Diaphorina citri psyllid: psy12141


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140--
MNKGDKRVVMNPELLKRLQQQAGQVRIGGKGTPRRKKKVVHTTAATDDKKLQSSLKKLAVNTIPGIEEVNMIKEDGTIIHFNNPKAQASLAANTFAITGHGETREITEMLPGILSQLGPEGLTQLKRLATSVAGMCKNLIVT
cccccccccccHHHHHHHHHHccccCCccccccccccccccccccccHHHHHHHHHccccccccccEEEEEECcccEEEEEccccEEEEccccEEEEEccccccHHHHHcHHHHHcccHHHHHHHHHHHHHHHccccccccc
*****KR***NPELLKRLQQQAG**RI*G*GT*RR**********TDDKKLQSSLKKLAVNTIPGIEEVNMIKEDGTIIHFNNPKAQASLAANTFAITGHGETREITEMLPGILSQLGPEGLTQLKRLATSVAGMCKNLI**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNKGDKRVVMNPELLKRLQQQAGQVRIGGKGTPRRKKKVVHTTAATDDKKLQSSLKKLAVNTIPGIEEVNMIKEDGTIIHFNNPKAQASLAANTFAITGHGETREITEMLPGILSQLGPEGLTQLKRLATSVAGMCKNLIVT

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Transcription factor BTF3 homolog May act as a transcription factor that exert a negative effect on the expression of several genes that are transcribed by RNA polymerase II.very confidentQ18885
Transcription factor BTF3 homolog 4 very confidentQ2KIY7
Transcription factor BTF3 homolog 4 very confidentQ6PC91

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005875 [CC]microtubule associated complexprobableGO:0043234, GO:0005856, GO:0015630, GO:0032991, GO:0005575, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0044430, GO:0044424, GO:0043228, GO:0043226, GO:0044422
GO:0005739 [CC]mitochondrionprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0040039 [BP]inductive cell migrationprobableGO:0040011, GO:0048870, GO:0009987, GO:0006928, GO:0051674, GO:0044763, GO:0008150, GO:0016477, GO:0051179, GO:0044699
GO:0040035 [BP]hermaphrodite genitalia developmentprobableGO:0032502, GO:0007548, GO:0032501, GO:0048608, GO:0000003, GO:0044707, GO:0022414, GO:0061458, GO:0048856, GO:0044767, GO:0003006, GO:0048513, GO:0048806, GO:0008150, GO:0048731, GO:0007275, GO:0044699
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0040010 [BP]positive regulation of growth rateprobableGO:0045927, GO:0040008, GO:0040009, GO:0065007, GO:0048518, GO:0008150, GO:0050789
GO:0006366 [BP]transcription from RNA polymerase II promoterprobableGO:0032774, GO:0090304, GO:0044249, GO:0034641, GO:0006807, GO:0034645, GO:1901362, GO:1901360, GO:1901576, GO:0044260, GO:0071704, GO:0010467, GO:0018130, GO:0006139, GO:0009987, GO:0006725, GO:0009058, GO:0009059, GO:0008150, GO:0008152, GO:0034654, GO:0046483, GO:0016070, GO:0044238, GO:0044271, GO:0044237, GO:0043170, GO:0006351, GO:0019438
GO:0070201 [BP]regulation of establishment of protein localizationprobableGO:0008150, GO:0032879, GO:0065007, GO:0050789, GO:0032880
GO:0060811 [BP]intracellular mRNA localization involved in anterior/posterior axis specificationprobableGO:0032502, GO:0007389, GO:0033036, GO:0032501, GO:0009952, GO:0044707, GO:0070727, GO:0009948, GO:0009987, GO:0044763, GO:0060810, GO:0008298, GO:0008150, GO:0003002, GO:0009798, GO:0051179, GO:0006403, GO:0007275, GO:0044699, GO:0051641
GO:0006898 [BP]receptor-mediated endocytosisprobableGO:0006897, GO:0016192, GO:0006810, GO:0008150, GO:0051234, GO:0051179
GO:0006355 [BP]regulation of transcription, DNA-dependentprobableGO:0009889, GO:0080090, GO:0019222, GO:0060255, GO:0031326, GO:0031323, GO:0051252, GO:2000112, GO:0050794, GO:0050789, GO:0019219, GO:0010556, GO:0065007, GO:0051171, GO:2001141, GO:0008150, GO:0010468
GO:0007317 [BP]regulation of pole plasm oskar mRNA localizationprobableGO:2000241, GO:0051239, GO:0060341, GO:0050793, GO:0060281, GO:0060284, GO:0050794, GO:0008150, GO:0044087, GO:0045595, GO:2000026, GO:0045995, GO:0065007, GO:0032879, GO:0051128, GO:0050789
GO:0009651 [BP]response to salt stressprobableGO:0008150, GO:0009628, GO:0006950, GO:0006970, GO:0050896
GO:0001701 [BP]in utero embryonic developmentprobableGO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0044767, GO:0009790, GO:0009792, GO:0008150, GO:0043009, GO:0007275, GO:0044699
GO:0005634 [CC]nucleusprobableGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0051082 [MF]unfolded protein bindingprobableGO:0003674, GO:0005488, GO:0005515
GO:0010171 [BP]body morphogenesisprobableGO:0032502, GO:0048856, GO:0044767, GO:0008150, GO:0009653, GO:0044699
GO:0043066 [BP]negative regulation of apoptotic processprobableGO:0043069, GO:0050794, GO:0008150, GO:0043067, GO:0065007, GO:0060548, GO:0048519, GO:0010941, GO:0042981, GO:0050789, GO:0048523
GO:0042788 [CC]polysomal ribosomeprobableGO:0005737, GO:0005844, GO:0032991, GO:0005840, GO:0043232, GO:0044464, GO:0043229, GO:0005623, GO:0030529, GO:0005575, GO:0044444, GO:0043228, GO:0044424, GO:0005622, GO:0043226
GO:0006915 [BP]apoptotic processprobableGO:0010259, GO:0009987, GO:0012501, GO:0044763, GO:0008150, GO:0007569, GO:0044699

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3LKX, chain A
Confidence level:very confident
Coverage over the Query: 60-125
View the alignment between query and template
View the model in PyMOL