BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= psy12129
         (154 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|3ECQ|A Chain A, Endo-Alpha-N-Acetylgalactosaminidase From Streptococcus
           Pneumoniae: Semet Structure
 pdb|3ECQ|B Chain B, Endo-Alpha-N-Acetylgalactosaminidase From Streptococcus
           Pneumoniae: Semet Structure
          Length = 1531

 Score = 26.9 bits (58), Expect = 5.0,   Method: Composition-based stats.
 Identities = 16/65 (24%), Positives = 33/65 (50%), Gaps = 3/65 (4%)

Query: 64  TGHIGSGDVELGNSRLRAIQNQMQSKGGYEADLGVRVSARQTHTRSQ---RRYRKEDPNG 120
           +GH+   D+      +   +  ++    Y A LG+ V+A +T+  S+    +  +++P+G
Sbjct: 623 SGHLNYADIGKRIGGVEDFKTLIEKAKKYGAHLGIHVNASETYPESKYFNEKILRKNPDG 682

Query: 121 SDSSG 125
           S S G
Sbjct: 683 SYSYG 687


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.314    0.131    0.388 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 4,845,266
Number of Sequences: 62578
Number of extensions: 185954
Number of successful extensions: 175
Number of sequences better than 100.0: 3
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 2
Number of HSP's that attempted gapping in prelim test: 173
Number of HSP's gapped (non-prelim): 3
length of query: 154
length of database: 14,973,337
effective HSP length: 90
effective length of query: 64
effective length of database: 9,341,317
effective search space: 597844288
effective search space used: 597844288
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 47 (22.7 bits)