RPS-BLAST 2.2.26 [Sep-21-2011]

Database: CDD.v3.10 
           44,354 sequences; 10,937,602 total letters

Searching..................................................done

Query= psy12096
         (173 letters)



>gnl|CDD|176031 cd08385, C2A_Synaptotagmin-1-5-6-9-10, C2A domain first repeat
           present in Synaptotagmins 1, 5, 6, 9, and 10.
           Synaptotagmin is a membrane-trafficking protein
           characterized by a N-terminal transmembrane region, a
           linker, and 2 C-terminal C2 domains. Synaptotagmin 1, a
           member of class 1 synaptotagmins, is located in the
           brain and endocranium and localized to the synaptic
           vesicles and secretory granules.  It functions as a Ca2+
           sensor for fast exocytosis as do synaptotagmins 5, 6,
           and 10. It is distinguished from the other
           synaptotagmins by having an N-glycosylated N-terminus.
           Synaptotagmins 5, 6, and 10, members of class 3
           synaptotagmins, are located primarily in the brain and
           localized to the active zone and plasma membrane.  They
           is distinguished from the other synaptotagmins by having
           disulfide bonds at its N-terminus.  Synaptotagmin 6 also
           regulates the acrosome reaction, a unique Ca2+-regulated
           exocytosis, in sperm. Synaptotagmin 9, a class 5
           synaptotagmins, is located in the brain and localized to
           the synaptic vesicles.  It is thought to be a
           Ca2+-sensor for dense-core vesicle exocytosis.
           Previously all synaptotagmins were thought to be calcium
           sensors in the regulation of neurotransmitter release
           and hormone secretion, but it has been shown that not
           all of them bind calcium.  Of the 17 identified
           synaptotagmins only 8 bind calcium (1-3, 5-7, 9, 10).
           The function of the two C2 domains that bind calcium
           are: regulating the fusion step of synaptic vesicle
           exocytosis (C2A) and  binding to
           phosphatidyl-inositol-3,4,5-triphosphate (PIP3) in the
           absence of calcium ions and to phosphatidylinositol
           bisphosphate (PIP2) in their presence (C2B).  C2B also
           regulates also the recycling step of synaptic vesicles. 
           C2 domains fold into an 8-standed beta-sandwich that can
           adopt 2 structural arrangements: Type I and Type II,
           distinguished by a circular permutation involving their
           N- and C-terminal beta strands. Many C2 domains are
           Ca2+-dependent membrane-targeting modules that bind a
           wide variety of substances including bind phospholipids,
           inositol polyphosphates, and intracellular proteins.
           Most C2 domain proteins are either signal transduction
           enzymes that contain a single C2 domain, such as protein
           kinase C, or membrane trafficking proteins which contain
           at least two C2 domains, such as synaptotagmin 1.
           However, there are a few exceptions to this including
           RIM isoforms and some splice variants of piccolo/aczonin
           and intersectin which only have a single C2 domain.  C2
           domains with a calcium binding region have negatively
           charged residues, primarily aspartates, that serve as
           ligands for calcium ions. This cd contains the first C2
           repeat, C2A, and has a type-I topology.
          Length = 124

 Score = 93.1 bits (232), Expect = 5e-25
 Identities = 32/51 (62%), Positives = 41/51 (80%)

Query: 112 VPYADAMNKTLVFAIFDFDRFSKHDQIGEVKVALCQIDLAQTIEEWRELQS 162
           VPY++  NKTLVF+++DFDRFSKHD IGEV+V L  +DL    EEWR+L+S
Sbjct: 74  VPYSELGNKTLVFSVYDFDRFSKHDLIGEVRVPLLTVDLGHVTEEWRDLES 124


>gnl|CDD|176032 cd08386, C2A_Synaptotagmin-7, C2A domain first repeat present in
           Synaptotagmin 7.  Synaptotagmin is a
           membrane-trafficking protein characterized by a
           N-terminal transmembrane region, a linker, and 2
           C-terminal C2 domains. Synaptotagmin 7, a member of
           class 2 synaptotagmins, is located in presynaptic plasma
           membranes in neurons, dense-core vesicles in endocrine
           cells, and lysosomes in fibroblasts.  It has been shown
           to play a role in regulation of Ca2+-dependent lysosomal
           exocytosis in fibroblasts and may also function as a
           vesicular Ca2+-sensor.  It is distinguished from the
           other synaptotagmins by having over 12 splice forms.
           Previously all synaptotagmins were thought to be calcium
           sensors in the regulation of neurotransmitter release
           and hormone secretion, but it has been shown that not
           all of them bind calcium.  Of the 17 identified
           synaptotagmins only 8 bind calcium (1-3, 5-7, 9, 10).
           The function of the two C2 domains that bind calcium
           are: regulating the fusion step of synaptic vesicle
           exocytosis (C2A) and  binding to
           phosphatidyl-inositol-3,4,5-triphosphate (PIP3) in the
           absence of calcium ions and to phosphatidylinositol
           bisphosphate (PIP2) in their presence (C2B).  C2B also
           regulates also the recycling step of synaptic vesicles.
           C2 domains fold into an 8-standed beta-sandwich that can
           adopt 2 structural arrangements: Type I and Type II,
           distinguished by a circular permutation involving their
           N- and C-terminal beta strands. Many C2 domains are
           Ca2+-dependent membrane-targeting modules that bind a
           wide variety of substances including bind phospholipids,
           inositol polyphosphates, and intracellular proteins.
           Most C2 domain proteins are either signal transduction
           enzymes that contain a single C2 domain, such as protein
           kinase C, or membrane trafficking proteins which contain
           at least two C2 domains, such as synaptotagmin 1.
           However, there are a few exceptions to this including
           RIM isoforms and some splice variants of piccolo/aczonin
           and intersectin which only have a single C2 domain.  C2
           domains with a calcium binding region have negatively
           charged residues, primarily aspartates, that serve as
           ligands for calcium ions. This cd contains the first C2
           repeat, C2A, and has a type-I topology.
          Length = 125

 Score = 63.1 bits (154), Expect = 2e-13
 Identities = 20/52 (38%), Positives = 32/52 (61%)

Query: 110 EGVPYADAMNKTLVFAIFDFDRFSKHDQIGEVKVALCQIDLAQTIEEWRELQ 161
           EG PY     + L   + D+DRFS++D IGEV + L ++DL +    W++L+
Sbjct: 73  EGFPYEKLQQRVLYLQVLDYDRFSRNDPIGEVSLPLNKVDLTEEQTFWKDLK 124


>gnl|CDD|176036 cd08390, C2A_Synaptotagmin-15-17, C2A domain first repeat present
           in Synaptotagmins 15 and 17.  Synaptotagmin is a
           membrane-trafficking protein characterized by a
           N-terminal transmembrane region, a linker, and 2
           C-terminal C2 domains. It is thought to be involved in
           the trafficking and exocytosis of secretory vesicles in
           non-neuronal tissues and is Ca2+ independent. Human
           synaptotagmin 15 has 2 alternatively spliced forms that
           encode proteins with different C-termini.  The larger,
           SYT15a, contains a N-terminal TM region, a putative
           fatty-acylation site, and 2 tandem C terminal C2
           domains.  The smaller, SYT15b, lacks the C-terminal
           portion of the second C2 domain.  Unlike most other
           synaptotagmins it is nearly absent in the brain and
           rather is found in the heart, lungs, skeletal muscle,
           and testis. Synaptotagmin 17 is located in the brain,
           kidney, and prostate and is thought to be a peripheral
           membrane protein. Previously all synaptotagmins were
           thought to be calcium sensors in the regulation of
           neurotransmitter release and hormone secretion, but it
           has been shown that not all of them bind calcium.  Of
           the 17 identified synaptotagmins only 8 bind calcium
           (1-3, 5-7, 9, 10).  The function of the two C2 domains
           that bind calcium are: regulating the fusion step of
           synaptic vesicle exocytosis (C2A) and  binding to
           phosphatidyl-inositol-3,4,5-triphosphate (PIP3) in the
           absence of calcium ions and to phosphatidylinositol
           bisphosphate (PIP2) in their presence (C2B).  C2B also
           regulates also the recycling step of synaptic vesicles. 
           C2 domains fold into an 8-standed beta-sandwich that can
           adopt 2 structural arrangements: Type I and Type II,
           distinguished by a circular permutation involving their
           N- and C-terminal beta strands. Many C2 domains are
           Ca2+-dependent membrane-targeting modules that bind a
           wide variety of substances including bind phospholipids,
           inositol polyphosphates, and intracellular proteins.
           Most C2 domain proteins are either signal transduction
           enzymes that contain a single C2 domain, such as protein
           kinase C, or membrane trafficking proteins which contain
           at least two C2 domains, such as synaptotagmin 1.
           However, there are a few exceptions to this including
           RIM isoforms and some splice variants of piccolo/aczonin
           and intersectin which only have a single C2 domain.  C2
           domains with a calcium binding region have negatively
           charged residues, primarily aspartates, that serve as
           ligands for calcium ions. This cd contains the first C2
           repeat, C2A, and has a type-I topology.
          Length = 123

 Score = 49.6 bits (119), Expect = 2e-08
 Identities = 18/50 (36%), Positives = 29/50 (58%)

Query: 112 VPYADAMNKTLVFAIFDFDRFSKHDQIGEVKVALCQIDLAQTIEEWRELQ 161
           V + +   +TL  +++D DRFS+H  IG V   L  +DL +    WR+L+
Sbjct: 73  VSFKELQRRTLRLSVYDVDRFSRHCIIGHVLFPLKDLDLVKGGVVWRDLE 122


>gnl|CDD|176033 cd08387, C2A_Synaptotagmin-8, C2A domain first repeat present in
           Synaptotagmin 8.  Synaptotagmin is a
           membrane-trafficking protein characterized by a
           N-terminal transmembrane region, a linker, and 2
           C-terminal C2 domains. Previously all synaptotagmins
           were thought to be calcium sensors in the regulation of
           neurotransmitter release and hormone secretion, but it
           has been shown that not all of them bind calcium.  Of
           the 17 identified synaptotagmins only 8 bind calcium
           (1-3, 5-7, 9, 10).  The function of the two C2 domains
           that bind calcium are: regulating the fusion step of
           synaptic vesicle exocytosis (C2A) and  binding to
           phosphatidyl-inositol-3,4,5-triphosphate (PIP3) in the
           absence of calcium ions and to phosphatidylinositol
           bisphosphate (PIP2) in their presence (C2B).  C2B also
           regulates also the recycling step of synaptic vesicles. 
           C2 domains fold into an 8-standed beta-sandwich that can
           adopt 2 structural arrangements: Type I and Type II,
           distinguished by a circular permutation involving their
           N- and C-terminal beta strands. Many C2 domains are
           Ca2+-dependent membrane-targeting modules that bind a
           wide variety of substances including bind phospholipids,
           inositol polyphosphates, and intracellular proteins.
           Most C2 domain proteins are either signal transduction
           enzymes that contain a single C2 domain, such as protein
           kinase C, or membrane trafficking proteins which contain
           at least two C2 domains, such as synaptotagmin 1.
           However, there are a few exceptions to this including
           RIM isoforms and some splice variants of piccolo/aczonin
           and intersectin which only have a single C2 domain.  C2
           domains with a calcium binding region have negatively
           charged residues, primarily aspartates, that serve as
           ligands for calcium ions. This cd contains the first C2
           repeat, C2A, and has a type-I topology.
          Length = 124

 Score = 48.6 bits (116), Expect = 5e-08
 Identities = 19/52 (36%), Positives = 36/52 (69%)

Query: 111 GVPYADAMNKTLVFAIFDFDRFSKHDQIGEVKVALCQIDLAQTIEEWRELQS 162
            VP  +   +TL   ++DFD+FS+ + IG V++ L ++DL++ ++ WR++QS
Sbjct: 73  EVPPQELPKRTLEVLLYDFDQFSRDECIGVVELPLAEVDLSEKLDLWRKIQS 124


>gnl|CDD|176034 cd08388, C2A_Synaptotagmin-4-11, C2A domain first repeat present in
           Synaptotagmins 4 and 11.  Synaptotagmin is a
           membrane-trafficking protein characterized by a
           N-terminal transmembrane region, a linker, and 2
           C-terminal C2 domains.  Synaptotagmins 4 and 11, class 4
           synaptotagmins, are located in the brain.  Their
           functions are unknown. They are distinguished from the
           other synaptotagmins by having and Asp to Ser
           substitution in their C2A domains. Previously all
           synaptotagmins were thought to be calcium sensors in the
           regulation of neurotransmitter release and hormone
           secretion, but it has been shown that not all of them
           bind calcium.  Of the 17 identified synaptotagmins only
           8 bind calcium (1-3, 5-7, 9, 10).  The function of the
           two C2 domains that bind calcium are: regulating the
           fusion step of synaptic vesicle exocytosis (C2A) and
           binding to phosphatidyl-inositol-3,4,5-triphosphate
           (PIP3) in the absence of calcium ions and to
           phosphatidylinositol bisphosphate (PIP2) in their
           presence (C2B).  C2B also regulates also the recycling
           step of synaptic vesicles.  C2 domains fold into an
           8-standed beta-sandwich that can adopt 2 structural
           arrangements: Type I and Type II, distinguished by a
           circular permutation involving their N- and C-terminal
           beta strands. Many C2 domains are Ca2+-dependent
           membrane-targeting modules that bind a wide variety of
           substances including bind phospholipids, inositol
           polyphosphates, and intracellular proteins.  Most C2
           domain proteins are either signal transduction enzymes
           that contain a single C2 domain, such as protein kinase
           C, or membrane trafficking proteins which contain at
           least two C2 domains, such as synaptotagmin 1.  However,
           there are a few exceptions to this including RIM
           isoforms and some splice variants of piccolo/aczonin and
           intersectin which only have a single C2 domain.  C2
           domains with a calcium binding region have negatively
           charged residues, primarily aspartates, that serve as
           ligands for calcium ions. This cd contains the first C2
           repeat, C2A, and has a type-I topology.
          Length = 128

 Score = 44.6 bits (106), Expect = 2e-06
 Identities = 21/54 (38%), Positives = 29/54 (53%), Gaps = 2/54 (3%)

Query: 111 GVPYADAMNKTLVFAIFDFDRFSKHDQIGEVKVALCQIDLAQ--TIEEWRELQS 162
           G+PY    + +L FA+  FDR+S+ D IGEV   L   DL     +   RE+Q 
Sbjct: 75  GIPYNQLQDLSLHFAVLSFDRYSRDDVIGEVVCPLAGADLLNEGELLVSREIQP 128


>gnl|CDD|175973 cd00030, C2, C2 domain.  The C2 domain was first identified in PKC.
           C2 domains fold into an 8-standed beta-sandwich that can
           adopt 2 structural arrangements: Type I and Type II,
           distinguished by a circular permutation involving their
           N- and C-terminal beta strands. Many C2 domains are
           Ca2+-dependent membrane-targeting modules that bind a
           wide variety of substances including bind phospholipids,
           inositol polyphosphates, and intracellular proteins.
           Most C2 domain proteins are either signal transduction
           enzymes that contain a single C2 domain, such as protein
           kinase C, or membrane trafficking proteins which contain
           at least two C2 domains, such as synaptotagmin 1.
           However, there are a few exceptions to this including
           RIM isoforms and some splice variants of piccolo/aczonin
           and intersectin which only have a single C2 domain.  C2
           domains with a calcium binding region have negatively
           charged residues, primarily aspartates, that serve as
           ligands for calcium ions.
          Length = 102

 Score = 39.7 bits (93), Expect = 7e-05
 Identities = 19/49 (38%), Positives = 28/49 (57%), Gaps = 1/49 (2%)

Query: 113 PYADAMNKTLVFAIFDFDRFSKHDQIGEVKVALCQI-DLAQTIEEWREL 160
           P  D  + TL   ++D DRFSK D +GEV++ L ++ D  +  E W  L
Sbjct: 54  PVLDPESDTLTVEVWDKDRFSKDDFLGEVEIPLSELLDSGKEGELWLPL 102


>gnl|CDD|214577 smart00239, C2, Protein kinase C conserved region 2 (CalB).
           Ca2+-binding motif present in phospholipases, protein
           kinases C, and synaptotagmins (among others). Some do
           not appear to contain Ca2+-binding sites. Particular C2s
           appear to bind phospholipids, inositol polyphosphates,
           and intracellular proteins. Unusual occurrence in
           perforin. Synaptotagmin and PLC C2s are permuted in
           sequence with respect to N- and C-terminal beta strands.
           SMART detects C2 domains using one or both of two
           profiles.
          Length = 101

 Score = 37.1 bits (86), Expect = 6e-04
 Identities = 12/46 (26%), Positives = 19/46 (41%)

Query: 112 VPYADAMNKTLVFAIFDFDRFSKHDQIGEVKVALCQIDLAQTIEEW 157
                     L   ++D DRF + D IG+V + L  + L    E+ 
Sbjct: 56  FEVPPPELAELEIEVYDKDRFGRDDFIGQVTIPLSDLLLGGRHEKL 101


>gnl|CDD|175995 cd04029, C2A_SLP-4_5, C2 domain first repeat present in
           Synaptotagmin-like proteins 4 and 5.  All Slp members
           basically share an N-terminal Slp homology domain (SHD)
           and C-terminal tandem C2 domains (named the C2A domain
           and the C2B domain) with the SHD and C2 domains being
           separated by a linker sequence of various length. SHD of
           Slp (except for the Slp4-SHD) function as a specific
           Rab27A/B-binding domain.  In addition to Slp, rabphilin,
           Noc2, and  Munc13-4 also function as Rab27-binding
           proteins. It has been demonstrated that Slp4/granuphilin
           promotes dense-core vesicle exocytosis. The C2A domain
           of Slp4 is Ca2+ dependent. Slp5 mRNA has been shown to
           be restricted to human placenta and liver suggesting a
           role in Rab27A-dependent membrane trafficking in
           specific tissues. C2 domains fold into an 8-standed
           beta-sandwich that can adopt 2 structural arrangements:
           Type I and Type II, distinguished by a circular
           permutation involving their N- and C-terminal beta
           strands. Many C2 domains are Ca2+-dependent
           membrane-targeting modules that bind a wide variety of
           substances including bind phospholipids, inositol
           polyphosphates, and intracellular proteins.  Most C2
           domain proteins are either signal transduction enzymes
           that contain a single C2 domain, such as protein kinase
           C, or membrane trafficking proteins which contain at
           least two C2 domains, such as synaptotagmin 1.  However,
           there are a few exceptions to this including RIM
           isoforms and some splice variants of piccolo/aczonin and
           intersectin which only have a single C2 domain.  C2
           domains with a calcium binding region have negatively
           charged residues, primarily aspartates, that serve as
           ligands for calcium ions.  This cd contains the first C2
           repeat, C2A, and has a type-I topology.
          Length = 125

 Score = 36.6 bits (85), Expect = 0.001
 Identities = 12/50 (24%), Positives = 26/50 (52%)

Query: 112 VPYADAMNKTLVFAIFDFDRFSKHDQIGEVKVALCQIDLAQTIEEWRELQ 161
           + ++    +TL  +++ +DRF ++  +GEV++ L   +     EE   L 
Sbjct: 76  ISHSQLETRTLQLSVWHYDRFGRNTFLGEVEIPLDSWNFDSQHEECLPLH 125


>gnl|CDD|176000 cd04035, C2A_Rabphilin_Doc2, C2 domain first repeat present in
           Rabphilin and Double C2 domain.  Rabphilin is found
           neurons and in neuroendrocrine cells, while Doc2 is
           found not only in the brain but in tissues, including
           mast cells, chromaffin cells, and osteoblasts.
           Rabphilin and Doc2s share highly homologous tandem C2
           domains, although their N-terminal structures are
           completely different: rabphilin contains an N-terminal
           Rab-binding domain (RBD),7 whereas Doc2 contains an
           N-terminal Munc13-1-interacting domain (MID). C2 domains
           fold into an 8-standed beta-sandwich that can adopt 2
           structural arrangements: Type I and Type II,
           distinguished by a circular permutation involving their
           N- and C-terminal beta strands. Many C2 domains are
           Ca2+-dependent membrane-targeting modules that bind a
           wide variety of substances including bind phospholipids,
           inositol polyphosphates, and intracellular proteins.
           Most C2 domain proteins are either signal transduction
           enzymes that contain a single C2 domain, such as protein
           kinase C, or membrane trafficking proteins which contain
           at least two C2 domains, such as synaptotagmin 1.
           However, there are a few exceptions to this including
           RIM isoforms and some splice variants of piccolo/aczonin
           and intersectin which only have a single C2 domain.  C2
           domains with a calcium binding region have negatively
           charged residues, primarily aspartates, that serve as
           ligands for calcium ions. This cd contains the first C2
           repeat, C2A, and has a type-I topology.
          Length = 123

 Score = 35.0 bits (81), Expect = 0.005
 Identities = 17/52 (32%), Positives = 25/52 (48%), Gaps = 1/52 (1%)

Query: 102 IFIERQILEGVPYADAMNKTLVFAIFDFDRFSKHDQIGEVKVALCQIDLAQT 153
            F E     G+   D   KTL   + D DRF  +D +GE ++ L ++   QT
Sbjct: 66  EFNETLTYYGITEEDIQRKTLRLLVLDEDRFG-NDFLGETRIPLKKLKPNQT 116


>gnl|CDD|176004 cd04039, C2_PSD, C2 domain present in Phosphatidylserine
           decarboxylase (PSD).  PSD is involved in the
           biosynthesis of aminophospholipid by converting
           phosphatidylserine (PtdSer) to phosphatidylethanolamine
           (PtdEtn). There is a single C2 domain present and it is
           thought to confer PtdSer binding motif that is common to
           PKC and synaptotagmin. C2 domains fold into an 8-standed
           beta-sandwich that can adopt 2 structural arrangements:
           Type I and Type II, distinguished by a circular
           permutation involving their N- and C-terminal beta
           strands. Many C2 domains are Ca2+-dependent
           membrane-targeting modules that bind a wide variety of
           substances including bind phospholipids, inositol
           polyphosphates, and intracellular proteins.  Most C2
           domain proteins are either signal transduction enzymes
           that contain a single C2 domain, such as protein kinase
           C, or membrane trafficking proteins which contain at
           least two C2 domains, such as synaptotagmin 1.  However,
           there are a few exceptions to this including RIM
           isoforms and some splice variants of piccolo/aczonin and
           intersectin which only have a single C2 domain.  C2
           domains with a calcium binding region have negatively
           charged residues, primarily aspartates, that serve as
           ligands for calcium ions.
          Length = 108

 Score = 34.5 bits (80), Expect = 0.005
 Identities = 17/82 (20%), Positives = 34/82 (41%), Gaps = 20/82 (24%)

Query: 94  MPPWVVVS-----------------IFIERQILEGVPYADAMNKTLVFAIFDFDRFSKHD 136
           M P+V++S                 +F ER   E  P+    N  + F + D D+FS +D
Sbjct: 26  MDPFVIISFGRRVFRTSWRRHTLNPVFNERLAFEVYPHE--KNFDIQFKVLDKDKFSFND 83

Query: 137 QIGEVKVALCQ-IDLAQTIEEW 157
            +    +++ + ++ A   +  
Sbjct: 84  YVATGSLSVQELLNAAPQPDPE 105


>gnl|CDD|175997 cd04031, C2A_RIM1alpha, C2 domain first repeat contained in
           Rab3-interacting molecule (RIM) proteins.  RIMs are
           believed to organize specialized sites of the plasma
           membrane called active zones.  They also play a role in
           controlling neurotransmitter release, plasticity
           processes, as well as memory and learning.  RIM contains
           an N-terminal zinc finger domain, a PDZ domain, and two
           C-terminal C2 domains (C2A, C2B).  C2 domains fold into
           an 8-standed beta-sandwich that can adopt 2 structural
           arrangements: Type I and Type II, distinguished by a
           circular permutation involving their N- and C-terminal
           beta strands. Many C2 domains are Ca2+-dependent
           membrane-targeting modules that bind a wide variety of
           substances including bind phospholipids, inositol
           polyphosphates, and intracellular proteins.  Most C2
           domain proteins are either signal transduction enzymes
           that contain a single C2 domain, such as protein kinase
           C, or membrane trafficking proteins which contain at
           least two C2 domains, such as synaptotagmin 1.  However,
           there are a few exceptions to this including RIM
           isoforms and some splice variants of piccolo/aczonin and
           intersectin which only have a single C2 domain.  C2
           domains with a calcium binding region have negatively
           charged residues, primarily aspartates, that serve as
           ligands for calcium ions. Members here have a type-I
           topology and do not bind Ca2+.
          Length = 125

 Score = 34.5 bits (80), Expect = 0.007
 Identities = 22/81 (27%), Positives = 32/81 (39%), Gaps = 19/81 (23%)

Query: 87  KVAEETGMPPWVVVSIFIERQILE--GVPYADAMNKTLVFAIFDFDRFSKHDQIGEVKVA 144
           K  ++T  P W         Q  E   V       +TL   ++D+DR  ++D +GE    
Sbjct: 58  KTVKKTLNPEW--------NQTFEYSNVRRETLKERTLEVTVWDYDRDGENDFLGE---- 105

Query: 145 LCQIDLAQTI----EEWRELQ 161
              IDLA  +      W  LQ
Sbjct: 106 -VVIDLADALLDDEPHWYPLQ 125


>gnl|CDD|176012 cd04047, C2B_Copine, C2 domain second repeat in Copine.  There are
           2 copies of the C2 domain present in copine, a protein
           involved in membrane trafficking, protein-protein
           interactions, and perhaps even cell division and growth.
            C2 domains fold into an 8-standed beta-sandwich that
           can adopt 2 structural arrangements: Type I and Type II,
           distinguished by a circular permutation involving their
           N- and C-terminal beta strands. Many C2 domains are
           Ca2+-dependent membrane-targeting modules that bind a
           wide variety of substances including bind phospholipids,
           inositol polyphosphates, and intracellular proteins.
           Most C2 domain proteins are either signal transduction
           enzymes that contain a single C2 domain, such as protein
           kinase C, or membrane trafficking proteins which contain
           at least two C2 domains, such as synaptotagmin 1.
           However, there are a few exceptions to this including
           RIM isoforms and some splice variants of piccolo/aczonin
           and intersectin which only have a single C2 domain.  C2
           domains with a calcium binding region have negatively
           charged residues, primarily aspartates, that serve as
           ligands for calcium ions. This cd contains the second C2
           repeat, C2B, and has a type-I topology.
          Length = 110

 Score = 33.3 bits (77), Expect = 0.014
 Identities = 11/40 (27%), Positives = 22/40 (55%), Gaps = 1/40 (2%)

Query: 118 MNKTLVFAIFDFDRFSKHDQIGEVKVALCQIDLAQTIEEW 157
            ++ +   ++D+D   KHD IGE +  L ++ L  +  E+
Sbjct: 68  YDRPIKIEVYDYDSSGKHDLIGEFETTLDEL-LKSSPLEF 106


>gnl|CDD|176029 cd08383, C2A_RasGAP, C2 domain (first repeat) of Ras GTPase
           activating proteins (GAPs).  RasGAPs suppress Ras
           function by enhancing the GTPase activity of Ras
           proteins resulting in the inactive GDP-bound form of
           Ras.  In this way it can control cellular proliferation
           and differentiation.  The proteins here all contain
           either a single C2 domain or two tandem C2 domains,  a
           Ras-GAP domain, and a pleckstrin homology (PH)-like
           domain. C2 domains fold into an 8-standed beta-sandwich
           that can adopt 2 structural arrangements: Type I and
           Type II, distinguished by a circular permutation
           involving their N- and C-terminal beta strands. Many C2
           domains are Ca2+-dependent membrane-targeting modules
           that bind a wide variety of substances including bind
           phospholipids, inositol polyphosphates, and
           intracellular proteins.  Most C2 domain proteins are
           either signal transduction enzymes that contain a single
           C2 domain, such as protein kinase C, or membrane
           trafficking proteins which contain at least two C2
           domains, such as synaptotagmin 1.  However, there are a
           few exceptions to this including RIM isoforms and some
           splice variants of piccolo/aczonin and intersectin which
           only have a single C2 domain.  C2 domains with a calcium
           binding region have negatively charged residues,
           primarily aspartates, that serve as ligands for calcium
           ions. Members here have a type-I topology.
          Length = 117

 Score = 33.0 bits (76), Expect = 0.023
 Identities = 16/47 (34%), Positives = 24/47 (51%)

Query: 126 IFDFDRFSKHDQIGEVKVALCQIDLAQTIEEWRELQSVEGEGGQIGK 172
            ++ D+ SK   I   KVAL ++DL Q  +EW  L  V+ +    G 
Sbjct: 64  FYNKDKRSKDRDIVIGKVALSKLDLGQGKDEWFPLTPVDPDSEVQGS 110


>gnl|CDD|175996 cd04030, C2C_KIAA1228, C2 domain third repeat present in
           uncharacterized human KIAA1228-like proteins.  KIAA
           proteins are uncharacterized human proteins. They were
           compiled by the Kazusa mammalian cDNA project which
           identified more than 2000 human genes. They are
           identified by 4 digit codes that precede the KIAA
           designation.  Many KIAA genes are still functionally
           uncharacterized including KIAA1228. C2 domains fold into
           an 8-standed beta-sandwich that can adopt 2 structural
           arrangements: Type I and Type II, distinguished by a
           circular permutation involving their N- and C-terminal
           beta strands. Many C2 domains are Ca2+-dependent
           membrane-targeting modules that bind a wide variety of
           substances including bind phospholipids, inositol
           polyphosphates, and intracellular proteins.  Most C2
           domain proteins are either signal transduction enzymes
           that contain a single C2 domain, such as protein kinase
           C, or membrane trafficking proteins which contain at
           least two C2 domains, such as synaptotagmin 1.  However,
           there are a few exceptions to this including RIM
           isoforms and some splice variants of piccolo/aczonin and
           intersectin which only have a single C2 domain.  C2
           domains with a calcium binding region have negatively
           charged residues, primarily aspartates, that serve as
           ligands for calcium ions. This cd contains the third C2
           repeat, C2C, and has a type-II topology.
          Length = 127

 Score = 33.0 bits (76), Expect = 0.028
 Identities = 12/52 (23%), Positives = 24/52 (46%), Gaps = 2/52 (3%)

Query: 112 VPYADAMNKTLVFAI-FDFDRFSKH-DQIGEVKVALCQIDLAQTIEEWRELQ 161
           V   +   +TL  A+       S+    +G+V + L  +DL++   +W +L 
Sbjct: 76  VSLEELKRRTLDVAVKNSKSFLSREKKLLGQVLIDLSDLDLSKGFTQWYDLT 127


>gnl|CDD|176056 cd08521, C2A_SLP, C2 domain first repeat present in
           Synaptotagmin-like proteins.  All Slp members basically
           share an N-terminal Slp homology domain (SHD) and
           C-terminal tandem C2 domains (named the C2A domain and
           the C2B domain) with the SHD and C2 domains being
           separated by a linker sequence of various length.
           Slp1/JFC1 and Slp2/exophilin 4 promote granule docking
           to the plasma membrane.  Additionally, their C2A domains
           are both Ca2+ independent, unlike the case in Slp3 and
           Slp4/granuphilin in which their C2A domains are Ca2+
           dependent.  It is thought that SHD (except for the
           Slp4-SHD) functions as a specific Rab27A/B-binding
           domain. In addition to Slps, rabphilin, Noc2, and
           Munc13-4 also function as Rab27-binding proteins. It has
           been demonstrated that Slp3 and Slp4/granuphilin promote
           dense-core vesicle exocytosis. Slp5 mRNA has been shown
           to be restricted to human placenta and liver suggesting
           a role in Rab27A-dependent membrane trafficking in
           specific tissues. C2 domains fold into an 8-standed
           beta-sandwich that can adopt 2 structural arrangements:
           Type I and Type II, distinguished by a circular
           permutation involving their N- and C-terminal beta
           strands. Many C2 domains are Ca2+-dependent
           membrane-targeting modules that bind a wide variety of
           substances including bind phospholipids, inositol
           polyphosphates, and intracellular proteins.  Most C2
           domain proteins are either signal transduction enzymes
           that contain a single C2 domain, such as protein kinase
           C, or membrane trafficking proteins which contain at
           least two C2 domains, such as synaptotagmin 1.  However,
           there are a few exceptions to this including RIM
           isoforms and some splice variants of piccolo/aczonin and
           intersectin which only have a single C2 domain.  C2
           domains with a calcium binding region have negatively
           charged residues, primarily aspartates, that serve as
           ligands for calcium ions.   This cd contains the first
           C2 repeat, C2A, and has a type-I topology.
          Length = 123

 Score = 32.6 bits (75), Expect = 0.037
 Identities = 13/46 (28%), Positives = 24/46 (52%)

Query: 112 VPYADAMNKTLVFAIFDFDRFSKHDQIGEVKVALCQIDLAQTIEEW 157
           +  +    +TL  +++  DRF ++  +GEV++ L   DL     EW
Sbjct: 75  ISKSQLETRTLQLSVWHHDRFGRNTFLGEVEIPLDSWDLDSQQSEW 120


>gnl|CDD|215765 pfam00168, C2, C2 domain. 
          Length = 85

 Score = 31.1 bits (71), Expect = 0.066
 Identities = 11/21 (52%), Positives = 14/21 (66%)

Query: 122 LVFAIFDFDRFSKHDQIGEVK 142
           L   ++D+DRF K D IGEV 
Sbjct: 65  LRIEVYDYDRFGKDDFIGEVT 85


>gnl|CDD|175990 cd04024, C2A_Synaptotagmin-like, C2 domain first repeat present in
           Synaptotagmin-like proteins.  Synaptotagmin is a
           membrane-trafficking protein characterized by a
           N-terminal transmembrane region, a linker, and 2
           C-terminal C2 domains. Previously all synaptotagmins
           were thought to be calcium sensors in the regulation of
           neurotransmitter release and hormone secretion, but it
           has been shown that not all of them bind calcium.  Of
           the 17 identified synaptotagmins only 8 bind calcium
           (1-3, 5-7, 9, 10).  The function of the two C2 domains
           that bind calcium are: regulating the fusion step of
           synaptic vesicle exocytosis (C2A) and  binding to
           phosphatidyl-inositol-3,4,5-triphosphate (PIP3) in the
           absence of calcium ions and to phosphatidylinositol
           bisphosphate (PIP2) in their presence (C2B).  C2B also
           regulates also the recycling step of synaptic vesicles.
           C2 domains fold into an 8-standed beta-sandwich that can
           adopt 2 structural arrangements: Type I and Type II,
           distinguished by a circular permutation involving their
           N- and C-terminal beta strands. Many C2 domains are
           Ca2+-dependent membrane-targeting modules that bind a
           wide variety of substances including bind phospholipids,
           inositol polyphosphates, and intracellular proteins.
           Most C2 domain proteins are either signal transduction
           enzymes that contain a single C2 domain, such as protein
           kinase C, or membrane trafficking proteins which contain
           at least two C2 domains, such as synaptotagmin 1.
           However, there are a few exceptions to this including
           RIM isoforms and some splice variants of piccolo/aczonin
           and intersectin which only have a single C2 domain.  C2
           domains with a calcium binding region have negatively
           charged residues, primarily aspartates, that serve as
           ligands for calcium ions. This cd contains the first C2
           repeat, C2A, and has a type-I topology.
          Length = 128

 Score = 31.6 bits (72), Expect = 0.091
 Identities = 16/55 (29%), Positives = 26/55 (47%), Gaps = 3/55 (5%)

Query: 112 VPYADAMNKTLVFAIFDFDRFSKHDQIGEVKVALCQIDLAQTIEE---WRELQSV 163
            P   A N+ L   ++D DRF+  D +GE  +AL ++       +   W  L+S 
Sbjct: 56  FPIFSAQNQLLKLILWDKDRFAGKDYLGEFDIALEEVFADGKTGQSDKWITLKST 110


>gnl|CDD|176047 cd08402, C2B_Synaptotagmin-1, C2 domain second repeat present in
           Synaptotagmin 1.  Synaptotagmin is a
           membrane-trafficking protein characterized by a
           N-terminal transmembrane region, a linker, and 2
           C-terminal C2 domains.  Synaptotagmin 1, a member of the
           class 1 synaptotagmins, is located in the brain and
           endocranium and localized to the synaptic vesicles and
           secretory granules.  It functions as a Ca2+ sensor for
           fast exocytosis. It, like synaptotagmin-2, has an
           N-glycosylated N-terminus. Synaptotagmin 4, a member of
           class 4 synaptotagmins, is located in the brain.  It
           functions are unknown. It, like synaptotagmin-11, has an
           Asp to Ser substitution in its C2A domain. Previously
           all synaptotagmins were thought to be calcium sensors in
           the regulation of neurotransmitter release and hormone
           secretion, but it has been shown that not all of them
           bind calcium.  Of the 17 identified synaptotagmins only
           8 bind calcium (1-3, 5-7, 9, 10).  The function of the
           two C2 domains that bind calcium are: regulating the
           fusion step of synaptic vesicle exocytosis (C2A) and
           binding to phosphatidyl-inositol-3,4,5-triphosphate
           (PIP3) in the absence of calcium ions and to
           phosphatidylinositol bisphosphate (PIP2) in their
           presence (C2B).  C2B also regulates also the recycling
           step of synaptic vesicles. C2 domains fold into an
           8-standed beta-sandwich that can adopt 2 structural
           arrangements: Type I and Type II, distinguished by a
           circular permutation involving their N- and C-terminal
           beta strands. Many C2 domains are Ca2+-dependent
           membrane-targeting modules that bind a wide variety of
           substances including bind phospholipids, inositol
           polyphosphates, and intracellular proteins.  Most C2
           domain proteins are either signal transduction enzymes
           that contain a single C2 domain, such as protein kinase
           C, or membrane trafficking proteins which contain at
           least two C2 domains, such as synaptotagmin 1.  However,
           there are a few exceptions to this including RIM
           isoforms and some splice variants of piccolo/aczonin and
           intersectin which only have a single C2 domain.  C2
           domains with a calcium binding region have negatively
           charged residues, primarily aspartates, that serve as
           ligands for calcium ions. This cd contains the second C2
           repeat, C2B, and has a type-I topology.
          Length = 136

 Score = 30.8 bits (70), Expect = 0.19
 Identities = 11/32 (34%), Positives = 18/32 (56%)

Query: 112 VPYADAMNKTLVFAIFDFDRFSKHDQIGEVKV 143
           VP+       L+  + D+DR  K+D IG+V +
Sbjct: 75  VPFEQIQKVHLIVTVLDYDRIGKNDPIGKVVL 106


>gnl|CDD|176002 cd04037, C2E_Ferlin, C2 domain fifth repeat in Ferlin.  Ferlins are
           involved in vesicle fusion events.  Ferlins and other
           proteins, such as Synaptotagmins, are implicated in
           facilitating the fusion process when cell membranes fuse
           together.  There are six known human Ferlins: Dysferlin
           (Fer1L1), Otoferlin (Fer1L2), Myoferlin (Fer1L3),
           Fer1L4, Fer1L5, and Fer1L6.  Defects in these genes can
           lead to a wide range of diseases including muscular
           dystrophy (dysferlin), deafness (otoferlin), and
           infertility (fer-1, fertilization factor-1).
           Structurally they have 6 tandem C2 domains, designated
           as (C2A-C2F) and a single C-terminal transmembrane
           domain, though there is a new study that disputes this
           and claims that there are actually 7 tandem C2 domains
           with another C2 domain inserted between C2D and C2E. 
           In a subset of them (Dysferlin, Myoferlin, and Fer1)
           there is an additional conserved domain called DysF. C2
           domains fold into an 8-standed beta-sandwich that can
           adopt 2 structural arrangements: Type I and Type II,
           distinguished by a circular permutation involving their
           N- and C-terminal beta strands. Many C2 domains are
           Ca2+-dependent membrane-targeting modules that bind a
           wide variety of substances including bind phospholipids,
           inositol polyphosphates, and intracellular proteins.
           Most C2 domain proteins are either signal transduction
           enzymes that contain a single C2 domain, such as protein
           kinase C, or membrane trafficking proteins which contain
           at least two C2 domains, such as synaptotagmin 1.
           However, there are a few exceptions to this including
           RIM isoforms and some splice variants of piccolo/aczonin
           and intersectin which only have a single C2 domain.  C2
           domains with a calcium binding region have negatively
           charged residues, primarily aspartates, that serve as
           ligands for calcium ions. This cd contains the fifth C2
           repeat, C2E, and has a type-II topology.
          Length = 124

 Score = 29.8 bits (68), Expect = 0.34
 Identities = 11/33 (33%), Positives = 14/33 (42%), Gaps = 5/33 (15%)

Query: 118 MNKTLVFAIFDFDRFSKHDQIGEVKVALCQIDL 150
            N  L  ++ D+D     D IGE       IDL
Sbjct: 61  GNSILKISVMDYDLLGSDDLIGETV-----IDL 88


>gnl|CDD|176007 cd04042, C2A_MCTP_PRT, C2 domain first repeat found in Multiple C2
           domain and Transmembrane region Proteins (MCTP).  MCTPs
           are involved in Ca2+ signaling at the membrane.  MCTP is
           composed of a variable N-terminal sequence, three C2
           domains, two transmembrane regions (TMRs), and a short
           C-terminal sequence.  It is one of four protein classes
           that are anchored to membranes via a transmembrane
           region; the others being synaptotagmins, extended
           synaptotagmins, and ferlins. MCTPs are the only
           membrane-bound C2 domain proteins that contain two
           functional TMRs. MCTPs are unique in that they bind Ca2+
           but not phospholipids. C2 domains fold into an 8-standed
           beta-sandwich that can adopt 2 structural arrangements:
           Type I and Type II, distinguished by a circular
           permutation involving their N- and C-terminal beta
           strands. Many C2 domains are Ca2+-dependent
           membrane-targeting modules that bind a wide variety of
           substances including bind phospholipids, inositol
           polyphosphates, and intracellular proteins.  Most C2
           domain proteins are either signal transduction enzymes
           that contain a single C2 domain, such as protein kinase
           C, or membrane trafficking proteins which contain at
           least two C2 domains, such as synaptotagmin 1.  However,
           there are a few exceptions to this including RIM
           isoforms and some splice variants of piccolo/aczonin and
           intersectin which only have a single C2 domain.  C2
           domains with a calcium binding region have negatively
           charged residues, primarily aspartates, that serve as
           ligands for calcium ions. This cd contains the first C2
           repeat, C2A, and has a type-II topology.
          Length = 121

 Score = 29.6 bits (67), Expect = 0.41
 Identities = 11/36 (30%), Positives = 18/36 (50%)

Query: 120 KTLVFAIFDFDRFSKHDQIGEVKVALCQIDLAQTIE 155
           + L   +FD+DR    D +G   V L  ++L +  E
Sbjct: 61  QPLYIKVFDYDRGLTDDFMGSAFVDLSTLELNKPTE 96


>gnl|CDD|99869 cd06116, CaCS_like, Chloroflexus aurantiacus (Ca) citrate synthase
           (CS)_like. CS catalyzes the condensation of acetyl
           coenzyme A (AcCoA) and oxalacetate (OAA) to form citrate
           and coenzyme A (CoA), the first step in the citric acid
           cycle (TCA or Krebs cycle). This group is similar to
           gram-negative Escherichia coli (Ec) CS (type II, gltA)
           and Arabidopsis thaliana (Ath) peroxisomal (Per) CS.
           However EcCS and AthPerCS are not found in this group.
           The overall CS reaction is thought to proceed through
           three partial reactions and involves both closed and
           open conformational forms of the enzyme: a) the
           carbanion or equivalent is generated from AcCoA by base
           abstraction of a proton, b) the nucleophilic attack of
           this carbanion on OAA to generate citryl-CoA, and c) the
           hydrolysis of citryl-CoA to produce citrate and CoA. 
           There are two types of CSs: type I CS and type II CSs.
           Type I CSs are found in eukarya, gram-positive bacteria,
           archaea, and in some gram-negative bacteria and are
           homodimers with both subunits participating in the
           active site.  Type II CSs are unique to gram-negative
           bacteria and are homohexamers of identical subunits
           (approximated as a trimer of dimers).  Some type II CSs
           are strongly and specifically inhibited by NADH through
           an allosteric mechanism. C. aurantiacus is a
           gram-negative thermophilic green gliding bacterium, its
           CS belonging to this group may be a type I CS; it is not
           inhibited by NADH or 2-oxoglutarate and is inhibited by
           ATP. Both gram-positive and gram-negative bacteria are
           found in this group.
          Length = 384

 Score = 30.2 bits (68), Expect = 0.50
 Identities = 12/28 (42%), Positives = 19/28 (67%)

Query: 83  KIADKVAEETGMPPWVVVSIFIERQILE 110
           KIAD+V E TG  P + +++ +E+  LE
Sbjct: 281 KIADEVFEATGRNPLLDIAVELEKIALE 308


>gnl|CDD|226068 COG3538, COG3538, Uncharacterized conserved protein [Function
           unknown].
          Length = 434

 Score = 30.1 bits (68), Expect = 0.58
 Identities = 16/51 (31%), Positives = 22/51 (43%), Gaps = 6/51 (11%)

Query: 113 PYADAMNKTLVFAIFDFDRFSKHDQIGEVKV---ALCQ-IDLAQTIEEWRE 159
           PYA+A N+T   A    D    +  + E K    +LC  I LA     W+ 
Sbjct: 102 PYANAFNETANGAGHQTDHTEMNPWVWERKYEIDSLCYPIQLAYLY--WKA 150


>gnl|CDD|218797 pfam05890, Ebp2, Eukaryotic rRNA processing protein EBP2.  This
          family consists of several Eukaryotic rRNA processing
          protein EBP2 sequences. Ebp2p is required for the
          maturation of 25S rRNA and 60S subunit assembly. Ebp2p
          may be one of the target proteins of Rrs1p for
          executing the signal to regulate ribosome biogenesis.
          This family also plays a role in chromosome
          segregation.
          Length = 270

 Score = 29.6 bits (67), Expect = 0.66
 Identities = 13/50 (26%), Positives = 23/50 (46%)

Query: 49 EEEDLEMTEAFEDVSEELSSTVASIKKEIANESMKIADKVAEETGMPPWV 98
          ++ D+E+ EAF D   +    V   +K+  N +  +  K+       PWV
Sbjct: 1  DDSDVELQEAFADGELKPGLNVVPHQKKTINNTAALKAKLERIKLPLPWV 50


>gnl|CDD|130038 TIGR00965, dapD, 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate
           N-succinyltransferase.  This enzyme is part of the
           diaminopimelate pathway of lysine biosynthesis.
           Alternate name: tetrahydrodipicolinate
           N-succinyltransferase. The closely related TabB protein
           of Pseudomonas syringae (pv. tabaci) appears to act in
           the biosynthesis of tabtoxin rather than lysine. The
           trusted cutoff is set high enough to exclude this gene.
           Sequences below trusted also include a version of this
           enzyme which apparently utilize acetate rather than
           succinate (EC: 2.3.1.89) [Amino acid biosynthesis,
           Aspartate family].
          Length = 269

 Score = 29.5 bits (66), Expect = 0.81
 Identities = 20/94 (21%), Positives = 41/94 (43%), Gaps = 13/94 (13%)

Query: 54  EMTEAFEDVSEELSSTVASIKKEIANES--------MKIADKVAEETGMPPWVVVSIFIE 105
            +  AFE  +E   +   ++ KE  NE         +++A+K+  +  +  W+  ++ + 
Sbjct: 5   IIETAFERRAEITPANADTVTKEAVNEVIALLDSGALRVAEKIDGQWKVNEWLKKAVLLS 64

Query: 106 RQILEGVPYADAMNK-----TLVFAIFDFDRFSK 134
            +I +      A N+      + FA +D  RF K
Sbjct: 65  FRINDNQVINGAENRYFDKVPMKFADYDEARFKK 98


>gnl|CDD|176039 cd08393, C2A_SLP-1_2, C2 domain first repeat present in
           Synaptotagmin-like proteins 1 and 2.  All Slp members
           basically share an N-terminal Slp homology domain (SHD)
           and C-terminal tandem C2 domains (named the C2A domain
           and the C2B domain) with the SHD and C2 domains being
           separated by a linker sequence of various length.
           Slp1/JFC1 and Slp2/exophilin 4 promote granule docking
           to the plasma membrane.  Additionally, their C2A domains
           are both Ca2+ independent, unlike Slp3 and
           Slp4/granuphilin which are Ca2+ dependent.  It is
           thought that SHD (except for the Slp4-SHD) functions as
           a specific Rab27A/B-binding domain.  In addition to
           Slps, rabphilin, Noc2, and  Munc13-4 also function as
           Rab27-binding proteins.  C2 domains fold into an
           8-standed beta-sandwich that can adopt 2 structural
           arrangements: Type I and Type II, distinguished by a
           circular permutation involving their N- and C-terminal
           beta strands. Many C2 domains are Ca2+-dependent
           membrane-targeting modules that bind a wide variety of
           substances including bind phospholipids, inositol
           polyphosphates, and intracellular proteins.  Most C2
           domain proteins are either signal transduction enzymes
           that contain a single C2 domain, such as protein kinase
           C, or membrane trafficking proteins which contain at
           least two C2 domains, such as synaptotagmin 1.  However,
           there are a few exceptions to this including RIM
           isoforms and some splice variants of piccolo/aczonin and
           intersectin which only have a single C2 domain.  C2
           domains with a calcium binding region have negatively
           charged residues, primarily aspartates, that serve as
           ligands for calcium ions.  This cd contains the first C2
           repeat, C2A, and has a type-I topology.
          Length = 125

 Score = 28.6 bits (64), Expect = 0.99
 Identities = 13/50 (26%), Positives = 23/50 (46%)

Query: 112 VPYADAMNKTLVFAIFDFDRFSKHDQIGEVKVALCQIDLAQTIEEWRELQ 161
           V   +   + L  +++  D   ++  +GEV+V L   D + T   W  LQ
Sbjct: 76  VEREELPTRVLNLSVWHRDSLGRNSFLGEVEVDLGSWDWSNTQPTWYPLQ 125


>gnl|CDD|175987 cd04020, C2B_SLP_1-2-3-4, C2 domain second repeat present in
           Synaptotagmin-like proteins 1-4.  All Slp members
           basically share an N-terminal Slp homology domain (SHD)
           and C-terminal tandem C2 domains (named the C2A domain
           and the C2B domain) with the SHD and C2 domains being
           separated by a linker sequence of various length.
           Slp1/JFC1 and Slp2/exophilin 4 promote granule docking
           to the plasma membrane.  Additionally, their C2A domains
           are both Ca2+ independent, unlike the case in Slp3 and
           Slp4/granuphilin in which their C2A domains are Ca2+
           dependent.  It is thought that SHD (except for the
           Slp4-SHD) functions as a specific Rab27A/B-binding
           domain. In addition to Slps, rabphilin, Noc2, and
           Munc13-4 also function as Rab27-binding proteins. It has
           been demonstrated that Slp3 and Slp4/granuphilin promote
           dense-core vesicle exocytosis. C2 domains fold into an
           8-standed beta-sandwich that can adopt 2 structural
           arrangements: Type I and Type II, distinguished by a
           circular permutation involving their N- and C-terminal
           beta strands. Many C2 domains are Ca2+-dependent
           membrane-targeting modules that bind a wide variety of
           substances including bind phospholipids, inositol
           polyphosphates, and intracellular proteins.  Most C2
           domain proteins are either signal transduction enzymes
           that contain a single C2 domain, such as protein kinase
           C, or membrane trafficking proteins which contain at
           least two C2 domains, such as synaptotagmin 1.  However,
           there are a few exceptions to this including RIM
           isoforms and some splice variants of piccolo/aczonin and
           intersectin which only have a single C2 domain.  C2
           domains with a calcium binding region have negatively
           charged residues, primarily aspartates, that serve as
           ligands for calcium ions.   This cd contains the second
           C2 repeat, C2B, and has a type-I topology.
          Length = 162

 Score = 28.8 bits (65), Expect = 1.0
 Identities = 13/55 (23%), Positives = 23/55 (41%)

Query: 110 EGVPYADAMNKTLVFAIFDFDRFSKHDQIGEVKVALCQIDLAQTIEEWRELQSVE 164
           +GV   D     L   ++D D+ S +D +G V++ L          +W +    E
Sbjct: 86  DGVSPEDLSQACLELTVWDHDKLSSNDFLGGVRLGLGTGKSYGQAVDWMDSTGEE 140


>gnl|CDD|176014 cd04049, C2_putative_Elicitor-responsive_gene, C2 domain present in
           the putative elicitor-responsive gene.  In plants
           elicitor-responsive proteins are triggered in response
           to specific elicitor molecules such as glycolproteins,
           peptides, carbohydrates and lipids. A host of defensive
           responses are also triggered resulting in localized cell
           death.  Antimicrobial secondary metabolites, such as
           phytoalexins, or defense-related proteins, including
           pathogenesis-related (PR) proteins  are also produced.
           There is a single C2 domain present here.  C2 domains
           fold into an 8-standed beta-sandwich that can adopt 2
           structural arrangements: Type I and Type II,
           distinguished by a circular permutation involving their
           N- and C-terminal beta strands. Many C2 domains are
           Ca2+-dependent membrane-targeting modules that bind a
           wide variety of substances including bind phospholipids,
           inositol polyphosphates, and intracellular proteins.
           Most C2 domain proteins are either signal transduction
           enzymes that contain a single C2 domain, such as protein
           kinase C, or membrane trafficking proteins which contain
           at least two C2 domains, such as synaptotagmin 1.
           However, there are a few exceptions to this including
           RIM isoforms and some splice variants of piccolo/aczonin
           and intersectin which only have a single C2 domain.  C2
           domains with a calcium binding region have negatively
           charged residues, primarily aspartates, that serve as
           ligands for calcium ions. Members have a type-II
           topology.
          Length = 124

 Score = 28.5 bits (64), Expect = 1.1
 Identities = 18/49 (36%), Positives = 19/49 (38%), Gaps = 6/49 (12%)

Query: 112 VPYADAMNKT-LVFAIFDFDRFSKHDQIGEVKVALCQIDLAQTIEEWRE 159
           V Y      T L+  I D D FS  D IGE       I L    EE  E
Sbjct: 57  VEYPGWGGDTKLILRIMDKDNFSDDDFIGEAT-----IHLKGLFEEGVE 100


>gnl|CDD|176059 cd08677, C2A_Synaptotagmin-13, C2 domain.  Synaptotagmin is a
           membrane-trafficking protein characterized by a
           N-terminal transmembrane region, a linker, and 2
           C-terminal C2 domains. Synaptotagmin 13, a member of
           class 6 synaptotagmins, is located in the brain.  It
           functions are unknown. It, like synaptotagmins 8 and 12,
           does not have any consensus Ca2+ binding sites.
           Previously all synaptotagmins were thought to be calcium
           sensors in the regulation of neurotransmitter release
           and hormone secretion, but it has been shown that not
           all of them bind calcium.  Of the 17 identified
           synaptotagmins only 8 bind calcium (1-3, 5-7, 9, 10).
           The function of the two C2 domains that bind calcium
           are: regulating the fusion step of synaptic vesicle
           exocytosis (C2A) and  binding to
           phosphatidyl-inositol-3,4,5-triphosphate (PIP3) in the
           absence of calcium ions and to phosphatidylinositol
           bisphosphate (PIP2) in their presence (C2B).  C2B also
           regulates also the recycling step of synaptic vesicles.
           C2 domains fold into an 8-standed beta-sandwich that can
           adopt 2 structural arrangements: Type I and Type II,
           distinguished by a circular permutation involving their
           N- and C-terminal beta strands. Many C2 domains are
           Ca2+-dependent membrane-targeting modules that bind a
           wide variety of substances including bind phospholipids,
           inositol polyphosphates, and intracellular proteins.
           Most C2 domain proteins are either signal transduction
           enzymes that contain a single C2 domain, such as protein
           kinase C, or membrane trafficking proteins which contain
           at least two C2 domains, such as synaptotagmin 1.
           However, there are a few exceptions to this including
           RIM isoforms and some splice variants of piccolo/aczonin
           and intersectin which only have a single C2 domain.  C2
           domains with a calcium binding region have negatively
           charged residues, primarily aspartates, that serve as
           ligands for calcium ions. This CD contains the first C2
           repeat, C2A, and has a type-I topology.
          Length = 118

 Score = 27.6 bits (61), Expect = 1.8
 Identities = 12/40 (30%), Positives = 22/40 (55%)

Query: 121 TLVFAIFDFDRFSKHDQIGEVKVALCQIDLAQTIEEWREL 160
           TL   +   DRFS+H  +GE+++ L  + +     +W +L
Sbjct: 79  TLTLTLRCCDRFSRHSTLGELRLKLADVSMMLGAAQWVDL 118


>gnl|CDD|176037 cd08391, C2A_C2C_Synaptotagmin_like, C2 domain first and third
           repeat in Synaptotagmin-like proteins.  Synaptotagmin is
           a membrane-trafficking protein characterized by a
           N-terminal transmembrane region, a linker, and 2
           C-terminal C2 domains. Previously all synaptotagmins
           were thought to be calcium sensors in the regulation of
           neurotransmitter release and hormone secretion, but it
           has been shown that not all of them bind calcium.  Of
           the 17 identified synaptotagmins only 8 bind calcium
           (1-3, 5-7, 9, 10).  The function of the two C2 domains
           that bind calcium are: regulating the fusion step of
           synaptic vesicle exocytosis (C2A) and  binding to
           phosphatidyl-inositol-3,4,5-triphosphate (PIP3) in the
           absence of calcium ions and to phosphatidylinositol
           bisphosphate (PIP2) in their presence (C2B).  C2B also
           regulates also the recycling step of synaptic vesicles.
           C2 domains fold into an 8-standed beta-sandwich that can
           adopt 2 structural arrangements: Type I and Type II,
           distinguished by a circular permutation involving their
           N- and C-terminal beta strands. Many C2 domains are
           Ca2+-dependent membrane-targeting modules that bind a
           wide variety of substances including bind phospholipids,
           inositol polyphosphates, and intracellular proteins.
           Most C2 domain proteins are either signal transduction
           enzymes that contain a single C2 domain, such as protein
           kinase C, or membrane trafficking proteins which contain
           at least two C2 domains, such as synaptotagmin 1.
           However, there are a few exceptions to this including
           RIM isoforms and some splice variants of piccolo/aczonin
           and intersectin which only have a single C2 domain.  C2
           domains with a calcium binding region have negatively
           charged residues, primarily aspartates, that serve as
           ligands for calcium ions. This cd contains either the
           first or third repeat in Synaptotagmin-like proteins
           with a type-I topology.
          Length = 121

 Score = 27.3 bits (61), Expect = 2.3
 Identities = 13/46 (28%), Positives = 23/46 (50%), Gaps = 1/46 (2%)

Query: 119 NKTLVFAIFDFDRFSKHDQIGEVKVALCQIDLAQTIEEWRELQSVE 164
            + L   +FD D   K D +G + + L  ++    I+EW  L+ V+
Sbjct: 67  GQELEIELFDEDP-DKDDFLGRLSIDLGSVEKKGFIDEWLPLEDVK 111


>gnl|CDD|176050 cd08405, C2B_Synaptotagmin-7, C2 domain second repeat present in
           Synaptotagmin 7.  Synaptotagmin is a
           membrane-trafficking protein characterized by a
           N-terminal transmembrane region, a linker, and 2
           C-terminal C2 domains. Synaptotagmin 7, a member of
           class 2 synaptotagmins, is located in presynaptic plasma
           membranes in neurons, dense-core vesicles in endocrine
           cells, and lysosomes in fibroblasts.  It has been shown
           to play a role in regulation of Ca2+-dependent lysosomal
           exocytosis in fibroblasts and may also function as a
           vesicular Ca2+-sensor.  It is distinguished from the
           other synaptotagmins by having over 12 splice forms.
           Previously all synaptotagmins were thought to be calcium
           sensors in the regulation of neurotransmitter release
           and hormone secretion, but it has been shown that not
           all of them bind calcium.  Of the 17 identified
           synaptotagmins only 8 bind calcium (1-3, 5-7, 9, 10).
           The function of the two C2 domains that bind calcium
           are: regulating the fusion step of synaptic vesicle
           exocytosis (C2A) and  binding to
           phosphatidyl-inositol-3,4,5-triphosphate (PIP3) in the
           absence of calcium ions and to phosphatidylinositol
           bisphosphate (PIP2) in their presence (C2B).  C2B also
           regulates also the recycling step of synaptic vesicles.
           C2 domains fold into an 8-standed beta-sandwich that can
           adopt 2 structural arrangements: Type I and Type II,
           distinguished by a circular permutation involving their
           N- and C-terminal beta strands. Many C2 domains are
           Ca2+-dependent membrane-targeting modules that bind a
           wide variety of substances including bind phospholipids,
           inositol polyphosphates, and intracellular proteins.
           Most C2 domain proteins are either signal transduction
           enzymes that contain a single C2 domain, such as protein
           kinase C, or membrane trafficking proteins which contain
           at least two C2 domains, such as synaptotagmin 1.
           However, there are a few exceptions to this including
           RIM isoforms and some splice variants of piccolo/aczonin
           and intersectin which only have a single C2 domain.  C2
           domains with a calcium binding region have negatively
           charged residues, primarily aspartates, that serve as
           ligands for calcium ions. This cd contains the second C2
           repeat, C2B, and has a type-I topology.
          Length = 136

 Score = 27.0 bits (60), Expect = 3.0
 Identities = 9/21 (42%), Positives = 15/21 (71%)

Query: 121 TLVFAIFDFDRFSKHDQIGEV 141
           TL+  + D DR S++D IG++
Sbjct: 84  TLIITVMDKDRLSRNDLIGKI 104


>gnl|CDD|236278 PRK08506, PRK08506, replicative DNA helicase; Provisional.
          Length = 472

 Score = 27.7 bits (62), Expect = 3.8
 Identities = 17/62 (27%), Positives = 29/62 (46%), Gaps = 5/62 (8%)

Query: 31  SIKRKTQATTTTTPLPEDEEEDLEMTEAFEDVSEELSSTVASIKKEIANESMKIADKVAE 90
           SIKR+  +   T P     E+ +E  +   D+ +E+   + SI     +E  K + +V E
Sbjct: 101 SIKRELLSLANTIP-----EQAVEEDQKSSDILDEVERELYSITNGSNSEDFKDSKEVIE 155

Query: 91  ET 92
            T
Sbjct: 156 ST 157


>gnl|CDD|222915 PHA02670, PHA02670, ORF112 putative chemokine-binding protein;
           Provisional.
          Length = 287

 Score = 27.3 bits (60), Expect = 4.4
 Identities = 9/28 (32%), Positives = 14/28 (50%)

Query: 35  KTQATTTTTPLPEDEEEDLEMTEAFEDV 62
           K + T +TTP P   E  L++T+     
Sbjct: 177 KPEPTPSTTPGPTLLETTLDLTDEPTTT 204


>gnl|CDD|176005 cd04040, C2D_Tricalbin-like, C2 domain fourth repeat present in
           Tricalbin-like proteins.  5 to 6 copies of the C2 domain
           are present in Tricalbin, a yeast homolog of
           Synaptotagmin, which is involved in membrane trafficking
           and sorting.  C2 domains fold into an 8-standed
           beta-sandwich that can adopt 2 structural arrangements:
           Type I and Type II, distinguished by a circular
           permutation involving their N- and C-terminal beta
           strands. Many C2 domains are Ca2+-dependent
           membrane-targeting modules that bind a wide variety of
           substances including bind phospholipids, inositol
           polyphosphates, and intracellular proteins.  Most C2
           domain proteins are either signal transduction enzymes
           that contain a single C2 domain, such as protein kinase
           C, or membrane trafficking proteins which contain at
           least two C2 domains, such as synaptotagmin 1.  However,
           there are a few exceptions to this including RIM
           isoforms and some splice variants of piccolo/aczonin and
           intersectin which only have a single C2 domain.  C2
           domains with a calcium binding region have negatively
           charged residues, primarily aspartates, that serve as
           ligands for calcium ions. This cd contains the fifth C2
           repeat, C2E, and has a type-II topology.
          Length = 115

 Score = 26.4 bits (59), Expect = 4.4
 Identities = 14/50 (28%), Positives = 25/50 (50%), Gaps = 3/50 (6%)

Query: 119 NKTLVFAIFDFDRFSKHDQIGEVKVALCQIDLAQTIEEWRELQSVEGEGG 168
              L   ++D+DR  K D +G   + L  ++  +T E    L  ++G+GG
Sbjct: 60  RAVLKVEVYDWDRGGKDDLLGSAYIDLSDLEPEETTE--LTLP-LDGQGG 106


>gnl|CDD|213841 TIGR03635, S17_bact, 30S ribosomal protein S17.  This model
           describes the bacterial ribosomal small subunit protein
           S17, while excluding cytosolic eukaryotic homologs and
           archaeal homologs. The model finds many, but not,
           chloroplast and mitochondrial counterparts to bacterial
           S17 [Protein synthesis, Ribosomal proteins: synthesis
           and modification].
          Length = 71

 Score = 25.6 bits (57), Expect = 4.5
 Identities = 12/30 (40%), Positives = 19/30 (63%), Gaps = 3/30 (10%)

Query: 106 RQILEGVPYADAMNKTLVFAIFDFDRFSKH 135
           R+ L+GV  +D M+KT+V  +   +R  KH
Sbjct: 1   RKTLQGVVVSDKMDKTIVVLV---ERRVKH 27


>gnl|CDD|148209 pfam06466, PCAF_N, PCAF (P300/CBP-associated factor) N-terminal
           domain.  This region is spliced out of human histone
           acetyltranfersase KAT2A isoform 2. It is predicted to be
           of a mixed alpha/beta fold - though predominantly
           helical.
          Length = 252

 Score = 27.2 bits (60), Expect = 5.0
 Identities = 10/25 (40%), Positives = 14/25 (56%)

Query: 2   PPFDKREVVQEVLNVISFNASTLPP 26
           PPF+K  + Q VLN + +  S L  
Sbjct: 139 PPFEKPCIEQGVLNFVQYKFSHLST 163


>gnl|CDD|176027 cd08381, C2B_PI3K_class_II, C2 domain second repeat present in
           class II phosphatidylinositol 3-kinases (PI3Ks).  There
           are 3 classes of PI3Ks based on structure, regulation,
           and specificity.  All classes contain a N-terminal C2
           domain, a PIK domain, and a kinase catalytic domain.
           Unlike class I and class III, class II PI3Ks have
           additionally a PX domain and a C-terminal C2 domain
           containing a nuclear localization signal both of which
           bind phospholipids though in a slightly different
           fashion.  PI3Ks (AKA phosphatidylinositol (PtdIns)
           3-kinases) regulate cell processes such as cell growth,
           differentiation, proliferation, and motility. PI3Ks work
           on phosphorylation of phosphatidylinositol,
           phosphatidylinositide (4)P (PtdIns (4)P),2 or
           PtdIns(4,5)P2. Specifically they phosphorylate the D3
           hydroxyl group of phosphoinositol lipids on the inositol
           ring. C2 domains fold into an 8-standed beta-sandwich
           that can adopt 2 structural arrangements: Type I and
           Type II, distinguished by a circular permutation
           involving their N- and C-terminal beta strands. Many C2
           domains are Ca2+-dependent membrane-targeting modules
           that bind a wide variety of substances including bind
           phospholipids, inositol polyphosphates, and
           intracellular proteins. Most C2 domain proteins are
           either signal transduction enzymes that contain a single
           C2 domain, such as protein kinase C, or membrane
           trafficking proteins which contain at least two C2
           domains, such as synaptotagmin 1.  However, there are a
           few exceptions to this including RIM isoforms and some
           splice variants of piccolo/aczonin and intersectin which
           only have a single C2 domain.  C2 domains with a calcium
           binding region have negatively charged residues,
           primarily aspartates, that serve as ligands for calcium
           ions. This cd contains the second C2 repeat, C2B, and
           has a type-I topology.
          Length = 122

 Score = 26.1 bits (58), Expect = 5.8
 Identities = 19/71 (26%), Positives = 36/71 (50%), Gaps = 6/71 (8%)

Query: 87  KVAEETGMPPWVVVSIFIERQILEGVPYADAMNKTLVFAIFDFDRFSKHDQIGEVKVALC 146
           KV  +T  P       F E  + +G+P  D   + L  +++  D   +++ +G V + L 
Sbjct: 54  KVVRKTRNP------TFNEMLVYDGLPVEDLQQRVLQVSVWSHDSLVENEFLGGVCIPLK 107

Query: 147 QIDLAQTIEEW 157
           ++DL+Q  E+W
Sbjct: 108 KLDLSQETEKW 118


>gnl|CDD|185268 PRK15370, PRK15370, E3 ubiquitin-protein ligase SlrP; Provisional.
          Length = 754

 Score = 27.0 bits (59), Expect = 5.9
 Identities = 24/102 (23%), Positives = 41/102 (40%), Gaps = 4/102 (3%)

Query: 12  EVLNVISFNASTLPPLVADSIKRKTQATTTTTPLPEDEEEDLEMTEAFEDVSEELSSTVA 71
             L+V   +  TLP  +   I      + + T LPE     L+  EA E+    L+S  A
Sbjct: 286 RYLSVYDNSIRTLPAHLPSGITHLNVQSNSLTALPETLPPGLKTLEAGENA---LTSLPA 342

Query: 72  SIKKEIANESMKIADKVAEETGMPPWVVVSIFIERQILEGVP 113
           S+  E+    +           +PP  + ++ + R  L  +P
Sbjct: 343 SLPPELQVLDVSKNQITVLPETLPP-TITTLDVSRNALTNLP 383


>gnl|CDD|175976 cd04009, C2B_Munc13-like, C2 domain second repeat in Munc13
           (mammalian uncoordinated)-like proteins.  C2-like
           domains are thought to be involved in phospholipid
           binding in a Ca2+ independent manner in both Unc13 and
           Munc13. Caenorabditis elegans Unc13 has a central domain
           with sequence similarity to PKC, which includes C1 and
           C2-related domains. Unc13 binds phorbol esters and DAG
           with high affinity in a phospholipid manner.  Mutations
           in Unc13 results in abnormal neuronal connections and
           impairment in cholinergic neurotransmission in the
           nematode.  Munc13 is the mammalian homolog which are
           expressed in the brain.  There are 3 isoforms (Munc13-1,
           -2, -3) and are thought to play a role in
           neurotransmitter release and are hypothesized to be
           high-affinity receptors for phorbol esters.  Unc13 and
           Munc13 contain both C1 and C2 domains.  There are two C2
           related domains present, one central and one at the
           carboxyl end.  Munc13-1 contains a third C2-like domain.
            Munc13 interacts with syntaxin, synaptobrevin, and
           synaptotagmin suggesting a role for these as scaffolding
           proteins. C2 domains fold into an 8-standed
           beta-sandwich that can adopt 2 structural arrangements:
           Type I and Type II, distinguished by a circular
           permutation involving their N- and C-terminal beta
           strands. Many C2 domains are Ca2+-dependent
           membrane-targeting modules that bind a wide variety of
           substances including bind phospholipids, inositol
           polyphosphates, and intracellular proteins.  Most C2
           domain proteins are either signal transduction enzymes
           that contain a single C2 domain, such as protein kinase
           C, or membrane trafficking proteins which contain at
           least two C2 domains, such as synaptotagmin 1.  However,
           there are a few exceptions to this including RIM
           isoforms and some splice variants of piccolo/aczonin and
           intersectin which only have a single C2 domain.  C2
           domains with a calcium binding region have negatively
           charged residues, primarily aspartates, that serve as
           ligands for calcium ions. This cd contains the third C2
           repeat, C2C, and has a type-II topology.
          Length = 133

 Score = 26.4 bits (59), Expect = 6.1
 Identities = 9/30 (30%), Positives = 14/30 (46%)

Query: 119 NKTLVFAIFDFDRFSKHDQIGEVKVALCQI 148
              L+F + D+D    +D  GE  + L  I
Sbjct: 87  GALLLFTVKDYDLLGSNDFEGEAFLPLNDI 116


>gnl|CDD|226683 COG4230, COG4230, Delta 1-pyrroline-5-carboxylate dehydrogenase
           [Energy production and conversion].
          Length = 769

 Score = 27.0 bits (60), Expect = 6.1
 Identities = 7/25 (28%), Positives = 13/25 (52%)

Query: 6   KREVVQEVLNVISFNASTLPPLVAD 30
           +REV   VL+V+ +    L  ++  
Sbjct: 476 QREVFGPVLHVVRYKRDELDEVIDQ 500


>gnl|CDD|216973 pfam02324, Glyco_hydro_70, Glycosyl hydrolase family 70.  Members
           of this family belong to glycosyl hydrolase family 70
           Glucosyltransferases or sucrose 6-glycosyl transferases
           (GTF-S) catalyze the transfer of D-glucopyramnosyl units
           from sucrose onto acceptor molecules, EC:2.4.1.5. This
           family roughly corresponds to the N-terminal catalytic
           domain of the enzyme. Members of this family also
           contain the Putative cell wall binding domain pfam01473,
           which corresponds with the C-terminal glucan-binding
           domain.
          Length = 808

 Score = 27.0 bits (60), Expect = 6.3
 Identities = 11/37 (29%), Positives = 20/37 (54%), Gaps = 2/37 (5%)

Query: 61  DVSEELSSTVASIKK--EIANESMKIADKVAEETGMP 95
             ++ L+ T+  +K+  +I NE M  ADK   +  +P
Sbjct: 313 PKTDGLTFTLDELKQAFKIYNEDMLKADKKYTQYNIP 349


>gnl|CDD|176003 cd04038, C2_ArfGAP, C2 domain present in Arf GTPase Activating
           Proteins (GAP).  ArfGAP is a GTPase activating protein
           which regulates the ADP ribosylation factor Arf, a
           member of the Ras superfamily of GTP-binding proteins.
           The GTP-bound form of Arf is involved in Golgi
           morphology and is involved in recruiting coat proteins. 
           ArfGAP is responsible for the GDP-bound form of Arf
           which is necessary for uncoating the membrane and
           allowing the Golgi to fuse with an acceptor compartment.
            These proteins contain an N-terminal ArfGAP domain
           containing the characteristic zinc finger motif
           (Cys-x2-Cys-x(16,17)-x2-Cys) and C-terminal C2 domain.
           C2 domains were first identified in Protein Kinase C
           (PKC). C2 domains fold into an 8-standed beta-sandwich
           that can adopt 2 structural arrangements: Type I and
           Type II, distinguished by a circular permutation
           involving their N- and C-terminal beta strands. Many C2
           domains are Ca2+-dependent membrane-targeting modules
           that bind a wide variety of substances including bind
           phospholipids, inositol polyphosphates, and
           intracellular proteins.  Most C2 domain proteins are
           either signal transduction enzymes that contain a single
           C2 domain, such as protein kinase C, or membrane
           trafficking proteins which contain at least two C2
           domains, such as synaptotagmin 1.  However, there are a
           few exceptions to this including RIM isoforms and some
           splice variants of piccolo/aczonin and intersectin which
           only have a single C2 domain.  C2 domains with a calcium
           binding region have negatively charged residues,
           primarily aspartates, that serve as ligands for calcium
           ions.
          Length = 145

 Score = 26.1 bits (58), Expect = 6.4
 Identities = 11/28 (39%), Positives = 15/28 (53%)

Query: 118 MNKTLVFAIFDFDRFSKHDQIGEVKVAL 145
               L   +FD D FSK D +GE ++ L
Sbjct: 59  PMAPLKLEVFDKDTFSKDDSMGEAEIDL 86


>gnl|CDD|237018 PRK11905, PRK11905, bifunctional proline
           dehydrogenase/pyrroline-5-carboxylate dehydrogenase;
           Reviewed.
          Length = 1208

 Score = 26.8 bits (60), Expect = 7.0
 Identities = 10/25 (40%), Positives = 15/25 (60%)

Query: 6   KREVVQEVLNVISFNASTLPPLVAD 30
           +REV   VL+V+ F A  L  ++ D
Sbjct: 916 EREVFGPVLHVVRFKADELDRVIDD 940


>gnl|CDD|176030 cd08384, C2B_Rabphilin_Doc2, C2 domain second repeat present in
           Rabphilin and Double C2 domain.  Rabphilin is found
           neurons and in neuroendrocrine cells, while Doc2 is
           found not only in the brain but in tissues, including
           mast cells, chromaffin cells, and osteoblasts.
           Rabphilin and Doc2s share highly homologous tandem C2
           domains, although their N-terminal structures are
           completely different: rabphilin contains an N-terminal
           Rab-binding domain (RBD),7 whereas Doc2 contains an
           N-terminal Munc13-1-interacting domain (MID). C2 domains
           fold into an 8-standed beta-sandwich that can adopt 2
           structural arrangements: Type I and Type II,
           distinguished by a circular permutation involving their
           N- and C-terminal beta strands. Many C2 domains are
           Ca2+-dependent membrane-targeting modules that bind a
           wide variety of substances including bind phospholipids,
           inositol polyphosphates, and intracellular proteins.
           Most C2 domain proteins are either signal transduction
           enzymes that contain a single C2 domain, such as protein
           kinase C, or membrane trafficking proteins which contain
           at least two C2 domains, such as synaptotagmin 1.
           However, there are a few exceptions to this including
           RIM isoforms and some splice variants of piccolo/aczonin
           and intersectin which only have a single C2 domain.  C2
           domains with a calcium binding region have negatively
           charged residues, primarily aspartates, that serve as
           ligands for calcium ions. This cd contains the second C2
           repeat, C2B, and has a type-I topology.
          Length = 133

 Score = 26.2 bits (58), Expect = 7.1
 Identities = 9/30 (30%), Positives = 16/30 (53%)

Query: 112 VPYADAMNKTLVFAIFDFDRFSKHDQIGEV 141
           + ++D   KTL   ++D D    +D IG +
Sbjct: 73  IKHSDLAKKTLEITVWDKDIGKSNDYIGGL 102


>gnl|CDD|225352 COG2747, FlgM, Negative regulator of flagellin synthesis
          (anti-sigma28 factor) [Transcription / Cell motility
          and secretion / Intracellular trafficking and
          secretion].
          Length = 93

 Score = 25.4 bits (56), Expect = 7.5
 Identities = 15/64 (23%), Positives = 29/64 (45%), Gaps = 10/64 (15%)

Query: 33 KRKTQATTTTTPLPEDEEEDLEMTEAFEDVSEELSSTVASIKKEIAN-----ESMKIADK 87
           +KT ++     L   + + ++      D+ EE    V  +K+ I N     ++ KIADK
Sbjct: 31 AKKTDSSNVEVSLSAQQAKLMQPGS--SDIREEK---VEELKQAIENGEYKVDTEKIADK 85

Query: 88 VAEE 91
          + + 
Sbjct: 86 LLDF 89


>gnl|CDD|176049 cd08404, C2B_Synaptotagmin-4, C2 domain second repeat present in
           Synaptotagmin 4.  Synaptotagmin is a
           membrane-trafficking protein characterized by a
           N-terminal transmembrane region, a linker, and 2
           C-terminal C2 domains.  Synaptotagmin 4, a member of
           class 4 synaptotagmins, is located in the brain.  It
           functions are unknown. It, like synaptotagmin-11, has an
           Asp to Ser substitution in its C2A domain. Previously
           all synaptotagmins were thought to be calcium sensors in
           the regulation of neurotransmitter release and hormone
           secretion, but it has been shown that not all of them
           bind calcium.  Of the 17 identified synaptotagmins only
           8 bind calcium (1-3, 5-7, 9, 10).  The function of the
           two C2 domains that bind calcium are: regulating the
           fusion step of synaptic vesicle exocytosis (C2A) and
           binding to phosphatidyl-inositol-3,4,5-triphosphate
           (PIP3) in the absence of calcium ions and to
           phosphatidylinositol bisphosphate (PIP2) in their
           presence (C2B).  C2B also regulates also the recycling
           step of synaptic vesicles.  C2 domains fold into an
           8-standed beta-sandwich that can adopt 2 structural
           arrangements: Type I and Type II, distinguished by a
           circular permutation involving their N- and C-terminal
           beta strands. Many C2 domains are Ca2+-dependent
           membrane-targeting modules that bind a wide variety of
           substances including bind phospholipids, inositol
           polyphosphates, and intracellular proteins.  Most C2
           domain proteins are either signal transduction enzymes
           that contain a single C2 domain, such as protein kinase
           C, or membrane trafficking proteins which contain at
           least two C2 domains, such as synaptotagmin 1.  However,
           there are a few exceptions to this including RIM
           isoforms and some splice variants of piccolo/aczonin and
           intersectin which only have a single C2 domain.  C2
           domains with a calcium binding region have negatively
           charged residues, primarily aspartates, that serve as
           ligands for calcium ions. This cd contains the second C2
           repeat, C2B, and has a type-I topology.
          Length = 136

 Score = 25.9 bits (57), Expect = 7.9
 Identities = 13/61 (21%), Positives = 27/61 (44%), Gaps = 4/61 (6%)

Query: 112 VPYADAMNKTLVFAIFDFDRFSKHDQIGEVKVALCQIDLAQTIEEWRELQSVEGEGGQIG 171
           +P  +  + ++ F + D DR +K++ IG  ++ L           W+E+        QI 
Sbjct: 75  IPSEELEDISVEFLVLDSDRVTKNEVIG--RLVLGPKASGSGGHHWKEVC--NPPRRQIA 130

Query: 172 K 172
           +
Sbjct: 131 E 131


>gnl|CDD|176045 cd08400, C2_Ras_p21A1, C2 domain present in RAS p21 protein
           activator 1 (RasA1).  RasA1 is a GAP1 (GTPase activating
           protein 1), a Ras-specific GAP member, which suppresses
           Ras function by enhancing the GTPase activity of Ras
           proteins resulting in the inactive GDP-bound form of
           Ras.  In this way it can control cellular proliferation
           and differentiation.  RasA1 contains a C2 domain,  a
           Ras-GAP domain, a pleckstrin homology (PH)-like domain,
           a SH3 domain, and 2 SH2 domains. C2 domains fold into an
           8-standed beta-sandwich that can adopt 2 structural
           arrangements: Type I and Type II, distinguished by a
           circular permutation involving their N- and C-terminal
           beta strands. Many C2 domains are Ca2+-dependent
           membrane-targeting modules that bind a wide variety of
           substances including bind phospholipids, inositol
           polyphosphates, and intracellular proteins.  Most C2
           domain proteins are either signal transduction enzymes
           that contain a single C2 domain, such as protein kinase
           C, or membrane trafficking proteins which contain at
           least two C2 domains, such as synaptotagmin 1.  However,
           there are a few exceptions to this including RIM
           isoforms and some splice variants of piccolo/aczonin and
           intersectin which only have a single C2 domain.  C2
           domains with a calcium binding region have negatively
           charged residues, primarily aspartates, that serve as
           ligands for calcium ions. Members here have a type-I
           topology.
          Length = 126

 Score = 25.8 bits (57), Expect = 8.1
 Identities = 12/30 (40%), Positives = 16/30 (53%)

Query: 133 SKHDQIGEVKVALCQIDLAQTIEEWRELQS 162
           SK  +I EV V L ++   Q  +EW  L S
Sbjct: 75  SKDSEIAEVTVQLSKLQNGQETDEWYPLSS 104


>gnl|CDD|200586 cd10964, CE4_PgaB_5s, N-terminal putative catalytic polysaccharide
           deacetylase domain of bacterial
           poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB,
           and similar proteins.  This family is represented by an
           outer membrane lipoprotein,
           poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase
           (PgaB, EC 3.5.1.-), encoded by Escherichia coli pgaB
           gene from the pgaABCD (formerly ycdSRQP) operon, which
           affects biofilm development by promoting abiotic surface
           binding and intercellular adhesion. PgaB catalyzes the
           N-deacetylation of poly-beta-1,6-N-acetyl-D-glucosamine
           (PGA), a biofilm adhesin polysaccharide that stabilizes
           biofilms of E. coli and other bacteria. PgaB contains an
           N-terminal NodB homology domain with a 5-stranded
           beta/alpha barrel, and a C-terminal carbohydrate binding
           domain required for PGA N-deacetylation, which may be
           involved in binding to unmodified poly-beta-1,6-GlcNAc
           and assisting catalysis by the deacetylase domain. This
           family also includes several orthologs of PgaB, such as
           the hemin storage system HmsF protein, encoded by
           Yersinia pestis hmsF gene from the hmsHFRS operon, which
           is essential for Y. pestis biofilm formation. Like PgaB,
           HmsF is an outer membrane protein with an N-terminal
           NodB homology domain, which is likely involved in the
           modification of the exopolysaccharide (EPS) component of
           the biofilm. HmsF also has a conserved but
           uncharacterized C-terminal domain that is present in
           other HmsF-like proteins in Gram-negative bacteria. This
           alignment model corresponds to the N-terminal NodB
           homology domain.
          Length = 193

 Score = 26.2 bits (58), Expect = 8.2
 Identities = 10/32 (31%), Positives = 17/32 (53%)

Query: 69  TVASIKKEIANESMKIADKVAEETGMPPWVVV 100
           T A  ++ I N+  K +  + + TG  P V+V
Sbjct: 115 TDAEYRQRIRNDLKKSSALIKKHTGRAPRVMV 146


>gnl|CDD|220369 pfam09731, Mitofilin, Mitochondrial inner membrane protein.
           Mitofilin controls mitochondrial cristae morphology.
           Mitofilin is enriched in the narrow space between the
           inner boundary and the outer membranes, where it forms a
           homotypic interaction and assembles into a large
           multimeric protein complex. The first 78 amino acids
           contain a typical amino-terminal-cleavable mitochondrial
           presequence rich in positive-charged and hydroxylated
           residues and a membrane anchor domain. In addition, it
           has three centrally located coiled coil domains.
          Length = 493

 Score = 26.5 bits (59), Expect = 8.6
 Identities = 17/80 (21%), Positives = 33/80 (41%), Gaps = 9/80 (11%)

Query: 21  ASTLPPLVADSIKRKTQATTTTTPLPEDEEEDLEMTEAFEDV---------SEELSSTVA 71
            +T P  + + ++   +           +    E+   F D+          ++L S +A
Sbjct: 107 EATTPKSIQELVEALEELLEELLKETASDPVVQELVSIFNDLIDSIKEDNLKDDLESLIA 166

Query: 72  SIKKEIANESMKIADKVAEE 91
           S K+E+   S K+A+  AEE
Sbjct: 167 SAKEELDQLSKKLAELKAEE 186


>gnl|CDD|176395 cd01800, SF3a120_C, Ubiquitin-like domain of Mammalian splicing
          factor SF3a_120.  SF3a120_C  Mammalian splicing factor
          SF3a consists of three subunits of 60, 66, and 120 kDa
          and functions early during pre-mRNA splicing by
          converting the U2 snRNP to its active form.  The 120kDa
          subunit (SF3a120) has a carboxy-terminal ubiquitin-like
          domain and two SWAP (suppressor-of-white-apricot)
          domains, referred to collectively as the SURP module,
          at its amino-terminus.
          Length = 76

 Score = 25.1 bits (55), Expect = 9.3
 Identities = 11/37 (29%), Positives = 17/37 (45%), Gaps = 11/37 (29%)

Query: 60 EDVSEELSSTVASIKKEIANESMKIADKVAEETGMPP 96
           + + +LS  V+ +K            K+ EETGMP 
Sbjct: 10 LNFTLQLSDPVSVLKV-----------KIHEETGMPA 35


>gnl|CDD|222923 PHA02738, PHA02738, hypothetical protein; Provisional.
          Length = 320

 Score = 26.4 bits (58), Expect = 9.7
 Identities = 14/43 (32%), Positives = 23/43 (53%), Gaps = 6/43 (13%)

Query: 60  EDVSEELSS--TVASIKKEIANESMKIADKVAEETGMPPWVVV 100
           ++ SE L+    V   +KE+A ES++I     +    PP +VV
Sbjct: 194 KNTSEFLNFVLEVRQCQKELAQESLQIGHNRLQ----PPPIVV 232


  Database: CDD.v3.10
    Posted date:  Mar 20, 2013  7:55 AM
  Number of letters in database: 10,937,602
  Number of sequences in database:  44,354
  
Lambda     K      H
   0.313    0.130    0.358 

Gapped
Lambda     K      H
   0.267   0.0857    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 44354
Number of Hits to DB: 8,858,517
Number of extensions: 817234
Number of successful extensions: 1109
Number of sequences better than 10.0: 1
Number of HSP's gapped: 1107
Number of HSP's successfully gapped: 114
Length of query: 173
Length of database: 10,937,602
Length adjustment: 90
Effective length of query: 83
Effective length of database: 6,945,742
Effective search space: 576496586
Effective search space used: 576496586
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 55 (24.7 bits)