BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= psy12155
         (78 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|2CKW|A Chain A, The 2.3 A Resolution Structure Of The Sapporo Virus Rna
           Dependant Rna Polymerase
          Length = 515

 Score = 26.2 bits (56), Expect = 4.7,   Method: Composition-based stats.
 Identities = 13/57 (22%), Positives = 24/57 (42%), Gaps = 2/57 (3%)

Query: 10  GMFVNVRGIDVLGEEFEFPTCPKFYNIFHPF--DPVAYRIEPLIVPAMEHVRPVQVP 64
           G    V  I   G++  +  CP   +IFH    +  +Y ++P      + ++P   P
Sbjct: 334 GNVFQVETIHTYGDDCMYSVCPATASIFHTVLANLTSYGLKPTAADKSDAIKPTNTP 390


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.331    0.149    0.496 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 2,712,002
Number of Sequences: 62578
Number of extensions: 99307
Number of successful extensions: 174
Number of sequences better than 100.0: 1
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 174
Number of HSP's gapped (non-prelim): 1
length of query: 78
length of database: 14,973,337
effective HSP length: 47
effective length of query: 31
effective length of database: 12,032,171
effective search space: 372997301
effective search space used: 372997301
T: 11
A: 40
X1: 15 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.9 bits)
S2: 45 (21.9 bits)