Diaphorina citri psyllid: psy12152


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130---
MVFHGVYLLYSRNPRYLGRTYIGYTVDPDRRIKQHNKGKDFGGAHKTSNRGPWDMVLIVYGFPNDISALRFEWAWQHPKMSRRLQHVARKKSKETTYTYCLRLLHIMLQTAPWQRLPLTVQWLKPEYQQVLTE
ccEEEEEEEECccccccccEEEEECcccHHHHHHHcccccccccccccccccEEEEEEEEccccHHHHHHHHHHHccccccHHHHHHHHHcccccHHHHHHHHHHHHHccccccccccEEEEEcHHHHHHHHc
MVFHGVYLLYSRNPRYLGRTYIGYTVDPDRRIKQHNKGKDFGGAHKTSNRGPWDMVLIVYGFPNDISALRFEWAWQHPKMSRRLQHVARKKSKETTYTYCLRLLHIMLQTAPWQRLPLTVQWLKPEYQQVLTE
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVFHGVYLLYSRNPRYLGRTYIGYTVDPDRRIKQHNKGKDFGGAHKTSNRGPWDMVLIVYGFPNDISALRFEWAWQHPKMSRRLQHVARKKSKETTYTYCLRLLHIMLQTAPWQRLPLTVQWLKPEYQQVLTE

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Structure-specific endonuclease subunit SLX1 homolog Catalytic subunit of a heterodimeric structure-specific endonuclease that resolves DNA secondary structures generated during DNA repair and recombination. Has endonuclease activity towards branched DNA substrates, introducing single-strand cuts in duplex DNA close to junctions with ss-DNA.confidentQ5TXB2
Structure-specific endonuclease subunit SLX1 homolog Catalytic subunit of a heterodimeric structure-specific endonuclease that resolves DNA secondary structures generated during DNA repair and recombination. Has endonuclease activity towards branched DNA substrates, introducing single-strand cuts in duplex DNA close to junctions with ss-DNA.confidentP91351
Structure-specific endonuclease subunit slx1 Catalytic subunit of the slx1-slx4 structure-specific endonuclease that resolves DNA secondary structures generated during DNA repair and recombination. Has endonuclease activity towards branched DNA substrates, introducing single-strand cuts in duplex DNA close to junctions with ss-DNA.confidentQ5AU18

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0017108 [MF]5'-flap endonuclease activityprobableGO:0004518, GO:0016787, GO:0004536, GO:0004519, GO:0003824, GO:0004520, GO:0016788, GO:0016893, GO:0003674, GO:0048256, GO:0016888
GO:0033557 [CC]Slx1-Slx4 complexprobableGO:0031974, GO:0043229, GO:0043228, GO:0000228, GO:0043227, GO:0043226, GO:0044446, GO:0031981, GO:0005634, GO:0044454, GO:0005694, GO:0043234, GO:0032991, GO:0043231, GO:0043232, GO:0043233, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0070013, GO:0044428, GO:0044424, GO:0044427, GO:0044422
GO:0010792 [BP]DNA double-strand break processing involved in repair via single-strand annealingprobableGO:0044238, GO:0090304, GO:0090305, GO:0034641, GO:0006807, GO:1901360, GO:1901361, GO:0006139, GO:0051716, GO:0044265, GO:0000726, GO:0044260, GO:0000729, GO:0006308, GO:0071704, GO:0044699, GO:0046483, GO:0006281, GO:0009987, GO:0006725, GO:1901575, GO:0046700, GO:0006974, GO:0006259, GO:0006950, GO:0044763, GO:0008152, GO:0034655, GO:0009056, GO:0009057, GO:0006302, GO:0044248, GO:0000738, GO:0044270, GO:0045002, GO:0050896, GO:0044237, GO:0043170, GO:0033554, GO:0019439, GO:0008150
GO:0008821 [MF]crossover junction endodeoxyribonuclease activityprobableGO:0016787, GO:0003824, GO:0004536, GO:0004519, GO:0004520, GO:0016788, GO:0004518, GO:0003674, GO:0016894, GO:0016889
GO:0000724 [BP]double-strand break repair via homologous recombinationprobableGO:0090304, GO:0034641, GO:0006807, GO:1901360, GO:0006139, GO:0051716, GO:0006302, GO:0000725, GO:0071704, GO:0044699, GO:0006281, GO:0009987, GO:0006725, GO:0006974, GO:0006950, GO:0044763, GO:0008152, GO:0046483, GO:0006310, GO:0044238, GO:0044260, GO:0050896, GO:0044237, GO:0043170, GO:0033554, GO:0006259, GO:0008150

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1ZG2, chain A
Confidence level:very confident
Coverage over the Query: 2-83,101-122
View the alignment between query and template
View the model in PyMOL