Query         psy12097
Match_columns 74
No_of_seqs    102 out of 842
Neff          8.1 
Searched_HMMs 46136
Date          Fri Aug 16 18:39:23 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy12097.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/12097hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG0099|consensus               99.9   6E-22 1.3E-26  130.2   5.4   74    1-74     95-168 (379)
  2 KOG0085|consensus               99.8 1.8E-20   4E-25  121.9   2.3   72    1-74     94-165 (359)
  3 KOG0082|consensus               99.8 3.1E-19 6.7E-24  120.5   4.3   71    2-74     89-161 (354)
  4 cd00066 G-alpha G protein alph  99.7 1.1E-16 2.5E-21  106.8   4.8   71    2-74     56-127 (317)
  5 smart00275 G_alpha G protein a  99.6 3.3E-16 7.2E-21  105.6   4.5   71    2-74     77-150 (342)
  6 PF00503 G-alpha:  G-protein al  99.4 1.1E-13 2.4E-18   94.3   1.6   63   12-74    129-201 (389)
  7 PRK04171 ribosome biogenesis p  60.3     7.8 0.00017   25.3   2.0   28   42-69     16-46  (222)
  8 PHA03260 Capsid triplex subuni  60.0      16 0.00034   25.1   3.4   26   32-57    255-280 (339)
  9 TIGR03793 TOMM_pelo TOMM prope  59.9      14 0.00029   20.2   2.6   17   38-54      7-23  (77)
 10 PF10664 NdhM:  Cyanobacterial   56.9     6.9 0.00015   22.7   1.2   16   44-59     38-53  (108)
 11 PF10142 PhoPQ_related:  PhoPQ-  53.4     7.1 0.00015   27.3   1.0   19   56-74    271-289 (367)
 12 KOG0930|consensus               47.1     4.1 8.9E-05   28.0  -0.9   20   52-72    275-294 (395)
 13 PF14834 GST_C_4:  Glutathione   46.0      27 0.00059   20.7   2.5   25   31-55     89-113 (117)
 14 PF11020 DUF2610:  Domain of un  42.5      27 0.00058   19.4   2.0   35   31-72     44-78  (82)
 15 PF02728 Cu_amine_oxidN3:  Copp  40.9      53  0.0012   18.3   3.2   24   35-58      6-29  (101)
 16 PF11748 DUF3306:  Protein of u  40.6      13 0.00027   21.8   0.6   18   33-50     77-95  (115)
 17 COG3226 Uncharacterized protei  40.0     5.5 0.00012   25.6  -1.1   37   37-74     18-58  (204)
 18 PF06757 Ins_allergen_rp:  Inse  37.9      55  0.0012   20.2   3.2   22   34-55    142-163 (179)
 19 KOG2883|consensus               37.1      31 0.00068   22.8   2.0   24   35-58    102-125 (253)
 20 PF08833 Axin_b-cat_bind:  Axin  32.0      28 0.00061   17.1   1.0   14   39-52     10-23  (45)
 21 PF03584 Herpes_ICP4_N:  Herpes  30.4      36 0.00077   21.5   1.4   18   39-56     24-41  (173)
 22 TIGR03795 chp_BMA0021 conserve  29.9      50  0.0011   19.4   1.9   23   33-55     13-35  (114)
 23 PF12399 BCA_ABC_TP_C:  Branche  29.9      50  0.0011   13.7   1.5   12   43-54     10-21  (23)
 24 COG4883 Uncharacterized protei  29.7      42 0.00092   23.6   1.8   32   37-69     10-41  (500)
 25 TIGR03512 GldD_lipo gliding mo  28.2      17 0.00037   23.2  -0.2   13   59-71    139-151 (186)
 26 PF00153 Mito_carr:  Mitochondr  27.4      49  0.0011   17.4   1.6   23   33-55     42-64  (95)
 27 TIGR03412 iscX_yfhJ FeS assemb  27.3 1.1E+02  0.0023   16.2   3.9   31   18-48     29-61  (63)
 28 PRK10721 hypothetical protein;  26.9 1.1E+02  0.0024   16.3   3.9   29   20-48     34-64  (66)
 29 PF07319 DnaI_N:  Primosomal pr  25.5 1.3E+02  0.0028   16.6   3.1   24   33-56     17-40  (94)
 30 cd04749 Commd1_MURR1 COMM_Doma  25.1      78  0.0017   20.0   2.3   27   32-58     74-102 (174)
 31 PF13186 SPASM:  Iron-sulfur cl  24.7      88  0.0019   15.0   2.1   17   39-55     34-50  (64)
 32 TIGR00828 EIID-AGA PTS system,  23.1      86  0.0019   21.1   2.3   30   32-61     31-62  (271)
 33 PF07750 GcrA:  GcrA cell cycle  21.0      81  0.0018   19.4   1.8   16   33-48      3-18  (162)
 34 PF08083 PROCN:  PROCN (NUC071)  20.6      20 0.00043   25.5  -1.1   40   33-73    154-193 (408)
 35 COG1756 Mra1 Uncharacterized c  20.5      92   0.002   20.5   2.0   17   42-58     17-33  (223)

No 1  
>KOG0099|consensus
Probab=99.86  E-value=6e-22  Score=130.23  Aligned_cols=74  Identities=61%  Similarity=1.154  Sum_probs=70.2

Q ss_pred             CCCCCCCCCCCCcccHHHHHHHhhhccCCCCCCCHHHHHHHHHhhCCHHHHHHHHhhcccccccchHHhhccCC
Q psy12097          1 MSQVNPPCTLEHPENQSRVDYIHNVASAHDFDYPPEFYDIAEELWKDKGVQACFERSNEYQLIDCAKYLVSLVK   74 (74)
Q Consensus         1 m~~l~~~i~~~~~~~~~~~~~i~~~~~~~~~~~~~~~~~~i~~LW~D~~iq~~~~r~~ef~L~Dsa~YFld~l~   74 (74)
                      |+.|.|.+++++++++..+++|+++....++.+|+|+.+.++.||+|.||+.||+|+|||||.|+|+||||+++
T Consensus        95 M~~l~p~v~l~~~~~~~~~dYIls~~~~~~~~~~~Ef~dHv~~lW~D~Gv~acyeRSnEyqLiDcAqYFLd~~~  168 (379)
T KOG0099|consen   95 MSNLVPPVELANPENQFRVDYILSVMNSPDFDYPPEFYDHVKTLWEDEGVRACYERSNEYQLIDCAQYFLDKID  168 (379)
T ss_pred             HhccCCCcccCCcccchhHHHHHhcCCCCcccCCHHHHHHHHHHhhhhhHHHHHhccCccchhhHHHHHHHhhh
Confidence            67888889999999999999999998888888999999999999999999999999999999999999999875


No 2  
>KOG0085|consensus
Probab=99.80  E-value=1.8e-20  Score=121.92  Aligned_cols=72  Identities=28%  Similarity=0.565  Sum_probs=64.8

Q ss_pred             CCCCCCCCCCCCcccHHHHHHHhhhccCCCCCCCHHHHHHHHHhhCCHHHHHHHHhhcccccccchHHhhccCC
Q psy12097          1 MSQVNPPCTLEHPENQSRVDYIHNVASAHDFDYPPEFYDIAEELWKDKGVQACFERSNEYQLIDCAKYLVSLVK   74 (74)
Q Consensus         1 m~~l~~~i~~~~~~~~~~~~~i~~~~~~~~~~~~~~~~~~i~~LW~D~~iq~~~~r~~ef~L~Dsa~YFld~l~   74 (74)
                      |++|  .|++..++|+.++..++......-..|...++.+|+.||.|||||+||+||+||||.|||+||++++|
T Consensus        94 MetL--~I~y~~e~nk~~A~~vrevd~ekVttfe~~yv~aik~LW~D~GIqeCYdRRREyqLsDSakYylsdld  165 (359)
T KOG0085|consen   94 METL--KIPYKREENKAHASLVREVDVEKVTTFEKRYVSAIKWLWRDPGIQECYDRRREYQLSDSAKYYLSDLD  165 (359)
T ss_pred             HHHh--ccccccccchhhhhHhhhcchHHhhhhhHHHHHHHHHHHhCcchHHHHHHHHHhhcchhhhHHhhhhh
Confidence            6789  99999999999999998765443346889999999999999999999999999999999999999875


No 3  
>KOG0082|consensus
Probab=99.77  E-value=3.1e-19  Score=120.53  Aligned_cols=71  Identities=35%  Similarity=0.666  Sum_probs=61.7

Q ss_pred             CCCCCCCCCCCcccHHHHHHHhhhccCC-C-CCCCHHHHHHHHHhhCCHHHHHHHHhhcccccccchHHhhccCC
Q psy12097          2 SQVNPPCTLEHPENQSRVDYIHNVASAH-D-FDYPPEFYDIAEELWKDKGVQACFERSNEYQLIDCAKYLVSLVK   74 (74)
Q Consensus         2 ~~l~~~i~~~~~~~~~~~~~i~~~~~~~-~-~~~~~~~~~~i~~LW~D~~iq~~~~r~~ef~L~Dsa~YFld~l~   74 (74)
                      ..+  ++++.+|.++.++..++...... + .+++++++++|++||+||+||+||+||++|+|+|||+|||++|+
T Consensus        89 ~~~--~i~~~~~~~~~d~~~~~~~~~~~~~~~~~~~e~~~~i~~lW~d~~Iq~~~~r~~e~~l~Dsa~Yfl~~l~  161 (354)
T KOG0082|consen   89 ETL--GINLDDPERENDAQKLTLLADAAEELGVFSPELAEAIKELWKDPGIQACYERRREFQLNDSAKYFLENLD  161 (354)
T ss_pred             HHh--cCCCCChhhhhHHHHHHHhhhcccccccCCHHHHHHHHHHHcCHHHHHHHHcCCcCCCCccHHHHHHhHH
Confidence            456  89999998888888887554333 2 46999999999999999999999999999999999999999975


No 4  
>cd00066 G-alpha G protein alpha subunit.  The alpha subunit of G proteins contains the guanine nucleotide binding site. The heterotrimeric GNP-binding proteins are signal transducers that communicate signals from many hormones, neurotransmitters, chemokines, and autocrine and paracrine factors. Extracellular signals are received by receptors, which activate the G proteins, which in turn route the signals to several distinct intracellular signaling pathways. The alpha subunit of G proteins is a weak GTPase. In the resting state, heterotrimeric G proteins are associated at the cytosolic face of the plasma membrane and the alpha subunit binds to GDP. Upon activation by a receptor GDP is replaced with GTP, and the G-alpha/GTP complex dissociates from the beta and gamma subunits. This results in activation of downstream signaling pathways, such as cAMP synthesis by adenylyl cyclase, which is terminated when GTP is hydrolized and the heterotrimers reconstitute.
Probab=99.66  E-value=1.1e-16  Score=106.77  Aligned_cols=71  Identities=37%  Similarity=0.711  Sum_probs=61.3

Q ss_pred             CCCCCCCCCCCcccHHHHHHHhhhccC-CCCCCCHHHHHHHHHhhCCHHHHHHHHhhcccccccchHHhhccCC
Q psy12097          2 SQVNPPCTLEHPENQSRVDYIHNVASA-HDFDYPPEFYDIAEELWKDKGVQACFERSNEYQLIDCAKYLVSLVK   74 (74)
Q Consensus         2 ~~l~~~i~~~~~~~~~~~~~i~~~~~~-~~~~~~~~~~~~i~~LW~D~~iq~~~~r~~ef~L~Dsa~YFld~l~   74 (74)
                      +.+  ++++.+++++..++.+...... ....+++++++.|.+||+|++||+||.||++|+|+||++|||++++
T Consensus        56 ~~~--~i~~~~~~~~~~~~~i~~~~~~~~~~~~~~~~~~~i~~lW~d~~iq~~~~~r~e~~l~d~~~yf~~~~~  127 (317)
T cd00066          56 ERL--NIPFGDPENEKDAKKILSFAPELEEGELPPELAEAIKELWKDPGIQACYDRRNEFQLNDSAKYFLDNLD  127 (317)
T ss_pred             HHc--CCCCCChhhHHHHHHHHhccccccccCCCHHHHHHHHHHhCCHHHHHHHHhccccccccchHHHHHhHH
Confidence            456  7888989988888888766543 2346999999999999999999999999999999999999999874


No 5  
>smart00275 G_alpha G protein alpha subunit. Subunit of G proteins that contains the guanine nucleotide binding site
Probab=99.63  E-value=3.3e-16  Score=105.59  Aligned_cols=71  Identities=30%  Similarity=0.578  Sum_probs=59.3

Q ss_pred             CCCCCCCCCCCcccHHHHHHHhhhcc---CCCCCCCHHHHHHHHHhhCCHHHHHHHHhhcccccccchHHhhccCC
Q psy12097          2 SQVNPPCTLEHPENQSRVDYIHNVAS---AHDFDYPPEFYDIAEELWKDKGVQACFERSNEYQLIDCAKYLVSLVK   74 (74)
Q Consensus         2 ~~l~~~i~~~~~~~~~~~~~i~~~~~---~~~~~~~~~~~~~i~~LW~D~~iq~~~~r~~ef~L~Dsa~YFld~l~   74 (74)
                      +.+  +|+++++.+...+..+.....   ..+..+++++++.|+.||+||+||+||.||++|+|+||+.|||++++
T Consensus        77 ~~~--~i~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~e~~~~i~~LW~D~~iq~~~~~~~~~~l~ds~~yf~~~~~  150 (342)
T smart00275       77 EEL--NIPFEDPESILDIRIITEQFNKTDETENVLPKEIAKAIKALWKDEGIQECYRRRNEFQLNDSASYFLDNID  150 (342)
T ss_pred             HHc--CCCCCChhhHHHHHHHhccccccccccccCCHHHHHHHHHHHCCHHHHHHHHhccccccccchhHHHHHHH
Confidence            456  899998888777777766531   11235899999999999999999999999999999999999999864


No 6  
>PF00503 G-alpha:  G-protein alpha subunit;  InterPro: IPR001019 Guanine nucleotide binding proteins (G proteins) are membrane-associated, heterotrimeric proteins composed of three subunits: alpha (IPR001019 from INTERPRO), beta (IPR001632 from INTERPRO) and gamma (IPR001770 from INTERPRO) []. G proteins and their receptors (GPCRs) form one of the most prevalent signalling systems in mammalian cells, regulating systems as diverse as sensory perception, cell growth and hormonal regulation []. At the cell surface, the binding of ligands such as hormones and neurotransmitters to a GPCR activates the receptor by causing a conformational change, which in turn activates the bound G protein on the intracellular-side of the membrane. The activated receptor promotes the exchange of bound GDP for GTP on the G protein alpha subunit. GTP binding changes the conformation of switch regions within the alpha subunit, which allows the bound trimeric G protein (inactive) to be released from the receptor, and to dissociate into active alpha subunit (GTP-bound) and beta/gamma dimer. The alpha subunit and the beta/gamma dimer go on to activate distinct downstream effectors, such as adenylyl cyclase, phosphodiesterases, phospholipase C, and ion channels. These effectors in turn regulate the intracellular concentrations of secondary messengers, such as cAMP, diacylglycerol, sodium or calcium cations, which ultimately lead to a physiological response, usually via the downstream regulation of gene transcription. The cycle is completed by the hydrolysis of alpha subunit-bound GTP to GDP, resulting in the re-association of the alpha and beta/gamma subunits and their binding to the receptor, which terminates the signal []. The length of the G protein signal is controlled by the duration of the GTP-bound alpha subunit, which can be regulated by RGS (regulator of G protein signalling) proteins (IPR000342 from INTERPRO) or by covalent modifications []. There are several isoforms of each subunit, many of which have splice variants, which together can make up hundreds of combinations of G proteins. The specific combination of subunits in heterotrimeric G proteins affects not only which receptor it can bind to, but also which downstream target is affected, providing the means to target specific physiological processes in response to specific external stimuli [, ]. G proteins carry lipid modifications on one or more of their subunits to target them to the plasma membrane and to contribute to protein interactions. This family consists of the G protein alpha subunit, which acts as a weak GTPase. G protein classes are defined based on the sequence and function of their alpha subunits, which in mammals fall into four main categories: G(S)alpha, G(Q)alpha, G(I)alpha and G(12)alpha; there are also fungal and plant classes of alpha subunits. The alpha subunit consists of two domains: a GTP-binding domain and a helical insertion domain (IPR011025 from INTERPRO). The GTP-binding domain is homologous to Ras-like small GTPases, and includes switch regions I and II, which change conformation during activation. The switch regions are loops of alpha-helices with conformations sensitive to guanine nucleotides. The helical insertion domain is inserted into the GTP-binding domain before switch region I and is unique to heterotrimeric G proteins. This helical insertion domain functions to sequester the guanine nucleotide at the interface with the GTP-binding domain and must be displaced to enable nucleotide dissociation.; GO: 0004871 signal transducer activity, 0019001 guanyl nucleotide binding, 0007186 G-protein coupled receptor protein signaling pathway; PDB: 3QI2_B 3QE0_A 2IK8_A 2OM2_A 2GTP_B 2XNS_B 3ONW_B 1KJY_A 2EBC_A 1Y3A_B ....
Probab=99.39  E-value=1.1e-13  Score=94.26  Aligned_cols=63  Identities=38%  Similarity=0.691  Sum_probs=49.7

Q ss_pred             CcccHHHHHHHhhhccCCCC----------CCCHHHHHHHHHhhCCHHHHHHHHhhcccccccchHHhhccCC
Q psy12097         12 HPENQSRVDYIHNVASAHDF----------DYPPEFYDIAEELWKDKGVQACFERSNEYQLIDCAKYLVSLVK   74 (74)
Q Consensus        12 ~~~~~~~~~~i~~~~~~~~~----------~~~~~~~~~i~~LW~D~~iq~~~~r~~ef~L~Dsa~YFld~l~   74 (74)
                      ++.++..+..+.........          .+++++++.|..||+|++||+||.++++|+|+|++.|||++++
T Consensus       129 ~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~~LW~D~~vq~~~~~~~~~~l~d~~~YFl~~l~  201 (389)
T PF00503_consen  129 NEENQEIAEKLKEILDPLDSSEFSLASDDNKFPEELAEDIRSLWKDPGVQECYERRNEFQLPDNAKYFLDNLD  201 (389)
T ss_dssp             STTHHHHHHHHHHHHCTTSTTCTC-----HCHHHHHHHHHHHHHHSHHHHHHHGGGGGST--TTHHHHHTTHH
T ss_pred             CHHHHHHHHHHHhhhccccccccccccccccCCHHHHHHHHHHHCChhHHHHHHhhhcccccccHHHHhhhhh
Confidence            56777777777655432221          3788999999999999999999999999999999999999864


No 7  
>PRK04171 ribosome biogenesis protein; Provisional
Probab=60.30  E-value=7.8  Score=25.31  Aligned_cols=28  Identities=21%  Similarity=0.367  Sum_probs=20.4

Q ss_pred             HHhhCCHHHHHHHHhhcc---cccccchHHh
Q psy12097         42 EELWKDKGVQACFERSNE---YQLIDCAKYL   69 (74)
Q Consensus        42 ~~LW~D~~iq~~~~r~~e---f~L~Dsa~YF   69 (74)
                      +++|++|+|.+--+||+.   .+|.|+..++
T Consensus        16 ~ei~~hp~v~~~a~rr~K~p~~~LLd~~~H~   46 (222)
T PRK04171         16 REIWNHPAVVKNARRRGKKPEEMLLDSSLHY   46 (222)
T ss_pred             HHHhcCcHHHhhHHHcCCChhhhccChHHHH
Confidence            357999999887776663   4588886654


No 8  
>PHA03260 Capsid triplex subunit 2; Provisional
Probab=60.03  E-value=16  Score=25.06  Aligned_cols=26  Identities=15%  Similarity=0.134  Sum_probs=22.0

Q ss_pred             CCCHHHHHHHHHhhCCHHHHHHHHhh
Q psy12097         32 DYPPEFYDIAEELWKDKGVQACFERS   57 (74)
Q Consensus        32 ~~~~~~~~~i~~LW~D~~iq~~~~r~   57 (74)
                      ...|.....|+-||+|+.++..|-.+
T Consensus       255 n~dP~tL~ei~~lw~d~~vadLf~Dg  280 (339)
T PHA03260        255 NAEPPSLDEMKGLIADAKLKMLMCDG  280 (339)
T ss_pred             CCCchHHHHHHHHhcCHHHHHHHHHH
Confidence            56788899999999999999888543


No 9  
>TIGR03793 TOMM_pelo TOMM propeptide domain. This model represents a domain that is conserved among a large number of putative thiazole/oxazole-modified microcins (TOMM). Oddly, most of this seqence region appears homologous to nitrile hydratase subunits. This family is expanded especially in Pelotomaculum thermopropionicum SI.
Probab=59.85  E-value=14  Score=20.18  Aligned_cols=17  Identities=18%  Similarity=0.524  Sum_probs=14.5

Q ss_pred             HHHHHHhhCCHHHHHHH
Q psy12097         38 YDIAEELWKDKGVQACF   54 (74)
Q Consensus        38 ~~~i~~LW~D~~iq~~~   54 (74)
                      +..|.+.|+|+..++.+
T Consensus         7 a~ivarAw~Dp~Fr~~L   23 (77)
T TIGR03793         7 EKIIAKAWEDEAFKQAL   23 (77)
T ss_pred             HHHHHHHHcCHHHHHHH
Confidence            56789999999998865


No 10 
>PF10664 NdhM:  Cyanobacterial and plastid NDH-1 subunit M;  InterPro: IPR018922 The NADH dehydrogenase I complex shuttles electrons from an unknown electron donor, via FMN and iron-sulphur (Fe-S) centres, to quinones in the respiratory and/or the photosynthetic chain. The immediate electron acceptor for the enzyme in plants is believed to be plastoquinone. The NADH dehydrogenase I complex couples the redox reaction to proton translocation, and thus conserves the redox energy in a proton gradient. This entry represents subunit M of the NADH dehydrogenase I complex in cyanobacteria and plant chloroplasts []. ; GO: 0016655 oxidoreductase activity, acting on NADH or NADPH, quinone or similar compound as acceptor, 0055114 oxidation-reduction process
Probab=56.90  E-value=6.9  Score=22.67  Aligned_cols=16  Identities=19%  Similarity=0.661  Sum_probs=13.2

Q ss_pred             hhCCHHHHHHHHhhcc
Q psy12097         44 LWKDKGVQACFERSNE   59 (74)
Q Consensus        44 LW~D~~iq~~~~r~~e   59 (74)
                      +|.|.++|++|++=.|
T Consensus        38 ~W~~~~l~kVy~~F~e   53 (108)
T PF10664_consen   38 NWNEEALQKVYRKFDE   53 (108)
T ss_pred             ccCHHHHHHHHHHHHH
Confidence            6999999999987444


No 11 
>PF10142 PhoPQ_related:  PhoPQ-activated pathogenicity-related protein;  InterPro: IPR009199 Proteins in this entry are believed to play a role in virulence/pathogenicity in Salmonella. Salmonella typhi PqaA has been shown to be activated by PhoP/Q two-component regulatory system, which regulates many virulence genes []. It has been also shown to confer resistance to antimicrobial peptides (melittin) []. Members of this family are predicted to belong to the alpha/beta hydrolase domain superfamily.
Probab=53.36  E-value=7.1  Score=27.27  Aligned_cols=19  Identities=11%  Similarity=0.317  Sum_probs=15.9

Q ss_pred             hhcccccccchHHhhccCC
Q psy12097         56 RSNEYQLIDCAKYLVSLVK   74 (74)
Q Consensus        56 r~~ef~L~Dsa~YFld~l~   74 (74)
                      -+-||.++|++.||++.|+
T Consensus       271 tgDeFf~pD~~~~y~d~L~  289 (367)
T PF10142_consen  271 TGDEFFVPDSSNFYYDKLP  289 (367)
T ss_pred             CCCceeccCchHHHHhhCC
Confidence            3457999999999999874


No 12 
>KOG0930|consensus
Probab=47.14  E-value=4.1  Score=27.99  Aligned_cols=20  Identities=20%  Similarity=0.348  Sum_probs=16.5

Q ss_pred             HHHHhhcccccccchHHhhcc
Q psy12097         52 ACFERSNEYQLIDCAKYLVSL   72 (74)
Q Consensus        52 ~~~~r~~ef~L~Dsa~YFld~   72 (74)
                      ++|.||. |-|.|+|-|||+-
T Consensus       275 ktWKrRW-FiLtdNCLYYFe~  294 (395)
T KOG0930|consen  275 KTWKRRW-FILTDNCLYYFEY  294 (395)
T ss_pred             cchhhee-EEeecceeeeeee
Confidence            5677766 9999999999973


No 13 
>PF14834 GST_C_4:  Glutathione S-transferase, C-terminal domain; PDB: 3BBY_A.
Probab=46.00  E-value=27  Score=20.65  Aligned_cols=25  Identities=28%  Similarity=0.421  Sum_probs=17.9

Q ss_pred             CCCCHHHHHHHHHhhCCHHHHHHHH
Q psy12097         31 FDYPPEFYDIAEELWKDKGVQACFE   55 (74)
Q Consensus        31 ~~~~~~~~~~i~~LW~D~~iq~~~~   55 (74)
                      .++|+....-....|+.|+||+=..
T Consensus        89 d~vP~~l~~Ya~~qwqrpsVQ~Wla  113 (117)
T PF14834_consen   89 DPVPERLADYAERQWQRPSVQRWLA  113 (117)
T ss_dssp             ----HHHHHHHHHHHT-HHHHHHHH
T ss_pred             CCCCHHHHHHHHHHHCCHHHHHHHH
Confidence            4789999999999999999998654


No 14 
>PF11020 DUF2610:  Domain of unknown function (DUF2610);  InterPro: IPR021277  This family is conserved in Proteobacteria. One member is annotated as being elongation factor P but this could not be confirmed. 
Probab=42.52  E-value=27  Score=19.37  Aligned_cols=35  Identities=17%  Similarity=0.346  Sum_probs=27.0

Q ss_pred             CCCCHHHHHHHHHhhCCHHHHHHHHhhcccccccchHHhhcc
Q psy12097         31 FDYPPEFYDIAEELWKDKGVQACFERSNEYQLIDCAKYLVSL   72 (74)
Q Consensus        31 ~~~~~~~~~~i~~LW~D~~iq~~~~r~~ef~L~Dsa~YFld~   72 (74)
                      +..|.++.+++.+|.+       +++.|..-+.|-+.|+|..
T Consensus        44 G~IP~~V~~sl~kL~~-------La~~N~v~feeLc~YAL~~   78 (82)
T PF11020_consen   44 GQIPEKVMDSLSKLYK-------LAKENNVSFEELCVYALGV   78 (82)
T ss_pred             CCCCHHHHHHHHHHHH-------HHHHcCCCHHHHHHHHHHH
Confidence            4689999999877754       4566777788999999864


No 15 
>PF02728 Cu_amine_oxidN3:  Copper amine oxidase, N3 domain;  InterPro: IPR015802 Amine oxidases (AO) are enzymes that catalyse the oxidation of a wide range of biogenic amines including many neurotransmitters, histamine and xenobiotic amines. There are two classes of amine oxidases: flavin-containing (1.4.3.4 from EC) and copper-containing (1.4.3.6 from EC). Copper-containing AO act as a disulphide-linked homodimer. They catalyse the oxidation of primary amines to aldehydes, with the subsequent release of ammonia and hydrogen peroxide, which requires one copper ion per subunit and topaquinone as cofactor []: RCH2NH2 + H2O + O2 = RCHO + NH3 + H2O2   Copper-containing amine oxidases are found in bacteria, fungi, plants and animals. In prokaryotes, the enzyme enables various amine substrates to be used as sources of carbon and nitrogen [, ]. In eukaryotes they have a broader range of functions, including cell differentiation and growth, wound healing, detoxification and cell signalling []. The copper amine oxidases occur as mushroom-shaped homodimers of 70-95 kDa, each monomer containing a copper ion and a covalently bound redox cofactor, topaquinone (TPQ). TPQ is formed by post-translational modification of a conserved tyrosine residue. The copper ion is coordinated with three histidine residues and two water molecules in a distorted square pyramidal geometry, and has a dual function in catalysis and TPQ biogenesis. The catalytic domain is the largest of the 3-4 domains found in copper amine oxidases, and consists of a beta sandwich of 18 strands in two sheets. The active site is buried and requires a conformational change to allow the substrate access. The two N-terminal domains share a common structural fold, its core consisting of a five-stranded antiparallel beta sheet twisted around an alpha helix. The D1 domains from the two subunits comprise the stalk, of the mushroom-shaped dimer, and interact with each other but do not pack tightly against each other [, ].  This entry represents one (N3) of the two N-terminal domains (N2/N3) that share a similar structure.; GO: 0005507 copper ion binding, 0008131 primary amine oxidase activity, 0048038 quinone binding, 0009308 amine metabolic process, 0055114 oxidation-reduction process; PDB: 1TU5_A 2PNC_B 3MPH_B 3HII_B 3HI7_A 3K5T_A 3HIG_A 1SPU_A 2WGQ_A 2WO0_A ....
Probab=40.91  E-value=53  Score=18.27  Aligned_cols=24  Identities=25%  Similarity=0.331  Sum_probs=20.5

Q ss_pred             HHHHHHHHHhhCCHHHHHHHHhhc
Q psy12097         35 PEFYDIAEELWKDKGVQACFERSN   58 (74)
Q Consensus        35 ~~~~~~i~~LW~D~~iq~~~~r~~   58 (74)
                      .|+..+-+.+.+||.+|++.++|.
T Consensus         6 ~E~~~~~~~~~~~p~~~~al~~rg   29 (101)
T PF02728_consen    6 EEFAEAEEIVKADPEFQAALKKRG   29 (101)
T ss_dssp             HHHHHHHHHHHTGHHHHHHHHHTT
T ss_pred             HHHHHHHHHHHHCHHHHHHHHHhC
Confidence            577777788889999999999876


No 16 
>PF11748 DUF3306:  Protein of unknown function (DUF3306);  InterPro: IPR021735  This family of proteobacterial species proteins has no known function. 
Probab=40.55  E-value=13  Score=21.75  Aligned_cols=18  Identities=22%  Similarity=0.370  Sum_probs=12.5

Q ss_pred             CCHHHH-HHHHHhhCCHHH
Q psy12097         33 YPPEFY-DIAEELWKDKGV   50 (74)
Q Consensus        33 ~~~~~~-~~i~~LW~D~~i   50 (74)
                      .++.+- .++++||.||.+
T Consensus        77 V~~~lk~aALRkLf~~p~f   95 (115)
T PF11748_consen   77 VPEELKRAALRKLFSDPEF   95 (115)
T ss_pred             CCHHHHHHHHHHHHcCccc
Confidence            344333 489999998875


No 17 
>COG3226 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=39.99  E-value=5.5  Score=25.59  Aligned_cols=37  Identities=27%  Similarity=0.314  Sum_probs=19.8

Q ss_pred             HHHHHHHhhCCHHHHHHHHhhc---cccc-ccchHHhhccCC
Q psy12097         37 FYDIAEELWKDKGVQACFERSN---EYQL-IDCAKYLVSLVK   74 (74)
Q Consensus        37 ~~~~i~~LW~D~~iq~~~~r~~---ef~L-~Dsa~YFld~l~   74 (74)
                      +.++--++-+--||.. ...|.   +-++ .-|+.|||++||
T Consensus        18 Iv~Aa~eli~~~Gv~a-V~HR~VAa~A~vPLgStTYYF~~lD   58 (204)
T COG3226          18 IVQAALELIKRYGVHA-VRHRAVAAEAGVPLGSTTYYFSDLD   58 (204)
T ss_pred             HHHHHHHHHHhcchhh-hhHHHHHHHhCCCccceeeecccHH
Confidence            3444445555556533 22222   2333 257889998875


No 18 
>PF06757 Ins_allergen_rp:  Insect allergen related repeat, nitrile-specifier detoxification;  InterPro: IPR010629 This entry represents several insect specific allergen repeats. These repeats are commonly found in various proteins from cockroaches, fruit flies and mosquitos. It has been suggested that the repeat sequences have evolved by duplication of an ancestral amino acid domain, which may have arisen from the mitochondrial energy transfer proteins [].  This family exemplifies a case of novel gene evolution. The case in point is the arms-race between plants and their infective insective herbivores in the area of the glucosinolate-myrosinase system. Brassicas have developed the glucosinolate-myrosinase system as chemical defence mechanism against the insects, and consequently the insects have adapted to produce a detoxifying molecule, nitrile-specifier protein (NSP). NSP is present in the Pieris rapae (Cabbage white butterfly). NSP is structurally different from and has no amino acid homology to any known detoxifying enzymes, and it appears to have arisen by a process of domain and gene duplication of a sequence of unknown function that is widespread in insect species and referred to as insect-allergen-repeat protein. Thus this family is found either as a single domain or as a multiple repeat-domain []. 
Probab=37.89  E-value=55  Score=20.18  Aligned_cols=22  Identities=27%  Similarity=0.603  Sum_probs=19.7

Q ss_pred             CHHHHHHHHHhhCCHHHHHHHH
Q psy12097         34 PPEFYDIAEELWKDKGVQACFE   55 (74)
Q Consensus        34 ~~~~~~~i~~LW~D~~iq~~~~   55 (74)
                      +++..+.+.++|..+.+|....
T Consensus       142 S~ef~~~~~~~~~~~~~~~~~~  163 (179)
T PF06757_consen  142 SPEFQQLYNALWASPEFQRLLN  163 (179)
T ss_pred             CHHHHHHHHHHHcCHHHHHHHH
Confidence            5778889999999999999986


No 19 
>KOG2883|consensus
Probab=37.11  E-value=31  Score=22.83  Aligned_cols=24  Identities=13%  Similarity=-0.010  Sum_probs=19.4

Q ss_pred             HHHHHHHHHhhCCHHHHHHHHhhc
Q psy12097         35 PEFYDIAEELWKDKGVQACFERSN   58 (74)
Q Consensus        35 ~~~~~~i~~LW~D~~iq~~~~r~~   58 (74)
                      +.+.+.+++||+|++.++.-.-++
T Consensus       102 ~~~~e~~~~l~n~ke~le~~~~rs  125 (253)
T KOG2883|consen  102 EHRDEVRKALANDKEYLEQSIERS  125 (253)
T ss_pred             chHHHHHHHHhcCHHHHHHHhHHH
Confidence            568899999999999988764444


No 20 
>PF08833 Axin_b-cat_bind:  Axin beta-catenin binding domain;  InterPro: IPR014936 Proteins in this entry are found on the scaffolding protein Axin which is a component of the beta-catenin destruction complex. It competes with the tumour suppressor adenomatous polyposis coli protein (APC) for binding to beta-catenin []. ; PDB: 1QZ7_B.
Probab=31.97  E-value=28  Score=17.13  Aligned_cols=14  Identities=29%  Similarity=0.755  Sum_probs=4.9

Q ss_pred             HHHHHhhCCHHHHH
Q psy12097         39 DIAEELWKDKGVQA   52 (74)
Q Consensus        39 ~~i~~LW~D~~iq~   52 (74)
                      +-+.++|++||-+.
T Consensus        10 ~HvsRV~rtPg~~S   23 (45)
T PF08833_consen   10 DHVSRVWRTPGCQS   23 (45)
T ss_dssp             HHHHHH--------
T ss_pred             HHHHHHhcCCCCCC
Confidence            57889999998764


No 21 
>PF03584 Herpes_ICP4_N:  Herpesvirus ICP4-like protein N-terminal region;  InterPro: IPR005206 The immediate-early protein ICP4 (infected-cell polypeptide 4) is required for efficient transcription of early and late viral genes and is thus essential for productive infection. ICP4 is a large phosphoprotein that binds DNA in a sequence specific manner as a homodimer. ICP4 represses transcription from LAT, ICP4 and ORF-P that have high-affinity a ICP4 binding site that spans the transcription initiation site. ICP4 proteins have two highly conserved regions, this family contains the N-terminal region that contains sites for DNA binding and homodimerisation [].; GO: 0045893 positive regulation of transcription, DNA-dependent, 0042025 host cell nucleus
Probab=30.39  E-value=36  Score=21.47  Aligned_cols=18  Identities=33%  Similarity=0.571  Sum_probs=14.4

Q ss_pred             HHHHHhhCCHHHHHHHHh
Q psy12097         39 DIAEELWKDKGVQACFER   56 (74)
Q Consensus        39 ~~i~~LW~D~~iq~~~~r   56 (74)
                      +.-..||.||.|+++-+|
T Consensus        24 d~R~gLwd~peV~~A~~r   41 (173)
T PF03584_consen   24 DSRPGLWDDPEVREAAAR   41 (173)
T ss_pred             CCCccccCCHHHHHHHHH
Confidence            345678999999998765


No 22 
>TIGR03795 chp_BMA0021 conserved hypothetical protein, BMA_0021 family. Members of this protein family are found sparsely, mostly in members of the genus Burkholderia. Members often occur as tandem homologous genes, such as BMA_0021 and BMA_0022 in Burkholderia mallei ATCC 23344. The genes regularly are encoded near the so-called docking protein of TOMM (thiazole/oxazole-modified microcins) biosynthetic clusters, suggesting a role in bacteriocin biosynthesis. The function is unknown.
Probab=29.88  E-value=50  Score=19.44  Aligned_cols=23  Identities=4%  Similarity=0.193  Sum_probs=18.4

Q ss_pred             CCHHHHHHHHHhhCCHHHHHHHH
Q psy12097         33 YPPEFYDIAEELWKDKGVQACFE   55 (74)
Q Consensus        33 ~~~~~~~~i~~LW~D~~iq~~~~   55 (74)
                      |-..++.+|..-|+|+..+.-+.
T Consensus        13 f~~v~lraIA~AW~DpaFr~eLl   35 (114)
T TIGR03795        13 FRAVYLRAIALAWHSPEFKDELL   35 (114)
T ss_pred             HHHHHHHHHHHHhCCHHHHHHHH
Confidence            55668899999999999876553


No 23 
>PF12399 BCA_ABC_TP_C:  Branched-chain amino acid ATP-binding cassette transporter
Probab=29.85  E-value=50  Score=13.73  Aligned_cols=12  Identities=17%  Similarity=0.437  Sum_probs=8.3

Q ss_pred             HhhCCHHHHHHH
Q psy12097         43 ELWKDKGVQACF   54 (74)
Q Consensus        43 ~LW~D~~iq~~~   54 (74)
                      .+=+||.|+++|
T Consensus        10 ~i~~n~~V~~aY   21 (23)
T PF12399_consen   10 EIRANPEVREAY   21 (23)
T ss_pred             HHhcCHHHHHhh
Confidence            345678888776


No 24 
>COG4883 Uncharacterized protein conserved in archaea [Function unknown]
Probab=29.73  E-value=42  Score=23.61  Aligned_cols=32  Identities=22%  Similarity=0.351  Sum_probs=24.3

Q ss_pred             HHHHHHHhhCCHHHHHHHHhhcccccccchHHh
Q psy12097         37 FYDIAEELWKDKGVQACFERSNEYQLIDCAKYL   69 (74)
Q Consensus        37 ~~~~i~~LW~D~~iq~~~~r~~ef~L~Dsa~YF   69 (74)
                      +-+++-+-|.|-++-+ -.|+.||.+.|..+|-
T Consensus        10 vkeam~aqkadv~vik-kkrgkefki~d~kpyv   41 (500)
T COG4883          10 VKEAMGAQKADVGVIK-KKRGKEFKITDAKPYV   41 (500)
T ss_pred             HHHHHhhhhhhhhhHh-hccCCeeeeccchhHH
Confidence            3467888899988643 2588899999998873


No 25 
>TIGR03512 GldD_lipo gliding motility-associated lipoprotein GldD. Members of this protein family are found a number of Bacteriodetes lineage bacteria, including both species such as Flavobacterium johnsoniae, which possess a poorly understood form of rapid gliding motility, and other species which apparently do not. Mutation of GldD blocks both this motility and chitin utilization in the model species, Flavobacterium johnsoniae.
Probab=28.20  E-value=17  Score=23.18  Aligned_cols=13  Identities=15%  Similarity=0.419  Sum_probs=11.1

Q ss_pred             ccccccchHHhhc
Q psy12097         59 EYQLIDCAKYLVS   71 (74)
Q Consensus        59 ef~L~Dsa~YFld   71 (74)
                      .|.+.||+.+|+.
T Consensus       139 QFy~TDSt~HFl~  151 (186)
T TIGR03512       139 QFYVTDSTKHFLR  151 (186)
T ss_pred             eEEEeccccceee
Confidence            3899999999985


No 26 
>PF00153 Mito_carr:  Mitochondrial carrier protein;  InterPro: IPR018108 A variety of substrate carrier proteins that are involved in energy transfer are found in the inner mitochondrial membrane or integral to the membrane of other eukaryotic organelles such as the peroxisome [, , , , , ]. Such proteins include: ADP, ATP carrier protein (ADP/ATP translocase); 2-oxoglutarate/malate carrier protein; phosphate carrier protein; tricarboxylate transport protein (or citrate transport protein); Graves disease carrier protein; yeast mitochondrial proteins MRS3 and MRS4; yeast mitochondrial FAD carrier protein; and many others. Structurally, these proteins can consist of up to three tandem repeats of a domain of approximately 100 residues, each domain containing two transmembrane regions.; PDB: 2LCK_A 2C3E_A 1OKC_A.
Probab=27.38  E-value=49  Score=17.41  Aligned_cols=23  Identities=9%  Similarity=0.391  Sum_probs=18.0

Q ss_pred             CCHHHHHHHHHhhCCHHHHHHHH
Q psy12097         33 YPPEFYDIAEELWKDKGVQACFE   55 (74)
Q Consensus        33 ~~~~~~~~i~~LW~D~~iq~~~~   55 (74)
                      -.......++.+|+..|++..|+
T Consensus        42 ~~~~~~~~~~~i~~~~G~~~ly~   64 (95)
T PF00153_consen   42 PYQGVWQCLRKIYKEEGIRGLYR   64 (95)
T ss_dssp             S-SSHHHHHHHHHHHHHHHHHHT
T ss_pred             ccccccccccccchhhhhccccC
Confidence            34567789999999999987764


No 27 
>TIGR03412 iscX_yfhJ FeS assembly protein IscX. Members of this protein family are YfhJ, a protein of the ISC system for iron-sulfur cluster assembly. Other genes in the system include iscSUA, hscBA, and fdx.
Probab=27.33  E-value=1.1e+02  Score=16.20  Aligned_cols=31  Identities=10%  Similarity=0.231  Sum_probs=20.6

Q ss_pred             HHHHHhhhccCCCC--CCCHHHHHHHHHhhCCH
Q psy12097         18 RVDYIHNVASAHDF--DYPPEFYDIAEELWKDK   48 (74)
Q Consensus        18 ~~~~i~~~~~~~~~--~~~~~~~~~i~~LW~D~   48 (74)
                      ....|+.++...+.  .-+..+.++|+.-|-|.
T Consensus        29 L~~wV~~L~~FdDdp~~~~EkiLEaIQ~aWieE   61 (63)
T TIGR03412        29 LHQWVLELPGFDDDPKRCNEKILEAIQMAWIDE   61 (63)
T ss_pred             HHHHHHhCcCcCCCcccccHHHHHHHHHHHHHh
Confidence            33445555543332  36789999999999775


No 28 
>PRK10721 hypothetical protein; Provisional
Probab=26.89  E-value=1.1e+02  Score=16.28  Aligned_cols=29  Identities=14%  Similarity=0.267  Sum_probs=19.0

Q ss_pred             HHHhhhccCCCC--CCCHHHHHHHHHhhCCH
Q psy12097         20 DYIHNVASAHDF--DYPPEFYDIAEELWKDK   48 (74)
Q Consensus        20 ~~i~~~~~~~~~--~~~~~~~~~i~~LW~D~   48 (74)
                      ..|+.++...+.  .-++.+.++|+.-|-|.
T Consensus        34 ~wV~~L~~FdDdp~~~~EkiLEAIQ~aWieE   64 (66)
T PRK10721         34 QWICELEDFDDDPQASNEKILEAILLVWLDE   64 (66)
T ss_pred             HHHHhCcCcCCCcccccHHHHHHHHHHHHHh
Confidence            344444443332  36789999999999775


No 29 
>PF07319 DnaI_N:  Primosomal protein DnaI N-terminus;  InterPro: IPR009928 This entry represents the N terminus (approximately 120 residues) of bacterial primosomal DnaI proteins, although one family member appears to be of viral origin. DnaI is one of the components of the Bacillus subtilis replication restart primosome, and is required for the DnaB75-dependent loading of the DnaC helicase [].; PDB: 2K7R_A.
Probab=25.53  E-value=1.3e+02  Score=16.60  Aligned_cols=24  Identities=21%  Similarity=0.443  Sum_probs=18.3

Q ss_pred             CCHHHHHHHHHhhCCHHHHHHHHh
Q psy12097         33 YPPEFYDIAEELWKDKGVQACFER   56 (74)
Q Consensus        33 ~~~~~~~~i~~LW~D~~iq~~~~r   56 (74)
                      +...+-+.+..+-+||.||+.++.
T Consensus        17 ~~~~~~~l~~~vl~dp~V~~Fl~~   40 (94)
T PF07319_consen   17 FEERYEQLKQEVLSDPEVQAFLQE   40 (94)
T ss_dssp             HHHHHHHHHHHHTT-HHHHHHHHH
T ss_pred             HHHHHHHHHHHHHcCHHHHHHHHH
Confidence            445677889999999999988764


No 30 
>cd04749 Commd1_MURR1 COMM_Domain containing protein 1, also called Murr1. Murr1/Commd1 is a protein involved in copper homeostasis, which has also been identified as a regulator of the human delta epithelial sodium channel. The COMM Domain is found at the C-terminus of a variety of proteins; presumably all COMM_Domain containing proteins are located in the nucleus and the COMM domain plays a role in protein-protein interactions. Several family members have been shown to bind and inhibit NF-kappaB.
Probab=25.07  E-value=78  Score=19.96  Aligned_cols=27  Identities=7%  Similarity=0.198  Sum_probs=21.7

Q ss_pred             CCCHHHHHHHHHhhCCHH--HHHHHHhhc
Q psy12097         32 DYPPEFYDIAEELWKDKG--VQACFERSN   58 (74)
Q Consensus        32 ~~~~~~~~~i~~LW~D~~--iq~~~~r~~   58 (74)
                      .+|.+.+.+|.+.|++..  ||+.+.+++
T Consensus        74 Gl~~eha~~l~Kfwk~~~~klr~~l~~~S  102 (174)
T cd04749          74 GITSLQAAVIAKFWKVHKKKIRESLLAQS  102 (174)
T ss_pred             CCChHHHHHHHHHHHHhHHHHHHHHHHHh
Confidence            489999999999999875  777775444


No 31 
>PF13186 SPASM:  Iron-sulfur cluster-binding domain
Probab=24.65  E-value=88  Score=15.01  Aligned_cols=17  Identities=24%  Similarity=0.477  Sum_probs=12.6

Q ss_pred             HHHHHhhCCHHHHHHHH
Q psy12097         39 DIAEELWKDKGVQACFE   55 (74)
Q Consensus        39 ~~i~~LW~D~~iq~~~~   55 (74)
                      +.+..+|+.+..++.-+
T Consensus        34 ~~l~eiw~s~~~~~~r~   50 (64)
T PF13186_consen   34 DSLEEIWNSPKFREFRK   50 (64)
T ss_pred             CCHHHHHCCHHHHHHHH
Confidence            36888999988776643


No 32 
>TIGR00828 EIID-AGA PTS system, mannose/fructose/sorbose family, IID component. Bacterial PTS transporters transport and concomitantly phosphorylate their sugar substrates, and typically consist of multiple subunits or protein domains. The Man family is unique in several respects among PTS permease families.It is the only PTS family in which members possess a IID protein. It is the only PTS family in which the IIB constituent is phosphorylated on a histidyl rather than a cysteyl residue. Its permease members exhibit broad specificity for a range of sugars, rather than being specific for just one or a few sugars. The mannose permease of E. coli, for example, can transport and phosphorylate glucose, mannose, fructose, glucosamine,N-acetylglucosamine, and other sugars. Other members of this can transport sorbose, fructose and N-acetylglucosamine. This family is specific for the IID subunits of this family of PTS transporters.
Probab=23.13  E-value=86  Score=21.09  Aligned_cols=30  Identities=20%  Similarity=0.350  Sum_probs=22.9

Q ss_pred             CCCHHHHHHHHHhh-CC-HHHHHHHHhhcccc
Q psy12097         32 DYPPEFYDIAEELW-KD-KGVQACFERSNEYQ   61 (74)
Q Consensus        32 ~~~~~~~~~i~~LW-~D-~~iq~~~~r~~ef~   61 (74)
                      .|.-.+.+++++|+ +| +..++++.|..+|.
T Consensus        31 gf~~~m~P~L~KlY~~d~e~~~~Alkrhl~fF   62 (271)
T TIGR00828        31 GFCYAMIPAIKKLYPDDKAGRSAALKRHLEFF   62 (271)
T ss_pred             hHHHHHHHHHHHHcCCCHHHHHHHHHHHHHHH
Confidence            35566788999999 45 57889998877754


No 33 
>PF07750 GcrA:  GcrA cell cycle regulator;  InterPro: IPR011681 GcrA, together with CtrA (see IPR001789 from INTERPRO and IPR001867 from INTERPRO), form a master cell cycle regulator. These bacterial regulators are involved in controlling the progression and asymmetric polar morphogenesis []. During this process, there are temporal and spatial variations in the concentrations of GcrA and CtrA. The variation in concentration produces time and space dependent transcriptional regulation of modular functions that implement cell-cycle processes []. More specifically, GcrA acts as an activator of components of the replisome and the segregation machinery [].
Probab=20.97  E-value=81  Score=19.43  Aligned_cols=16  Identities=19%  Similarity=0.478  Sum_probs=13.1

Q ss_pred             CCHHHHHHHHHhhCCH
Q psy12097         33 YPPEFYDIAEELWKDK   48 (74)
Q Consensus        33 ~~~~~~~~i~~LW~D~   48 (74)
                      .+.+-.+.+++||++-
T Consensus         3 Wtde~~~~L~~lw~~G   18 (162)
T PF07750_consen    3 WTDERVERLRKLWAEG   18 (162)
T ss_pred             CCHHHHHHHHHHHHcC
Confidence            5677888999999884


No 34 
>PF08083 PROCN:  PROCN (NUC071) domain;  InterPro: IPR012592 The PROCN domain is the central domain in pre-mRNA splicing factors of PRO8 family [].; GO: 0000398 nuclear mRNA splicing, via spliceosome, 0005681 spliceosomal complex
Probab=20.57  E-value=20  Score=25.46  Aligned_cols=40  Identities=28%  Similarity=0.287  Sum_probs=27.8

Q ss_pred             CCHHHHHHHHHhhCCHHHHHHHHhhcccccccchHHhhccC
Q psy12097         33 YPPEFYDIAEELWKDKGVQACFERSNEYQLIDCAKYLVSLV   73 (74)
Q Consensus        33 ~~~~~~~~i~~LW~D~~iq~~~~r~~ef~L~Dsa~YFld~l   73 (74)
                      +..|+.. +.++--|..||=-...-..|||.|+..|-|++|
T Consensus       154 L~REilr-~~K~iVD~hv~~rlgnida~qLadgl~yiF~hv  193 (408)
T PF08083_consen  154 LCREILR-FTKLIVDIHVQYRLGNIDAYQLADGLQYIFNHV  193 (408)
T ss_pred             HHHHHHH-HHHHHhhhheeeeccCccHHHHHHHHHHHHHhh
Confidence            4556544 445556777764444556799999999999986


No 35 
>COG1756 Mra1 Uncharacterized conserved protein [Function unknown]
Probab=20.54  E-value=92  Score=20.51  Aligned_cols=17  Identities=24%  Similarity=0.204  Sum_probs=14.2

Q ss_pred             HHhhCCHHHHHHHHhhc
Q psy12097         42 EELWKDKGVQACFERSN   58 (74)
Q Consensus        42 ~~LW~D~~iq~~~~r~~   58 (74)
                      ..+|.+|+|.+.+.||+
T Consensus        17 ~~i~~hpav~~~akrrg   33 (223)
T COG1756          17 EEIVNHPAVLRDAKRRG   33 (223)
T ss_pred             HHHhcCHHHHHHHHHhC
Confidence            35799999999998775


Done!