Query         psy12155
Match_columns 78
No_of_seqs    101 out of 297
Neff          5.5 
Searched_HMMs 46136
Date          Fri Aug 16 20:08:06 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy12155.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/12155hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF02862 DDHD:  DDHD domain;  I 100.0 5.6E-35 1.2E-39  205.1   3.8   76    1-76      7-93  (227)
  2 KOG2308|consensus              100.0 1.6E-31 3.5E-36  215.5   2.7   78    1-78    516-596 (741)
  3 PF05191 ADK_lid:  Adenylate ki  44.5      11 0.00024   19.8   0.7   13   26-38      3-15  (36)
  4 TIGR03046 PS_II_psbV2 photosys  29.2      22 0.00047   24.6   0.4   35   40-74     16-50  (155)
  5 PF02560 Cyanate_lyase:  Cyanat  28.8      13 0.00028   23.0  -0.7   13   39-51      7-19  (73)
  6 cd00559 Cyanase_C Cyanase C-te  27.6      26 0.00055   21.4   0.4   14   39-52      3-16  (69)
  7 PF09737 Det1:  De-etiolated pr  23.4      36 0.00077   27.0   0.7   17   32-48    376-392 (407)
  8 KOG2558|consensus               22.7      42 0.00091   27.4   0.9   21   35-55    504-524 (532)
  9 KOG1148|consensus               21.0      37  0.0008   28.8   0.3   14   37-50    401-414 (764)
 10 KOG4342|consensus               20.7      26 0.00056   30.3  -0.6   28   28-55    236-263 (1078)
 11 KOG3620|consensus               20.2   1E+02  0.0022   28.5   2.8   43   34-76     74-131 (1626)
 12 PRK02866 cyanate hydratase; Va  20.1      34 0.00073   23.5  -0.0   13   39-51     81-93  (147)

No 1  
>PF02862 DDHD:  DDHD domain;  InterPro: IPR004177 The DDHD domain is 180 residues long and contains four conserved residues that may form a metal binding site. The domain is named after these four residues. This pattern of conservation of metal binding residues is often seen in phosphoesterase domains. This domain is found in retinal degeneration B proteins, as well as a family of probable phospholipases.; GO: 0046872 metal ion binding
Probab=100.00  E-value=5.6e-35  Score=205.14  Aligned_cols=76  Identities=46%  Similarity=0.970  Sum_probs=70.3

Q ss_pred             CEEeecChHHHHHHhhCCccC-----------CCcccCCCcCceeeeccCCCccccccccccccccccCCCeeecccCCc
Q psy12155          1 MFFAFGSPVGMFVNVRGIDVL-----------GEEFEFPTCPKFYNIFHPFDPVAYRIEPLIVPAMEHVRPVQVPHHKGR   69 (78)
Q Consensus         1 nlF~~GSPlg~fl~lr~~~~~-----------~~~~~~p~c~~~yNIfhp~DPvAyRlEPli~~~~~~~~P~~iP~~~~~   69 (78)
                      |||++|||||+||++||....           +..+.+|+|.|+||||||+|||||||||||+++|++++|+.||+++++
T Consensus         7 ~lF~~GSPlg~fl~lr~~~~~~~~~~~~~~~~~~~~~~p~~~~~yNifhp~DPvAyRlEPli~~~~~~~~P~~ip~~~~~   86 (227)
T PF02862_consen    7 NLFLVGSPLGLFLTLRGAQIGARSASEYVTDEGSFYPCPACRRIYNIFHPYDPVAYRLEPLIDPRYADIKPVSIPRFKGG   86 (227)
T ss_pred             eEEEeCCCHHHHHHHhCccccccccccccccccccccCCccccceeeeecCChHHHhHHHHHhhhhccCCCeeccccccc
Confidence            799999999999999998743           236889999999999999999999999999999999999999999999


Q ss_pred             ceeeeee
Q psy12155         70 KRMHLGR   76 (78)
Q Consensus        70 ~r~h~~~   76 (78)
                      ++.|.++
T Consensus        87 ~~~~~~~   93 (227)
T PF02862_consen   87 KLGHYES   93 (227)
T ss_pred             Ccccccc
Confidence            9988765


No 2  
>KOG2308|consensus
Probab=99.97  E-value=1.6e-31  Score=215.48  Aligned_cols=78  Identities=58%  Similarity=1.135  Sum_probs=73.5

Q ss_pred             CEEeecChHHHHHHhhCCccCCCc---ccCCCcCceeeeccCCCccccccccccccccccCCCeeecccCCcceeeeeec
Q psy12155          1 MFFAFGSPVGMFVNVRGIDVLGEE---FEFPTCPKFYNIFHPFDPVAYRIEPLIVPAMEHVRPVQVPHHKGRKRMHLGRK   77 (78)
Q Consensus         1 nlF~~GSPlg~fl~lr~~~~~~~~---~~~p~c~~~yNIfhp~DPvAyRlEPli~~~~~~~~P~~iP~~~~~~r~h~~~~   77 (78)
                      |||++|||||+|+++||....+..   +.+|+|++|||||||+|||||||||||+++|+.++|+.||++++++|+|.+++
T Consensus       516 ~fFalGSPlgvFltlrG~d~~~~~~~~~~~p~C~~fyNIfHP~DPVAYRlEPlV~ke~~~i~Pv~Iph~r~~~~L~~~~~  595 (741)
T KOG2308|consen  516 NFFALGSPLGVFLTLRGIDSYNELSRIVSRPACKRFYNIFHPTDPVAYRLEPLVVKEMAHIRPVKIPHHRGSKRLHSELK  595 (741)
T ss_pred             heeeecCchhhhheecccccccccccccccccccchhhcCCCCCchheecccccchhhcccCceeccccCCccchhhhhc
Confidence            799999999999999998766665   88999999999999999999999999999999999999999999999999887


Q ss_pred             C
Q psy12155         78 H   78 (78)
Q Consensus        78 ~   78 (78)
                      +
T Consensus       596 ~  596 (741)
T KOG2308|consen  596 E  596 (741)
T ss_pred             c
Confidence            5


No 3  
>PF05191 ADK_lid:  Adenylate kinase, active site lid;  InterPro: IPR007862 Adenylate kinases (ADK; 2.7.4.3 from EC) are phosphotransferases that catalyse the Mg-dependent reversible conversion of ATP and AMP to two molecules of ADP, an essential reaction for many processes in living cells. In large variants of adenylate kinase, the AMP and ATP substrates are buried in a domain that undergoes conformational changes from an open to a closed state when bound to substrate; the ligand is then contained within a highly specific environment required for catalysis. Adenylate kinase is a 3-domain protein consisting of a large central CORE domain flanked by a LID domain on one side and the AMP-binding NMPbind domain on the other []. The LID domain binds ATP and covers the phosphates at the active site. The substrates first bind the CORE domain, followed by closure of the active site by the LID and NMPbind domains. Comparisons of adenylate kinases have revealed a particular divergence in the active site lid. In some organisms, particularly the Gram-positive bacteria, residues in the lid domain have been mutated to cysteines and these cysteine residues (two CX(n)C motifs) are responsible for the binding of a zinc ion. The bound zinc ion in the lid domain is clearly structurally homologous to Zinc-finger domains. However, it is unclear whether the adenylate kinase lid is a novel zinc-finger DNA/RNA binding domain, or that the lid bound zinc serves a purely structural function [].; GO: 0004017 adenylate kinase activity; PDB: 3BE4_A 2OSB_B 2ORI_A 2EU8_A 3DL0_A 1P3J_A 2QAJ_A 2OO7_A 2P3S_A 3DKV_A ....
Probab=44.51  E-value=11  Score=19.83  Aligned_cols=13  Identities=31%  Similarity=0.687  Sum_probs=10.4

Q ss_pred             cCCCcCceeeecc
Q psy12155         26 EFPTCPKFYNIFH   38 (78)
Q Consensus        26 ~~p~c~~~yNIfh   38 (78)
                      .+++|..+||+..
T Consensus         3 ~C~~Cg~~Yh~~~   15 (36)
T PF05191_consen    3 ICPKCGRIYHIEF   15 (36)
T ss_dssp             EETTTTEEEETTT
T ss_pred             CcCCCCCcccccc
Confidence            4689999999943


No 4  
>TIGR03046 PS_II_psbV2 photosystem II cytochrome PsbV2. Members of this protein family are PsbV2, a protein closely related cytochrome c-550 (PsbV), a protein important to the water-splitting and oxygen-evolving activity of photosystem II. Mutant studies in Thermosynechococcus elongatus showed PsbV2 can partially replace PsbV, from which it appears to have arisen first by duplication, then by intergenic recombination with a different gene.
Probab=29.22  E-value=22  Score=24.64  Aligned_cols=35  Identities=23%  Similarity=0.422  Sum_probs=28.8

Q ss_pred             CCccccccccccccccccCCCeeecccCCcceeee
Q psy12155         40 FDPVAYRIEPLIVPAMEHVRPVQVPHHKGRKRMHL   74 (78)
Q Consensus        40 ~DPvAyRlEPli~~~~~~~~P~~iP~~~~~~r~h~   74 (78)
                      .+|+|.+++|.|..-.+.-.||.||--..|.-.-+
T Consensus        16 ~~~~~~~~d~yv~~~l~~~~~~~~~~~~~g~~~~~   50 (155)
T TIGR03046        16 ASPVAARVDPYVKQYLRVTGPVELPLDAQGELKTF   50 (155)
T ss_pred             CCHHHhccChHHHHHhccCCceEeecCCCCCeEEe
Confidence            45899999999998887889999998877665544


No 5  
>PF02560 Cyanate_lyase:  Cyanate lyase C-terminal domain;  InterPro: IPR003712 Some bacteria can overcome the toxicity of environmental cyanate by hydrolysis of cyanate. This reaction is catalyzed by cyanate lyase (also known as cyanase) []. Cyanate lyase is found in bacteria and plants and catalyzes the reaction of cyanate with bicarbonate to produce ammonia and carbon dioxide. The cyanate lyase monomer is composed of two domains. The N-terminal domain shows structural similarity to the DNA-binding alpha-helix bundle motif. The C-terminal domain has an 'open fold' with no structural homology to other proteins. The dimer structure reveals the C-terminal domains to be intertwined, and the decamer is formed by a pentamer of these dimers. The active site of the enzyme is located between dimers and is comprised of residues from four adjacent subunits of the homodecamer []. ; GO: 0008824 cyanate hydratase activity, 0009439 cyanate metabolic process; PDB: 2IV1_B 2IUO_A 2IVQ_B 1DW9_A 1DWK_E 2IVG_G 2IU7_J 2IVB_A.
Probab=28.77  E-value=13  Score=22.95  Aligned_cols=13  Identities=38%  Similarity=0.940  Sum_probs=8.3

Q ss_pred             CCCcccccccccc
Q psy12155         39 PFDPVAYRIEPLI   51 (78)
Q Consensus        39 p~DPvAyRlEPli   51 (78)
                      |.||+-||+--.+
T Consensus         7 ptDP~iYR~yE~v   19 (73)
T PF02560_consen    7 PTDPLIYRLYEIV   19 (73)
T ss_dssp             --SHHHHHHHHHH
T ss_pred             CCCCeEeeeehhh
Confidence            6899999985443


No 6  
>cd00559 Cyanase_C Cyanase C-terminal domain. Cyanase (Cyanate lyase) is responsible for the hydrolysis of cyanate.  It catalyzes the reaction of cyanate with bicarbonate to produce ammonia and carbon dioxide. This allows organisms that possess the enzyme to overcome the toxicity of environmental cyanate and to use cyanate as a source of nitrogen for growth. This enzyme is a homodecamer, formed by five dimers. Each monomer is composed of two domains, an N-terminal helix-turn-helix and this structurally unique C-terminal domain.
Probab=27.58  E-value=26  Score=21.41  Aligned_cols=14  Identities=36%  Similarity=0.795  Sum_probs=10.6

Q ss_pred             CCCccccccccccc
Q psy12155         39 PFDPVAYRIEPLIV   52 (78)
Q Consensus        39 p~DPvAyRlEPli~   52 (78)
                      |+||+-||+--.+.
T Consensus         3 ptDP~iYRlyE~v~   16 (69)
T cd00559           3 PTDPLIYRFYEIVQ   16 (69)
T ss_pred             CCCceeeehHHHHH
Confidence            78999999865443


No 7  
>PF09737 Det1:  De-etiolated protein 1 Det1;  InterPro: IPR019138  This entry represents Det1 family proteins []. Det1 (de-etiolated-1) is an essential negative regulator of plant light responses, and it is a component of the Arabidopsis CDD complex containing DDB1 and COP10 ubiquitin E2 variant. Mammalian Det1 forms stable DDD-E2 complexes, consisting of DDB1, DDA1 (DET1, DDB1 Associated 1), is a member of the UBE2E group of canonical ubiquitin conjugating enzymes and modulates Cul4A function []. 
Probab=23.35  E-value=36  Score=26.99  Aligned_cols=17  Identities=35%  Similarity=0.714  Sum_probs=12.8

Q ss_pred             ceeeeccCCCccccccc
Q psy12155         32 KFYNIFHPFDPVAYRIE   48 (78)
Q Consensus        32 ~~yNIfhp~DPvAyRlE   48 (78)
                      -+==+|||++|.|--+-
T Consensus       376 ~vaf~FHP~~PFaiSvq  392 (407)
T PF09737_consen  376 LVAFTFHPFEPFAISVQ  392 (407)
T ss_pred             EEEEEcCCCCCeEEEEE
Confidence            34458999999997654


No 8  
>KOG2558|consensus
Probab=22.70  E-value=42  Score=27.37  Aligned_cols=21  Identities=48%  Similarity=0.899  Sum_probs=15.8

Q ss_pred             eeccCCCcccccccccccccc
Q psy12155         35 NIFHPFDPVAYRIEPLIVPAM   55 (78)
Q Consensus        35 NIfhp~DPvAyRlEPli~~~~   55 (78)
                      =||||.||.|--+--...+.|
T Consensus       504 F~fHPf~PlaISIQ~t~~p~y  524 (532)
T KOG2558|consen  504 FIFHPFDPLAISIQKTMNPSY  524 (532)
T ss_pred             EeccCCCceeeeeecccCCce
Confidence            389999999988766655443


No 9  
>KOG1148|consensus
Probab=20.97  E-value=37  Score=28.82  Aligned_cols=14  Identities=43%  Similarity=0.605  Sum_probs=10.3

Q ss_pred             ccCCCccccccccc
Q psy12155         37 FHPFDPVAYRIEPL   50 (78)
Q Consensus        37 fhp~DPvAyRlEPl   50 (78)
                      +...||||||+-=.
T Consensus       401 p~m~DlvayRik~~  414 (764)
T KOG1148|consen  401 PQMWDLVAYRIKNV  414 (764)
T ss_pred             ccccccceeeeecC
Confidence            34579999998543


No 10 
>KOG4342|consensus
Probab=20.68  E-value=26  Score=30.26  Aligned_cols=28  Identities=21%  Similarity=0.501  Sum_probs=21.7

Q ss_pred             CCcCceeeeccCCCcccccccccccccc
Q psy12155         28 PTCPKFYNIFHPFDPVAYRIEPLIVPAM   55 (78)
Q Consensus        28 p~c~~~yNIfhp~DPvAyRlEPli~~~~   55 (78)
                      -.|+++-|+|||.||..++.---+.++|
T Consensus       236 q~~N~~mN~fdPnd~st~~~cr~La~~f  263 (1078)
T KOG4342|consen  236 QTANQMMNVFDPNDPSTFPVCRALASRF  263 (1078)
T ss_pred             HHHHHHHhccCCCChhhhHHHHHHHHHH
Confidence            3599999999999999888655454444


No 11 
>KOG3620|consensus
Probab=20.25  E-value=1e+02  Score=28.45  Aligned_cols=43  Identities=21%  Similarity=0.375  Sum_probs=28.8

Q ss_pred             eeeccCCCcccccccccccccc---ccCCC---eeecc---------cCCcceeeeee
Q psy12155         34 YNIFHPFDPVAYRIEPLIVPAM---EHVRP---VQVPH---------HKGRKRMHLGR   76 (78)
Q Consensus        34 yNIfhp~DPvAyRlEPli~~~~---~~~~P---~~iP~---------~~~~~r~h~~~   76 (78)
                      |-++--+|+.-|||.|++--+.   +.+.|   +..|+         |..|+-+|+||
T Consensus        74 y~vqG~g~~nPYRl~Pf~G~r~PmNss~sp~I~i~NPh~~plqi~EiysSGG~~hlEL  131 (1626)
T KOG3620|consen   74 YAVQGEGSENPYRLKPFVGIRAPMNSSLSPEIHIYNPHERPLQILEIYSSGGEFHLEL  131 (1626)
T ss_pred             EEEeccCCCCccccccccceecccccccCCceEecCCccCceEEEEEeccCccEEEec
Confidence            5667778999999999985432   23322   22233         45588999987


No 12 
>PRK02866 cyanate hydratase; Validated
Probab=20.12  E-value=34  Score=23.51  Aligned_cols=13  Identities=38%  Similarity=0.894  Sum_probs=10.2

Q ss_pred             CCCcccccccccc
Q psy12155         39 PFDPVAYRIEPLI   51 (78)
Q Consensus        39 p~DPvAyRlEPli   51 (78)
                      |+||+-||+--.+
T Consensus        81 ptdP~iYR~yE~v   93 (147)
T PRK02866         81 PTDPLIYRFYEMV   93 (147)
T ss_pred             CCCcHHHHHHHHH
Confidence            7899999985443


Done!