BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= psy12129
(154 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|3ECQ|A Chain A, Endo-Alpha-N-Acetylgalactosaminidase From Streptococcus
Pneumoniae: Semet Structure
pdb|3ECQ|B Chain B, Endo-Alpha-N-Acetylgalactosaminidase From Streptococcus
Pneumoniae: Semet Structure
Length = 1531
Score = 26.9 bits (58), Expect = 5.0, Method: Composition-based stats.
Identities = 16/65 (24%), Positives = 33/65 (50%), Gaps = 3/65 (4%)
Query: 64 TGHIGSGDVELGNSRLRAIQNQMQSKGGYEADLGVRVSARQTHTRSQ---RRYRKEDPNG 120
+GH+ D+ + + ++ Y A LG+ V+A +T+ S+ + +++P+G
Sbjct: 623 SGHLNYADIGKRIGGVEDFKTLIEKAKKYGAHLGIHVNASETYPESKYFNEKILRKNPDG 682
Query: 121 SDSSG 125
S S G
Sbjct: 683 SYSYG 687
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.314 0.131 0.388
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 4,845,266
Number of Sequences: 62578
Number of extensions: 185954
Number of successful extensions: 175
Number of sequences better than 100.0: 3
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 2
Number of HSP's that attempted gapping in prelim test: 173
Number of HSP's gapped (non-prelim): 3
length of query: 154
length of database: 14,973,337
effective HSP length: 90
effective length of query: 64
effective length of database: 9,341,317
effective search space: 597844288
effective search space used: 597844288
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 47 (22.7 bits)