Diaphorina citri psyllid: psy12135


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210--
MSVQIWRRSYDVLPPPMTKDHKYYQDIITNPNFKIDGPNEDQFPHTESLKETIMRVLPYWNENIATEIKQGKKVLVVTHGTSLRGLILKVHVGRPWGLQSHVFLLGINNNFARFQVQIWRRSYDVLPPPMTKDHKYYQDIISNPNFKIDGPNEDQFPHTESLKETIMRVLPYWNENIATEIKQGKKVLVVTHGTSLRGLVKHIERKSLREPV
ccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHcccccccccHHHHcccHHHHHHHHHHHHHHHcccccccccHcccccccccccHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccHHHHHHHcccccHHHcHHHHHcccEEEEEEccHHHHHHHHHHccccccccc
MSVQIWRRSYDVLPPPMTKDHKYYQDIITNPNFKIDGPNEDQFPHTESLKETIMRVLPYWNENIATEIKQGKKVLVVTHGTSLRGLILKVHVGRPWGLQSHVFLLGINNNFARFQVQIWRRSYDVLPPPMTKDHKYYQDIISNPNFKIDGPNEDQFPHTESLKETIMRVLPYWNENIATEIKQGKKVLVVTHGTSLRGLVKHIERKSLREPV
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSVQIWRRSYDVLPPPMTKDHKYYQDIITNPNFKIDGPNEDQFPHTESLKETIMRVLPYWNENIATEIKQGKKVLVVTHGTSLRGLILKVHVGRPWGLQSHVFLLGINNNFARFQVQIWRRSYDVLPPPMTKDHKYYQDIISNPNFKIDGPNEDQFPHTESLKETIMRVLPYWNENIATEIKQGKKVLVVTHGTSLRGLVKHIERKSLREPV

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Catalyzes the interconversion of 2-phosphoglycerate and 3-phosphoglycerate.confidentP30798
Phosphoglycerate mutase 2 Interconversion of 3- and 2-phosphoglycerate with 2,3-bisphosphoglycerate as the primer of the reaction. Can also catalyze the reaction of EC 5.4.2.4 (synthase) and EC 3.1.3.13 (phosphatase), but with a reduced activity.confidentQ32KV0
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Catalyzes the interconversion of 2-phosphoglycerate and 3-phosphoglycerate.confidentQ39V40

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0043231 [CC]intracellular membrane-bounded organelleprobableGO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0008152 [BP]metabolic processprobableGO:0008150
GO:0044444 [CC]cytoplasmic partprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424
GO:0071944 [CC]cell peripheryprobableGO:0005575, GO:0044464, GO:0005623

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2HHJ, chain A
Confidence level:very confident
Coverage over the Query: 41-210
View the alignment between query and template
View the model in PyMOL
Template: 2HHJ, chain A
Confidence level:very confident
Coverage over the Query: 3-90
View the alignment between query and template
View the model in PyMOL