Diaphorina citri psyllid: psy12066


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160----
MNYFPGFGLVTGTISSPWTPGSAAVPPGADTNGSGGDSKHALDVGDLDDDKDLAAADAEGVWSPDIEQSFQEALAIYPPCGRRKIILSDEGKMYETVGTFGRKKNPTKGGKGAVGGIDLMGFLKAQRYEGRELWEELPVGRAELRGGDVLWEGEVVMYLGKGRW
ccccccccccccccccccccccccccccccccccccccccccccccccccHHcccccccccccHHHHHHHHHHHHHccccccccEEEccccccHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHccccc
*****GFGLVTGT************************************************WSPDIEQSFQEALAIYPPCGRRKIILSDEGKMYETVGTFGR*******GKGAVGGIDLMGFLKAQRYEGRELWEELPVGRAELRGGDVLWEGEVVMYLG*G**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNYFPGFGLVTGTISSPWTPGSAAVPPGADTNGSGGDSKHALDVGDLDDDKDLAAADAEGVWSPDIEQSFQEALAIYPPCGRRKIILSDEGKMYETVGTFGRKKNPTKGGKGAVGGIDLMGFLKAQRYEGRELWEELPVGRAELRGGDVLWEGEVVMYLGKGRW

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Protein scalloped Transcription factor which plays a key role in the Hippo/SWH (Sav/Wts/Hpo) signaling pathway, a signaling pathway that plays a pivotal role in organ size control and tumor suppression by restricting proliferation and promoting apoptosis. The core of this pathway is composed of a kinase cascade wherein Hippo (Hpo), in complex with its regulatory protein Salvador (Sav), phosphorylates and activates Warts (Wts) in complex with its regulatory protein Mats, which in turn phosphorylates and inactivates the Yorkie (Yki) oncoprotein. The Hippo/SWH signaling pathway inhibits the activity of the transcriptional complex formed by Scalloped (sd) and Yki and the target genes of this pathway include cyclin-E (cycE), diap1 and bantam. Sd promotes nuclear localization of Yki. Involved in the regulation of cell-specific gene expression during development, particularly in the differentiation of the nervous system. When in combination with vestigial (vg) it acts as a transcriptional activation complex that regulates gene expression in the wing. Binding to vg switches the DNA target selectivity of sd. Required autonomously for cell proliferation and viability within the wing blade. Required for proper sensory organ precursor (SOP) differentiation at the wing margin; required for correct expression of sens.confidentP30052
Transcriptional enhancer factor TEF-5 Transcription factor which plays a key role in the Hippo signaling pathway, a pathway involved in organ size control and tumor suppression by restricting proliferation and promoting apoptosis. The core of this pathway is composed of a kinase cascade wherein MST1/MST2, in complex with its regulatory protein SAV1, phosphorylates and activates LATS1/2 in complex with its regulatory protein MOB1, which in turn phosphorylates and inactivates YAP1 oncoprotein and WWTR1/TAZ. Acts by mediating gene expression of YAP1 and WWTR1/TAZ, thereby regulating cell proliferation, migration and epithelial mesenchymal transition (EMT) induction. Binds to multiple functional elements of the human chorionic somatomammotropin-B gene enhancer.confidentQ99594

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0035329 [BP]hippo signaling cascadeprobableGO:0044700, GO:0051716, GO:0050896, GO:0009987, GO:0050794, GO:0008150, GO:0065007, GO:0044763, GO:0007165, GO:0023052, GO:0007154, GO:0035556, GO:0050789, GO:0044699
GO:0042127 [BP]regulation of cell proliferationprobableGO:0008150, GO:0065007, GO:0050789, GO:0050794
GO:0005667 [CC]transcription factor complexprobableGO:0043234, GO:0044446, GO:0032991, GO:0005575, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0005623, GO:0005622, GO:0005654, GO:0070013, GO:0043229, GO:0044428, GO:0031974, GO:0044424, GO:0044451, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0072089 [BP]stem cell proliferationprobableGO:0008150, GO:0044699, GO:0008283
GO:0001708 [BP]cell fate specificationprobableGO:0032502, GO:0045165, GO:0048869, GO:0030154, GO:0044763, GO:0008150, GO:0009987, GO:0044699
GO:0048368 [BP]lateral mesoderm developmentprobableGO:0007498, GO:0032502, GO:0048856, GO:0008150, GO:0009888
GO:0048339 [BP]paraxial mesoderm developmentprobableGO:0007498, GO:0032502, GO:0048856, GO:0008150, GO:0009888
GO:0007566 [BP]embryo implantationprobableGO:0032502, GO:0044703, GO:0044702, GO:0000003, GO:0044707, GO:0044706, GO:0007565, GO:0022414, GO:0032501, GO:0008150, GO:0007275, GO:0044699, GO:0051704
GO:0045944 [BP]positive regulation of transcription from RNA polymerase II promoterprobableGO:0009893, GO:0019222, GO:0031328, GO:0031326, GO:0031325, GO:2001141, GO:0031323, GO:0010628, GO:0050789, GO:0080090, GO:0010604, GO:0051171, GO:0009891, GO:2000112, GO:0019219, GO:0010556, GO:0065007, GO:0048518, GO:0010468, GO:0045935, GO:0060255, GO:0009889, GO:0050794, GO:0008150, GO:0045893, GO:0051173, GO:0051252, GO:0051254, GO:0006355, GO:0010557, GO:0006357, GO:0048522
GO:0005515 [MF]protein bindingprobableGO:0003674, GO:0005488
GO:0000980 [MF]RNA polymerase II distal enhancer sequence-specific DNA bindingprobableGO:0005488, GO:0044212, GO:0043565, GO:0001067, GO:0003677, GO:0001012, GO:0001158, GO:0000976, GO:0000977, GO:0003676, GO:0000975, GO:0003674, GO:0097159, GO:1901363, GO:0035326
GO:0003143 [BP]embryonic heart tube morphogenesisprobableGO:0032502, GO:0009790, GO:0072359, GO:0072358, GO:0009653, GO:0007275, GO:0044699, GO:0002009, GO:0048513, GO:0048729, GO:0060562, GO:0048598, GO:0009887, GO:0032501, GO:0035239, GO:0060429, GO:0035050, GO:0009888, GO:0003007, GO:0008150, GO:0035295, GO:0007507, GO:0044707, GO:0048856, GO:0044767, GO:0048731
GO:0001830 [BP]trophectodermal cell fate commitmentprobableGO:0030154, GO:0009790, GO:0009792, GO:0009653, GO:0007275, GO:0044699, GO:0001701, GO:0001829, GO:0048869, GO:0001825, GO:0001824, GO:0043009, GO:0048646, GO:0032502, GO:0032501, GO:0009987, GO:0044767, GO:0044763, GO:0045165, GO:0044707, GO:0048856, GO:0008150
GO:0003705 [MF]RNA polymerase II distal enhancer sequence-specific DNA binding transcription factor activityprobableGO:0003700, GO:0003674, GO:0001071, GO:0000981
GO:0030903 [BP]notochord developmentprobableGO:0032502, GO:0032501, GO:0044707, GO:0048568, GO:0048856, GO:0044767, GO:0009790, GO:0048513, GO:0008150, GO:0048731, GO:0007275, GO:0044699

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2HZD, chain A
Confidence level:very confident
Coverage over the Query: 55-126
View the alignment between query and template
View the model in PyMOL