcccccchhhhhccccccCCCccccc--chhhhHH
Q psy12066         57 DAEGVWSPDIEQSFQEALAIYPPCGRRKIILSDEGKMYETVGTFGRKKNPTKGGKGAVGG--IDLMGFL  123 (164)
Q Consensus        57 d~e~VWs~DIEqAF~EALaIyPp~GRrKIiLSdeGK~yGRNELIa~YI~~~tgGK~R~~~--~~l~~~l  123 (164)
                      |.++|||+|||+||.|||++|||||+|||+++++|||||||||||+||+. +|||.||++  ++|+|+|
T Consensus         1 dg~~vWp~~lE~Af~~aL~~~~~~g~~kik~~~r~k~~gRNelIs~YI~~-~tGk~Rt~KQVsShIQvl   68 (68)
T smart00426        1 DAEGVWSPDIEQAFQEALAIYPPCGRRKIILSDEGKMYGRNELIARYIKL-RTGKTRTRKQVSSHIQVL   68 (68)
T ss_pred             CCCCcCcHHHHHHHHHHHHHcCccCcccchhhhcCcccchhHHHHHHHHH-HhCCccchhhhcchheeC
Confidence            67899999999999999999999999999999999999999999999995 569999988  6677764


No 3  
>PF01285 TEA:  TEA/ATTS domain family;  InterPro: IPR000818 Transcriptional enhancer activators are nuclear proteins that contain a TEA/ATTSdomain, a DNA-binding region of 66-68 amino acids. The TEA/ATTS domain is found in the N-termini of certain gene regulatory proteins, such as the Simian virus 40 (SV40) enhancer factor TEF-1, yeast trans-acting factor TEC-1 (which is required for TY1 enhancer activity), and the Aspergillus abaA regulatory gene product. SV40 and retroviral enhancers, and those to which TEF-1, TEC-1 and abaA proteins bind, contain GT-IIC sites: the TEA/ATTS domain may therefore recognise and bind such sites. Secondary structure predictions suggest the presence of 3 helices, but have not confirmed the presence of the helix-turn-helix motif characteristic of many DNA-binding proteins: DNA-binding may therefore be effected by a different mechanism [].; GO: 0003700 sequence-specific DNA binding transcription factor activity, 0006355 regulation of transcription, DNA-dependent, 0005634 nucleus; PDB: 3L15_B 2HZD_A 3KYS_A 3JUA_C 4EAZ_B.
Probab=99.94  E-value=1.6e-28  Score=216.75  Aligned_cols=81  Identities=46%  Similarity=0.719  Sum_probs=45.2

Q ss_pred             cCCCCCCCChhHHHHHHHHHHhcCCCCcceeeeCCCCcccccchhhhhccccccCCCccccc--chhhhHHHh----h--
Q psy12066         55 AADAEGVWSPDIEQSFQEALAIYPPCGRRKIILSDEGKMYETVGTFGRKKNPTKGGKGAVGG--IDLMGFLKA----Q--  126 (164)
Q Consensus        55 ~~d~e~VWs~DIEqAF~EALaIyPp~GRrKIiLSdeGK~yGRNELIa~YI~~~tgGK~R~~~--~~l~~~lK~----~--  126 (164)
                      +.++++||++|||+||+|||+||||||||||  +++|||||||||||+||+.+ |||.||++  .+|+|+|++    .  
T Consensus        45 ~~~~~~vw~~~~e~af~~al~~~~~~g~~k~--~~~~~~~grn~li~~yi~~~-tg~~rt~kqvsshiqvl~~~~~~~~k  121 (431)
T PF01285_consen   45 DGDGEGVWPPDIEQAFQEALAIYPPCGRRKL--SDEGKMYGRNELISDYIKLK-TGKTRTRKQVSSHIQVLKREIQNKLK  121 (431)
T ss_dssp             -GGGS--S-HHHHHHHHHHHHHS-SSS---H--HHH-----THHHHHHHHHHH-HS----SHHHHHHHHHHTT-------
T ss_pred             CCCCCCCCCHHHHHHHHHHHHhCCCCCCccc--ccccccccchhHHHHHHHHH-hCcccchhHHHHHHHHHHHHHhhccc
Confidence            5789999999999999999999999999995  77999999999999999965 59999988  678888821    1  


Q ss_pred             -hccccccccccc
Q psy12066        127 -RYEGRELWEELP  138 (164)
Q Consensus       127 -r~e~~~~W~~l~  138 (164)
                       ....++.|..|.
T Consensus       122 ~~~~kd~~l~~l~  134 (431)
T PF01285_consen  122 DQTAKDKALQSLI  134 (431)
T ss_dssp             -------------
T ss_pred             ccccccHHHHhhh
Confidence             133666776664


No 4  
>TIGR01557 myb_SHAQKYF myb-like DNA-binding domain, SHAQKYF class. This model describes a DNA-binding domain restricted to (but common in) plant proteins, many of which also contain a response regulator domain. The domain appears related to the Myb-like DNA-binding domain described by Pfam model pfam00249. It is distinguished in part by a well-conserved motif SH[AL]QKY[RF] at the C-terminal end of the motif.
Probab=68.82  E-value=4.5  Score=27.47  Aligned_cols=20  Identities=25%  Similarity=0.496  Sum_probs=17.6

Q ss_pred             CCCChhHHHHHHHHHHhcCC
Q psy12066         60 GVWSPDIEQSFQEALAIYPP   79 (164)
Q Consensus        60 ~VWs~DIEqAF~EALaIyPp   79 (164)
                      -.|++|.++.|.+|+..+..
T Consensus         4 ~~WT~eeh~~Fl~ai~~~G~   23 (57)
T TIGR01557         4 VVWTEDLHDRFLQAVQKLGG   23 (57)
T ss_pred             CCCCHHHHHHHHHHHHHhCC
Confidence            47999999999999999853


No 5  
>cd06407 PB1_NLP A PB1 domain is present in NIN like proteins (NLP), a key enzyme in a process of establishment of symbiosis betweeen legumes and nitrogen fixing bacteria (Rhizobium). The PB1 domain is a modular domain mediating specific protein-protein interaction which play a role in many critical cell processes like osteoclastogenesis, angiogenesis, early cardiovascular development, and cell polarity. A canonical PB1-PB1 interaction, which involves heterodimerization of two PB1 domains, is required for the formation of macromolecular signaling complexes ensuring specificity and fidelity during cellular signaling. The interaction between two PB1 domain depends on the type of PB1. There are three types of PB1 domains: type I which contains an OPCA motif, acidic aminoacid cluster, type II which contains a basic cluster, and type I/II which contains both an OPCA motif and a basic cluster.  Interactions of PB1 domains with other protein domains have been described as noncanonical PB1-inte
Probab=57.70  E-value=6.1  Score=28.31  Aligned_cols=38  Identities=24%  Similarity=0.406  Sum_probs=27.3

Q ss_pred             cccccCCCCCCCChh-HHHHHHHHHHhcCCCCcceeeeC
Q psy12066         51 KDLAAADAEGVWSPD-IEQSFQEALAIYPPCGRRKIILS   88 (164)
Q Consensus        51 ~~~~~~d~e~VWs~D-IEqAF~EALaIyPp~GRrKIiLS   88 (164)
                      -.++=.|+|+-|..= =.+=++||++|+..+++++|+|+
T Consensus        41 f~LkY~Ddegd~v~ltsd~DL~eai~i~~~~~~~~v~l~   79 (82)
T cd06407          41 FDLKYLDDDEEWVLLTCDADLEECIDVYRSSGSHTIRLL   79 (82)
T ss_pred             eEEEEECCCCCeEEeecHHHHHHHHHHHHHCCCCeEEEE
Confidence            344445666777532 23448899999999999999985


No 6  
>PF00515 TPR_1:  Tetratricopeptide repeat;  InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ]. It mediates protein-protein interactions and the assembly of multiprotein complexes []. The TPR motif consists of 3-16 tandem-repeats of 34 amino acids residues, although individual TPR motifs can be dispersed in the protein sequence. Sequence alignment of the TPR domains reveals a consensus sequence defined by a pattern of small and large amino acids. TPR motifs have been identified in various different organisms, ranging from bacteria to humans. Proteins containing TPRs are involved in a variety of biological processes, such as cell cycle regulation, transcriptional control, mitochondrial and peroxisomal protein transport, neurogenesis and protein folding. The X-ray structure of a domain containing three TPRs from protein phosphatase 5 revealed that TPR adopts a helix-turn-helix arrangement, with adjacent TPR motifs packing in a parallel fashion, resulting in a spiral of repeating anti-parallel alpha-helices []. The two helices are denoted helix A and helix B. The packing angle between helix A and helix B is ~24 degrees; within a single TPR and generates a right-handed superhelical shape. Helix A interacts with helix B and with helix A' of the next TPR. Two protein surfaces are generated: the inner concave surface is contributed to mainly by residue on helices A, and the other surface presents residues from both helices A and B. ; GO: 0005515 protein binding; PDB: 3SF4_C 2LNI_A 1ELW_A 2C0M_A 1FCH_B 3R9A_B 2J9Q_A 2C0L_A 1KT1_A 3FWV_A ....
Probab=56.51  E-value=9.9  Score=21.09  Aligned_cols=16  Identities=25%  Similarity=0.416  Sum_probs=13.2

Q ss_pred             hhHHHHHHHHHHhcCC
Q psy12066         64 PDIEQSFQEALAIYPP   79 (164)
Q Consensus        64 ~DIEqAF~EALaIyPp   79 (164)
                      ++-.++|++||+|.|.
T Consensus        18 ~~A~~~~~~al~~~p~   33 (34)
T PF00515_consen   18 EEALEYYQRALELDPD   33 (34)
T ss_dssp             HHHHHHHHHHHHHSTT
T ss_pred             hHHHHHHHHHHHHCcC
Confidence            3557899999999985


No 7  
>COG2877 KdsA 3-deoxy-D-manno-octulosonic acid (KDO) 8-phosphate synthase [Cell envelope biogenesis, outer membrane]
Probab=55.07  E-value=7  Score=34.85  Aligned_cols=28  Identities=18%  Similarity=0.283  Sum_probs=24.6

Q ss_pred             hcCCCCcceeeeCCCCcccccchhhhhc
Q psy12066         76 IYPPCGRRKIILSDEGKMYETVGTFGRK  103 (164)
Q Consensus        76 IyPp~GRrKIiLSdeGK~yGRNELIa~Y  103 (164)
                      -.-.+|..||+|.++|-+||=|-|++|.
T Consensus       153 K~~~~gn~~v~lcERG~sFGYnnLV~DM  180 (279)
T COG2877         153 KFLETGNNKVILCERGASFGYNNLVVDM  180 (279)
T ss_pred             HHHhcCCCcEEEEeccCccCcchhHHHh
Confidence            3345899999999999999999999985


No 8  
>PF13926 DUF4211:  Domain of unknown function (DUF4211)
Probab=48.62  E-value=21  Score=27.23  Aligned_cols=20  Identities=40%  Similarity=0.961  Sum_probs=15.9

Q ss_pred             CCCCCChhHHHHHHHHHHhcCCCC
Q psy12066         58 AEGVWSPDIEQSFQEALAIYPPCG   81 (164)
Q Consensus        58 ~e~VWs~DIEqAF~EALaIyPp~G   81 (164)
                      ...+|+++    |.+||..||.+-
T Consensus        88 ~ss~W~~~----f~~aL~~~P~l~  107 (153)
T PF13926_consen   88 SSSAWKPD----FKKALETYPELS  107 (153)
T ss_pred             eeccCCHH----HHHHHHHCCCeE
Confidence            34578765    999999999883


No 9  
>PF00249 Myb_DNA-binding:  Myb-like DNA-binding domain;  InterPro: IPR014778 The retroviral oncogene v-myb, and its cellular counterpart c-myb, encode nuclear DNA-binding proteins. These belong to the SANT domain family that specifically recognise the sequence YAAC(G/T)G [, ]. In myb, one of the most conserved regions consisting of three tandem repeats has been shown to be involved in DNA-binding [].; PDB: 1X41_A 2XAF_B 2XAG_B 2XAH_B 2UXN_B 2Y48_B 2XAQ_B 2X0L_B 2IW5_B 2XAJ_B ....
Probab=47.57  E-value=24  Score=21.84  Aligned_cols=21  Identities=24%  Similarity=0.518  Sum_probs=17.6

Q ss_pred             CCCChhHHHHHHHHHHhcCCC
Q psy12066         60 GVWSPDIEQSFQEALAIYPPC   80 (164)
Q Consensus        60 ~VWs~DIEqAF~EALaIyPp~   80 (164)
                      +.|+++=++.|.+|+..+++.
T Consensus         2 ~~Wt~eE~~~l~~~v~~~g~~   22 (48)
T PF00249_consen    2 GPWTEEEDEKLLEAVKKYGKD   22 (48)
T ss_dssp             -SS-HHHHHHHHHHHHHSTTT
T ss_pred             CCCCHHHHHHHHHHHHHhCCc
Confidence            579999999999999999876


No 10 
>PF07719 TPR_2:  Tetratricopeptide repeat;  InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ]. It mediates protein-protein interactions and the assembly of multiprotein complexes []. The TPR motif consists of 3-16 tandem-repeats of 34 amino acids residues, although individual TPR motifs can be dispersed in the protein sequence. Sequence alignment of the TPR domains reveals a consensus sequence defined by a pattern of small and large amino acids. TPR motifs have been identified in various different organisms, ranging from bacteria to humans. Proteins containing TPRs are involved in a variety of biological processes, such as cell cycle regulation, transcriptional control, mitochondrial and peroxisomal protein transport, neurogenesis and protein folding. This repeat includes outlying Tetratricopeptide-like repeats (TPR) that are not matched by IPR001440 from INTERPRO.; PDB: 1XNF_B 3Q15_A 4ABN_A 1OUV_A 3U4T_A 3MA5_C 2KCV_A 2KCL_A 2XEV_A 3NF1_A ....
Probab=46.72  E-value=26  Score=18.92  Aligned_cols=16  Identities=25%  Similarity=0.422  Sum_probs=12.9

Q ss_pred             hHHHHHHHHHHhcCCC
Q psy12066         65 DIEQSFQEALAIYPPC   80 (164)
Q Consensus        65 DIEqAF~EALaIyPp~   80 (164)
                      +-.+.|++||++.|.+
T Consensus        19 ~A~~~~~~al~l~p~~   34 (34)
T PF07719_consen   19 EAIEYFEKALELDPNN   34 (34)
T ss_dssp             HHHHHHHHHHHHSTTS
T ss_pred             HHHHHHHHHHHHCcCC
Confidence            4567899999999963


No 11 
>PF12218 End_N_terminal:  N terminal extension of bacteriophage endosialidase;  InterPro: IPR024429 This entry represents the N-terminal extension domain of endosialidases which is approximately 70 amino acids in length. The two N-terminal domains (this domain and the beta propeller) assemble in the compact 'cap' whereas the C-terminal domain forms an extended tail-like structure. The very N-terminal part of the 'cap' region (residues 246 to 312) holds the only alpha-helix of the protein and is presumably the residual part of the deleted N-terminal head-binding domain [].; PDB: 3JU4_A 3GVL_A 3GVK_B 3GVJ_A 1V0E_B 1V0F_E.
Probab=44.89  E-value=25  Score=25.71  Aligned_cols=44  Identities=32%  Similarity=0.421  Sum_probs=26.2

Q ss_pred             HHHHHHHHHhcCCCCcceeeeCCCCcccccchh--hhhccccccCCCcccccchhhhHHHhhhccccccccccc
Q psy12066         67 EQSFQEALAIYPPCGRRKIILSDEGKMYETVGT--FGRKKNPTKGGKGAVGGIDLMGFLKAQRYEGRELWEELP  138 (164)
Q Consensus        67 EqAF~EALaIyPp~GRrKIiLSdeGK~yGRNEL--Ia~YI~~~tgGK~R~~~~~l~~~lK~~r~e~~~~W~~l~  138 (164)
                      .+||-+||+.-|..  +||=.  .|..|-=|.|  |++|+.                        .+++|||++
T Consensus        10 t~A~~a~l~a~~~g--~~IDg--~GlTykVs~lPd~srf~N------------------------~rF~~eri~   55 (67)
T PF12218_consen   10 TAAITAALEASPVG--RKIDG--AGLTYKVSSLPDISRFKN------------------------ARFVYERIP   55 (67)
T ss_dssp             HHHHHHHHHHS-TT--S-EE---TT-EEEESS---GGGEES-------------------------EEEE-SST
T ss_pred             HHHHHHHHhccCCC--eEEec--CCceEEEeeCccHHhhcc------------------------ceEEEeecC
Confidence            47899999988753  56644  5777766655  555544                        678999986


No 12 
>smart00028 TPR Tetratricopeptide repeats. Repeats present in 4 or more copies in proteins. Contain a minimum of 34 amino acids each and self-associate via a "knobs and holes" mechanism.
Probab=36.47  E-value=42  Score=15.64  Aligned_cols=16  Identities=19%  Similarity=0.403  Sum_probs=11.6

Q ss_pred             hhHHHHHHHHHHhcCC
Q psy12066         64 PDIEQSFQEALAIYPP   79 (164)
Q Consensus        64 ~DIEqAF~EALaIyPp   79 (164)
                      ++....|++|+.+.|.
T Consensus        18 ~~a~~~~~~~~~~~~~   33 (34)
T smart00028       18 DEALEYYEKALELDPN   33 (34)
T ss_pred             HHHHHHHHHHHccCCC
Confidence            3456678888888774


No 13 
>KOG4132|consensus
Probab=36.32  E-value=15  Score=32.51  Aligned_cols=52  Identities=23%  Similarity=0.129  Sum_probs=37.9

Q ss_pred             ChhHHHHHHHHHH--hcCC--------------C----CcceeeeCCCCcccccchhhhhccccccCCCccc
Q psy12066         63 SPDIEQSFQEALA--IYPP--------------C----GRRKIILSDEGKMYETVGTFGRKKNPTKGGKGAV  114 (164)
Q Consensus        63 s~DIEqAF~EALa--IyPp--------------~----GRrKIiLSdeGK~yGRNELIa~YI~~~tgGK~R~  114 (164)
                      ||-.-+|..|||.  .-+-              .    =||++-|.-+|+-||+-|..||||--..++|+.-
T Consensus        63 SpR~VEa~~eaL~q~~tel~~~w~a~~vYtVG~aT~~si~~~~~l~T~Ge~~gNa~~LaD~Ive~~~~~~al  134 (260)
T KOG4132|consen   63 SPRCVEALNEALIQTETELKAAWLAKHVYTVGPATHASIRRLGFLNTHGEDAGNAEILADLIVETFTDKRAL  134 (260)
T ss_pred             ChHHHHHHHHHhccccchhhhHHhhcceeeeccccHHHHHHhcCccccccccccHHHHhHhhhhcCCCcccC
Confidence            5677777777776  1111              1    1566667779999999999999999877777654


No 14 
>PF10488 PP1c_bdg:  Phosphatase-1 catalytic subunit binding region;  InterPro: IPR019523  This entry represents the conserved C terminus of the regulatory subunit (15A and 15B) of protein phosphatase 1. This C-terminal domain appears to be a binding region for the catalytic subunit (PP1C) of protein phosphatase-1, which may in some circumstances also be retroviral in origin since it is found in both herpes simplex virus and in mouse and man. This domain is found in Gadd-34 apoptosis-associated proteins as well as the constitutive repressor of eIF2-alpha phosphorylation/protein phosphatase 1, regulatory (inhibitor) subunit 15b, otherwise known as CReP. Diverse stressful conditions are associated with phosphorylation of the alpha-subunit of eukaryotic translation initiation factor 2 (eIF2-alpha) on serine 51. This signaling event, which is conserved from yeast to mammals, negatively regulates the guanine nucleotide exchange factor, eIF2-B and inhibits the recycling of eIF2 to its active GTP bound form. In mammalian cells eIF2-alpha phosphorylation emerges as an important event in stress signaling that impacts on gene expression at both the translational and transcriptional levels []. 
Probab=31.34  E-value=76  Score=28.70  Aligned_cols=27  Identities=22%  Similarity=0.216  Sum_probs=20.5

Q ss_pred             ccccccCCCcCCCCCCCCCCCCCCCCC
Q psy12066         10 VTGTISSPWTPGSAAVPPGADTNGSGG   36 (164)
Q Consensus        10 ~~gTIsspWTp~~~g~p~g~~w~~~~s   36 (164)
                      -..||.++|||....++-..+|++..+
T Consensus        82 fta~iqt~~~~~~~~~~~e~d~s~~~~  108 (307)
T PF10488_consen   82 FTATIQTAATPVPKDPSSEKDLSDKSD  108 (307)
T ss_pred             ccccccccccCCCCCCccccccccccc
Confidence            357899999998888765667766555


No 15 
>PF00877 NLPC_P60:  NlpC/P60 family;  InterPro: IPR000064 The Escherichia coli NLPC/Listeria P60 domain occurs at the C terminus of a number of different bacterial and viral proteins. The viral proteins are either described as tail assembly proteins or Gp19. In bacteria, the proteins are variously described as being putative tail component of prophage, invasin, invasion associated protein, putative lipoprotein, cell wall hydrolase, or putative endopeptidase.  The E. coli NLPC/Listeria P60 domain is contained within the boundaries of the cysteine peptidase domain that defines the MEROPS peptidase family C40 (clan C-). A type example being dipeptidyl-peptidase VI from Bacillus sphaericus and gamma-glutamyl-diamino acid-endopeptidase precursor from Lactococcus lactis 3.4.19.11 from EC. This group also contains proteins classified as non-peptidase homologues in that they either have been found experimentally to be without peptidase activity, or lack amino acid residues that are believed to be essential for the catalytic activity of peptidases in the C40 family. ; PDB: 3PVQ_B 3GT2_A 3NPF_B 2K1G_A 3I86_A 3S0Q_A 2XIV_A 3PBC_A 3NE0_A 3M1U_B ....
Probab=29.51  E-value=43  Score=23.18  Aligned_cols=26  Identities=38%  Similarity=0.677  Sum_probs=19.7

Q ss_pred             cccceeecCcceeeec------eEEEEeccCC
Q psy12066        138 PVGRAELRGGDVLWEG------EVVMYLGKGR  163 (164)
Q Consensus       138 ~~~~~~~~~~~~~~~~------~~~~~~~~~~  163 (164)
                      .+-..+++-||+++-.      -|.||+|.++
T Consensus        46 ~~~~~~~~pGDlif~~~~~~~~Hvgiy~g~~~   77 (105)
T PF00877_consen   46 RVPISELQPGDLIFFKGGGGISHVGIYLGDGK   77 (105)
T ss_dssp             HEEGGG-TTTEEEEEEGTGGEEEEEEEEETTE
T ss_pred             ccchhcCCcccEEEEeCCccCCEeEEEEeCCe
Confidence            4667889999988754      5999998875


No 16 
>PF15163 Meiosis_expr:  Meiosis-expressed
Probab=28.38  E-value=37  Score=25.43  Aligned_cols=16  Identities=25%  Similarity=0.576  Sum_probs=12.2

Q ss_pred             CCCChhHHHHHHHHHH
Q psy12066         60 GVWSPDIEQSFQEALA   75 (164)
Q Consensus        60 ~VWs~DIEqAF~EALa   75 (164)
                      -.||++||.||.=-+|
T Consensus         5 K~Ws~evE~~yRfQ~A   20 (77)
T PF15163_consen    5 KKWSEEVENAYRFQQA   20 (77)
T ss_pred             cccCHHHHHHHHHHHc
Confidence            3799999999764444


No 17 
>cd08867 START_STARD4_5_6-like Lipid-binding START domain of mammalian STARD4, -5, -6, and related proteins. This subfamily includes the steroidogenic acute regulatory protein (StAR)-related lipid transfer (START) domains of mammalian STARD4, -5, and -6. The START domain family belongs to the SRPBCC (START/RHO_alpha_C/PITP/Bet_v1/CoxG/CalC) domain superfamily of proteins that bind hydrophobic ligands. SRPBCC domains have a deep hydrophobic ligand-binding pocket. STARD4 plays an important role in steroidogenesis, trafficking cholesterol into mitochondria. It specifically binds cholesterol, and demonstrates limited binding to another sterol, 7a-hydroxycholesterol. STARD4 and STARD5 are ubiquitously expressed, with highest levels in liver and kidney. STRAD5 functions in the kidney within the proximal tubule cells where it is associated with the Endoplasmic Reticulum (ER), and may participate in ER-associated cholesterol transport. It binds cholesterol and 25-hydroxycholesterol. Expression 
Probab=25.84  E-value=1.7e+02  Score=22.83  Aligned_cols=77  Identities=12%  Similarity=-0.034  Sum_probs=44.6

Q ss_pred             HHHHHHHHHHhcCCCCcceeeeCCCC-cccccchhhhhc---cccccCCCcccccchhhhHHHhhhcccccccccccccc
Q psy12066         66 IEQSFQEALAIYPPCGRRKIILSDEG-KMYETVGTFGRK---KNPTKGGKGAVGGIDLMGFLKAQRYEGRELWEELPVGR  141 (164)
Q Consensus        66 IEqAF~EALaIyPp~GRrKIiLSdeG-K~yGRNELIa~Y---I~~~tgGK~R~~~~~l~~~lK~~r~e~~~~W~~l~~~~  141 (164)
                      +++|-+|+|.|.-.....|+..+.+| +.|=|.  .+.|   ++ +--|-.-..-.+++.+|..+..+.+..|+......
T Consensus         7 ~~~~~~~~~~~~~~~~~W~~~~~~~~i~v~~~~--~~~~~~~~~-k~~~~i~~~~~~v~~~l~d~~~~~r~~Wd~~~~~~   83 (206)
T cd08867           7 AEKLANEALQYINDTDGWKVLKTVKNITVSWKP--STEFTGHLY-RAEGIVDALPEKVIDVIIPPCGGLRLKWDKSLKHY   83 (206)
T ss_pred             HHHHHHHHHHHhcCcCCcEEEEcCCCcEEEEec--CCCCCCEEE-EEEEEEcCCHHHHHHHHHhcCccccccccccccce
Confidence            67889999999988777777655433 444331  0111   11 11111111225666777655578889998776655


Q ss_pred             eeec
Q psy12066        142 AELR  145 (164)
Q Consensus       142 ~~~~  145 (164)
                      ..|.
T Consensus        84 ~~le   87 (206)
T cd08867          84 EVLE   87 (206)
T ss_pred             EEEE
Confidence            5444


No 18 
>PF00665 rve:  Integrase core domain;  InterPro: IPR001584 Integrase comprises three domains capable of folding independently and whose three-dimensional structures are known. However, the manner in which the N-terminal, catalytic, and C-terminal domains interact in the holoenzyme remains obscure. Numerous studies indicate that the enzyme functions as a multimer, minimally a dimer. The integrase proteins from Human immunodeficiency virus 1 (HIV-1) and Avian sarcoma virus (ASV) have been studied most carefully with respect to the structural basis of catalysis. Although the active site of ASV integrase does not undergo significant conformational changes on binding the required metal cofactor, that of HIV-1 does. This active site-mediated conformational change in HIV-1 reorganises the catalytic core and C-terminal domains and appears to promote an interaction that is favourable for catalysis [].  Retroviral integrase is synthesised as part of the POL polyprotein that contains; an aspartyl protease, a reverse transcriptase, RNase H and integrase. POL polyprotein undergoes specific enzymatic cleavage to yield the mature proteins. The presence of retrovirus integrase-related gene sequences in eukaryotes is known. Bacterial transposases involved in the transposition of the insertion sequence also belong to this group.  HIV integrase catalyses the incorporation of virally derived DNA into the human genome. This unique step in the virus life cycle provides a variety of points for intervention and hence is an attractive target for the development of new therapeutics for the treatment of AIDS []. Substrate recognition by the retroviral integrase enzyme is critical for retroviral integration. To catalyse this recombination event, integrase must recognise and act on two types of substrates, viral DNA and host DNA, yet the necessary interactions exhibit markedly different degrees of specificity [].; GO: 0015074 DNA integration; PDB: 3AO3_A 3OVN_A 3AO5_A 3AO4_A 3AO1_A 1C6V_D 3HPG_A 3HPH_A 3OYD_A 3OYF_B ....
Probab=24.82  E-value=49  Score=22.24  Aligned_cols=41  Identities=12%  Similarity=0.174  Sum_probs=28.3

Q ss_pred             ChhHHHHHHHHHHhcCCCCcceeeeCCCCcccccchhhhhccc
Q psy12066         63 SPDIEQSFQEALAIYPPCGRRKIILSDEGKMYETVGTFGRKKN  105 (164)
Q Consensus        63 s~DIEqAF~EALaIyPp~GRrKIiLSdeGK~yGRNELIa~YI~  105 (164)
                      ..++-++|.+++..+..+. -+++.||.|+.|-.+ .+..+..
T Consensus        49 ~~~~~~~l~~~~~~~~~~~-p~~i~tD~g~~f~~~-~~~~~~~   89 (120)
T PF00665_consen   49 AEAALRALKRAIEKRGGRP-PRVIRTDNGSEFTSH-AFEAWCK   89 (120)
T ss_dssp             HHHHHHHHHHHHHHHS-SE--SEEEEESCHHHHSH-HHHHHHH
T ss_pred             ccccccccccccccccccc-ceecccccccccccc-hhhhHHH
Confidence            3678888888888887766 567789999988544 4444444


No 19 
>PRK10424 ilvG operon leader peptide; Provisional
Probab=23.26  E-value=26  Score=22.48  Aligned_cols=7  Identities=71%  Similarity=1.701  Sum_probs=5.5

Q ss_pred             HhcCCCC
Q psy12066         75 AIYPPCG   81 (164)
Q Consensus        75 aIyPp~G   81 (164)
                      -|+||||
T Consensus        18 iiippcg   24 (32)
T PRK10424         18 IIIPPCG   24 (32)
T ss_pred             EEecCch
Confidence            3789996


No 20 
>PF07533 BRK:  BRK domain;  InterPro: IPR006576 BRK is a domain of unknown function found only in the metazoa and in association with CHROMO domain (IPR000953 from INTERPRO) and DEAD/DEAH box helicase domain (IPR011545 from INTERPRO).; GO: 0005515 protein binding, 0016817 hydrolase activity, acting on acid anhydrides; PDB: 2DL6_A 2CKA_A 2V0F_A 2V0E_A 2CKC_A.
Probab=23.23  E-value=40  Score=22.26  Aligned_cols=28  Identities=32%  Similarity=0.548  Sum_probs=19.2

Q ss_pred             ccCCCccccc-----chhhhHHHhh-hccccccc
Q psy12066        107 TKGGKGAVGG-----IDLMGFLKAQ-RYEGRELW  134 (164)
Q Consensus       107 ~tgGK~R~~~-----~~l~~~lK~~-r~e~~~~W  134 (164)
                      +++||.-++.     .+|.++|+.+ .|+-.|.|
T Consensus        13 ~~tGk~l~G~~AP~~~~L~~WL~~~P~y~V~P~w   46 (46)
T PF07533_consen   13 RKTGKRLTGDEAPKLKELEEWLEEHPGYEVAPRW   46 (46)
T ss_dssp             TTTTEEE-CCCS-BCCCHHHHHHH-TTEEESHHH
T ss_pred             CCCCCCcccccCcCHHHHHHHHHHCcCceeCCCC
Confidence            5677777654     8999999977 66666655


No 21 
>PF11330 DUF3132:  Protein of unknown function (DUF3132);  InterPro: IPR021479 This entry is represented by the Citrus psorosis virus, 54kDa protein; it is a family of uncharacterised viral proteins.
Probab=22.79  E-value=62  Score=25.65  Aligned_cols=17  Identities=65%  Similarity=0.872  Sum_probs=13.8

Q ss_pred             ecCcceeee--ceEEEEec
Q psy12066        144 LRGGDVLWE--GEVVMYLG  160 (164)
Q Consensus       144 ~~~~~~~~~--~~~~~~~~  160 (164)
                      -.|.|||-|  |||||.|.
T Consensus        76 tagddvllekdgevvmild   94 (124)
T PF11330_consen   76 TAGDDVLLEKDGEVVMILD   94 (124)
T ss_pred             ccCCeEEEecCCcEEEEEe
Confidence            457889875  99999985


No 22 
>PF08302 tRNA_lig_CPD:  Fungal tRNA ligase phosphodiesterase domain;  InterPro: IPR015965 This entry represents a phosphodiesterase domain found in fungal tRNA ligases []. Please see the following relevant references: [, ].; GO: 0003972 RNA ligase (ATP) activity, 0005524 ATP binding, 0006388 tRNA splicing, via endonucleolytic cleavage and ligation
Probab=21.30  E-value=62  Score=27.42  Aligned_cols=16  Identities=38%  Similarity=0.708  Sum_probs=13.3

Q ss_pred             ChhHHHHHHHHHH-hcC
Q psy12066         63 SPDIEQSFQEALA-IYP   78 (164)
Q Consensus        63 s~DIEqAF~EALa-IyP   78 (164)
                      +++|++||+.||. --|
T Consensus        27 ~e~id~A~~~Al~~Ykp   43 (257)
T PF08302_consen   27 DEEIDEAFQKALNEYKP   43 (257)
T ss_pred             HHHHHHHHHHHHhhCCC
Confidence            3789999999999 444


No 23 
>PRK01388 arginine deiminase; Provisional
Probab=21.00  E-value=94  Score=28.10  Aligned_cols=32  Identities=38%  Similarity=0.676  Sum_probs=22.9

Q ss_pred             cccccccccccceeecCcceeeeceEEEEeccC
Q psy12066        130 GRELWEELPVGRAELRGGDVLWEGEVVMYLGKG  162 (164)
Q Consensus       130 ~~~~W~~l~~~~~~~~~~~~~~~~~~~~~~~~~  162 (164)
                      +-+.|.+.. +.+-+.||||+|-|.-+.++|-+
T Consensus       201 ~~~i~~~~~-~~~~iEGGDvl~l~~~~l~IG~s  232 (406)
T PRK01388        201 DVPVWDDRH-GNATLEGGDVLVLGKGVVAIGMS  232 (406)
T ss_pred             CceEEecCC-CCCCCccceEEEECCCEEEEEec
Confidence            457775433 66779999999999766666644


No 24 
>PF00778 DIX:  DIX domain;  InterPro: IPR001158 Dishevelled (Dsh) protein is an important component of the Wnt signal-transduction pathway. It has three relatively conserved domains: DIX, PDZ and DEP. The DIX domain of Dvl-1 (a mammalian Dishevelled homologue) shares 37% identity with the C-terminal region of Axin. Dsh can interact with the Axin/APC/GSK3/beta-catenin complex, and may thus modulate its activity []. The Wnt signalling pathway is conserved in various species from Caenorhabditis elegans to mammals, and plays important roles in development, cellular proliferation, and differentiation. The molecular mechanisms by which the Wnt signal regulates cellular functions are becoming increasingly well understood. Wnt stabilises cytoplasmic beta-catenin, which stimulates the expression of genes including c-myc, c-jun, fra-1, and cyclin D1. Axin and its homologue Axil are components of the Wnt signalling pathway that negatively regulate this pathway. Other components of the Wnt signalling pathway, including Dvl, glycogen synthase kinase-3beta (GSK-3beta), beta-catenin, and adenomatous polyposis coli (APC), interact with Axin, and the phosphorylation and stability of beta-catenin are regulated in the Axin complex. Axil has similar functions to Axin. Thus, Axin and Axil act as scaffold proteins in the Wnt signalling pathway, thereby modulating the Wnt-dependent cellular functions [].; GO: 0004871 signal transducer activity, 0007275 multicellular organismal development, 0005622 intracellular; PDB: 1WSP_B 2D5G_A 3PZ7_A 3PZ8_H.
Probab=20.95  E-value=35  Score=25.01  Aligned_cols=34  Identities=26%  Similarity=0.314  Sum_probs=22.6

Q ss_pred             HHHhhhcccc-cccccccccceeecCcceeeeceEEEEe
Q psy12066        122 FLKAQRYEGR-ELWEELPVGRAELRGGDVLWEGEVVMYL  159 (164)
Q Consensus       122 ~lK~~r~e~~-~~W~~l~~~~~~~~~~~~~~~~~~~~~~  159 (164)
                      |.|....|+. .-|+++.--.+-|    .+|||.||+.+
T Consensus        46 fFK~~~~d~~~~V~eEi~dD~~~L----P~~eGkI~~~v   80 (84)
T PF00778_consen   46 FFKSLDPDFGCVVKEEITDDDDIL----PLFEGKIVAKV   80 (84)
T ss_dssp             EEEEEETTTETEEEEEE-STTSB-------BTTEEEEEE
T ss_pred             EEEEeCCCCCeeeEEEEcCCcccc----cccCCEEEEEE
Confidence            3455555655 7899988887777    68999999876


No 25 
>smart00678 WWE Domain in Deltex and TRIP12 homologues. Possibly involved in regulation of ubiquitin-mediated proteolysis.
Probab=20.52  E-value=61  Score=21.55  Aligned_cols=10  Identities=40%  Similarity=0.723  Sum_probs=7.2

Q ss_pred             ChhHHHHHHH
Q psy12066         63 SPDIEQSFQE   72 (164)
Q Consensus        63 s~DIEqAF~E   72 (164)
                      +.+||+||++
T Consensus        20 ~~~IE~ay~~   29 (73)
T smart00678       20 SEDIEEAYAA   29 (73)
T ss_pred             HHHHHHHHHc
Confidence            4677888875


No 26 
>PF13230 GATase_4:  Glutamine amidotransferases class-II; PDB: 3MDN_D.
Probab=20.24  E-value=42  Score=28.24  Aligned_cols=28  Identities=29%  Similarity=0.541  Sum_probs=7.6

Q ss_pred             hccccccccccccccee-ecCcceeeece
Q psy12066        127 RYEGRELWEELPVGRAE-LRGGDVLWEGE  154 (164)
Q Consensus       127 r~e~~~~W~~l~~~~~~-~~~~~~~~~~~  154 (164)
                      .+..++.|++++.|..- ++.|.|++.+.
T Consensus       230 PLt~~e~W~~vp~g~~l~~~~G~v~~~~~  258 (271)
T PF13230_consen  230 PLTDDEDWEPVPPGSLLVFRDGEVVARSK  258 (271)
T ss_dssp             ----SS--EE--SSEEEE-----------
T ss_pred             cCCCCCCeEEcCCCcEEEEeccccccccc
Confidence            45567789999999876 78899988764


Done!