Diaphorina citri psyllid: psy12139

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60-----
MLLELSPAQLLMLLASDEALRQKVEEAMDIVMNLSGHDLSSENLLGSSDGIDIHSSTVKGELTLR
ccccccHHHHHHHHHcHHHHHHHHHHHHHHHHHHHccccccccccccccccEEcccccccccccc
*****SPAQLLMLLASDEALRQKVEEAMDIVMN***********LGSSDGIDIHSSTV*******
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLLELSPAQLLMLLASDEALRQKVEEAMDIVMNLSGHDLSSENLLGSSDGIDIHSSTVKGELTLR

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfer were detected in SWISS-PROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0050847 [BP]progesterone receptor signaling pathwayprobableGO:0044700, GO:0051716, GO:0030522, GO:0050896, GO:0009987, GO:0050794, GO:0008150, GO:0065007, GO:0044763, GO:0007165, GO:0023052, GO:0030518, GO:0007154, GO:0050789, GO:0044699
GO:0090263 [BP]positive regulation of canonical Wnt receptor signaling pathwayprobableGO:0009966, GO:0009967, GO:0048584, GO:0048583, GO:0030111, GO:0050794, GO:0023056, GO:0030177, GO:0065007, GO:0023051, GO:0048518, GO:0008150, GO:0010647, GO:0010646, GO:0050789, GO:0060828, GO:0048522
GO:0000209 [BP]protein polyubiquitinationprobableGO:0071704, GO:0044267, GO:0044238, GO:0044260, GO:0032446, GO:0019538, GO:0009987, GO:0070647, GO:0006464, GO:0043170, GO:0016567, GO:0043412, GO:0036211, GO:0008150, GO:0044237, GO:0008152
GO:0005634 [CC]nucleusprobableGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0033160 [BP]positive regulation of protein import into nucleus, translocationprobableGO:0033157, GO:0070201, GO:0032879, GO:0032388, GO:0060341, GO:0051050, GO:0051049, GO:0032386, GO:1900180, GO:0090316, GO:0033158, GO:0050794, GO:0008150, GO:0065007, GO:0046822, GO:0048518, GO:0042306, GO:0051222, GO:0051223, GO:0050789, GO:0032880
GO:0035413 [BP]positive regulation of catenin import into nucleusprobableGO:0033157, GO:0032388, GO:0060341, GO:0051049, GO:0032386, GO:0035412, GO:0051222, GO:0051223, GO:0050789, GO:0032880, GO:0065007, GO:0048518, GO:0070201, GO:0051050, GO:0090316, GO:0050794, GO:0008150, GO:0042307, GO:0042306, GO:0032879, GO:1900180, GO:0046824, GO:0046822
GO:0034450 [MF]ubiquitin-ubiquitin ligase activityprobableGO:0019787, GO:0016879, GO:0004842, GO:0016881, GO:0003824, GO:0003674, GO:0016874

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2DYD, chain A
Confidence level:very confident
Coverage over the Query: 1-37
View the alignment between query and template
View the model in PyMOL