Query         psy12163
Match_columns 88
No_of_seqs    102 out of 396
Neff          5.9 
Searched_HMMs 46136
Date          Fri Aug 16 20:19:54 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy12163.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/12163hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF03124 EXS:  EXS family;  Int  99.9 4.7E-27   1E-31  177.8   3.1   83    5-88    237-334 (345)
  2 KOG1162|consensus               99.9 1.7E-23 3.7E-28  169.7   1.2   83    3-88    486-581 (617)
  3 COG5409 EXS domain-containing   99.6 1.1E-16 2.4E-21  123.4  -0.4   78    5-88    265-356 (384)
  4 PF12980 DUF3864:  Domain of Un  19.6      53  0.0012   20.6   0.8   11   26-36     39-49  (82)
  5 PF08412 Ion_trans_N:  Ion tran  18.3      43 0.00093   20.8   0.1   12   16-27     42-53  (77)
  6 PRK00104 scpA segregation and   12.8 1.5E+02  0.0033   21.6   1.8   17   70-86    204-220 (242)
  7 COG0525 ValS Valyl-tRNA synthe  11.7 1.1E+02  0.0024   27.1   1.0   21   11-31    630-650 (877)
  8 PF02616 ScpA_ScpB:  ScpA/B pro  10.1 1.7E+02  0.0036   20.9   1.3   17   70-86    208-224 (242)
  9 PF12534 DUF3733:  Leucine-rich   9.8      91   0.002   18.8  -0.1   10   21-30     22-31  (65)
 10 PF15018 InaF-motif:  TRP-inter   9.6   2E+02  0.0042   15.6   1.1   15   13-27     22-36  (38)

No 1  
>PF03124 EXS:  EXS family;  InterPro: IPR004342 The EXS domain is named after ERD1/XPR1/SYG1 and proteins containing this motif include the C-terminal of the SYG1 G-protein associated signal transduction protein from Saccharomyces cerevisiae, and sequences that are thought to be Murine leukemia virus (MLV) receptors (XPR1. The N-terminal of these proteins often have an SPX domain (IPR004331 from INTERPRO) []. While the N-terminal is thought to be involved in signal transduction, the role of the C-terminal is not known. This region of similarity contains several predicted transmembrane helices. This family also includes the ERD1 (ERD: ER retention defective) S. cerevisiae proteins. ERD1 proteins are involved in the localization of endogenous endoplasmic reticulum (ER) proteins. Erd1 null mutants secrete such proteins even though they possess the C-terminal HDEL ER lumen localization label sequence. In addition, null mutants also exhibit defects in the Golgi-dependent processing of several glycoproteins, which led to the suggestion that the sorting of luminal ER proteins actually occurs in the Golgi, with subsequent return of these proteins to the ER via `salvage' vesicles [].; GO: 0016021 integral to membrane
Probab=99.93  E-value=4.7e-27  Score=177.85  Aligned_cols=83  Identities=29%  Similarity=0.616  Sum_probs=72.7

Q ss_pred             chhHhHHHHHHhhhhhhhhhhcccccCcCCCCCCCCCCCCcccccCCCceEEEEEEEEcC----cchh-----------h
Q psy12163          5 FFYPWLAASVISSIYSYIWDIKMDWGLFDKNAPPDNPFLREETVYSSTTSTLIGYVLFNP----TGIL-----------M   69 (88)
Q Consensus         5 ~~~~wi~~~~inS~Ys~~WDv~mDWgL~~~~~~~~~~~LR~~l~y~~~~~Yy~Aiv~~n~----~~~~-----------~   69 (88)
                      .+.+|++++++||+||++|||+|||||+++++++++++||++++||+|++||+||+ .|.    .|+.           +
T Consensus       237 ~~~~w~~~~~i~s~Ys~~WDv~~DWgL~~~~~~~~~~~LR~~l~~~~~~~Yy~ai~-~n~ilRf~W~~~~~~~~~~~~~~  315 (345)
T PF03124_consen  237 LFILWIIFALINSLYSFYWDVKMDWGLFQPKKKSKNWLLRRRLLYPRKWFYYFAII-LNFILRFAWILTLSPPHFSHIDN  315 (345)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHhcccccCCccccCCCCCccccccCCcchhhhHHH-HHHHHHHHHHHHHHHhhcchhhh
Confidence            68899999999999999999999999999885458999999999999999999998 353    3322           3


Q ss_pred             hhHHHHHHHHHhhhhcccC
Q psy12163         70 IQFLQSITCLGGVVKTLAW   88 (88)
Q Consensus        70 ~~~~~~~~~~lEi~RR~iW   88 (88)
                      .+...++++++||+||++|
T Consensus       316 ~~~~~~~~~~lEi~RR~iW  334 (345)
T PF03124_consen  316 SEIFIFILAILEIFRRFIW  334 (345)
T ss_pred             HHHHHHHHHHHHHHHHHhh
Confidence            4677899999999999999


No 2  
>KOG1162|consensus
Probab=99.87  E-value=1.7e-23  Score=169.69  Aligned_cols=83  Identities=25%  Similarity=0.608  Sum_probs=72.4

Q ss_pred             CcchhHhHHHHHHhhhhhhhhhhcccccCcCCCCCCCCCCCCcccccCCCceEEEEEEE---EcCcchhh----------
Q psy12163          3 NPFFYPWLAASVISSIYSYIWDIKMDWGLFDKNAPPDNPFLREETVYSSTTSTLIGYVL---FNPTGILM----------   69 (88)
Q Consensus         3 ~~~~~~wi~~~~inS~Ys~~WDv~mDWgL~~~~~~~~~~~LR~~l~y~~~~~Yy~Aiv~---~n~~~~~~----------   69 (88)
                      ++++.+|++++.+||+|+++||++|||||+++++  + ++||++++||+|++||+||+.   ++..|+++          
T Consensus       486 ~~~~~l~~~~s~vaS~y~~~WDvv~DWgLl~~~~--~-~~lRd~l~~p~k~vYy~aiv~N~vLR~aW~~~~i~~~~~~~~  562 (617)
T KOG1162|consen  486 SLWFALWILSSKVASLYTTYWDVVMDWGLLNRKS--K-PWLRDNLLYPQKWVYYSAIVLNFVLRFAWFFKTILVFHEEFL  562 (617)
T ss_pred             chHHHHHHHHHHHHHHHHHHHHHheecccccccC--c-hhhHHHhcccchheehhHHHHHHHHHHHHHHHHHHHHHHhhh
Confidence            4789999999999999999999999999999886  4 999999999999999999983   23456321          


Q ss_pred             hhHHHHHHHHHhhhhcccC
Q psy12163         70 IQFLQSITCLGGVVKTLAW   88 (88)
Q Consensus        70 ~~~~~~~~~~lEi~RR~iW   88 (88)
                      .+.++++++.+||+||++|
T Consensus       563 ~~~~~~i~a~LEIiRRfiW  581 (617)
T KOG1162|consen  563 SDSMVFIMALLEIIRRFIW  581 (617)
T ss_pred             HHHHHHHHHHHHHHHhhhh
Confidence            3567899999999999999


No 3  
>COG5409 EXS domain-containing protein [Signal transduction mechanisms]
Probab=99.59  E-value=1.1e-16  Score=123.36  Aligned_cols=78  Identities=23%  Similarity=0.371  Sum_probs=61.5

Q ss_pred             chhHhHHHHHHhhhhhhhhhhcccccCcCCCCCCCCCCCCcccccCCCceEEEEEEEEcC----cchh---------hh-
Q psy12163          5 FFYPWLAASVISSIYSYIWDIKMDWGLFDKNAPPDNPFLREETVYSSTTSTLIGYVLFNP----TGIL---------MI-   70 (88)
Q Consensus         5 ~~~~wi~~~~inS~Ys~~WDv~mDWgL~~~~~~~~~~~LR~~l~y~~~~~Yy~Aiv~~n~----~~~~---------~~-   70 (88)
                      ++.+|++++.+||+||+.|||.|||++..+.++ .+..+|++++++    |++||++ |.    .|+.         +. 
T Consensus       265 l~~l~~~~a~lnS~yT~~WDV~mDW~l~~~~~~-~~~~kr~~~~l~----y~~a~~i-nFllR~~Wi~~~~~~~~~~~~~  338 (384)
T COG5409         265 LFHLQIWFALLNSIYTSFWDVFMDWSLDSLTSL-RSWSKRAVTLLK----YHIAMII-NFLLRFSWIVYYLPPNHIQHSA  338 (384)
T ss_pred             eehHHHHHHHHHHHHHHhHHhheeeeecccccc-hhccccchhHHH----HHHHHHH-HHHHHHHHHHhhcchhhhhhhh
Confidence            678999999999999999999999999777653 456778888777    8898873 43    3432         11 


Q ss_pred             hHHHHHHHHHhhhhcccC
Q psy12163         71 QFLQSITCLGGVVKTLAW   88 (88)
Q Consensus        71 ~~~~~~~~~lEi~RR~iW   88 (88)
                      +...|+++.+||+||++|
T Consensus       339 ~~~~F~m~~lEi~RR~vW  356 (384)
T COG5409         339 DIFIFIMQLLEILRRFVW  356 (384)
T ss_pred             hhHHHHHHHHHHHHhhee
Confidence            222289999999999999


No 4  
>PF12980 DUF3864:  Domain of Unknown Function with PDB structure (DUF3864);  InterPro: IPR024335 This entry represents a functionally uncharacterised domain found in bacterial sequences. The structure of one of the sequences, A6LGL1 from SWISSPROT from Parabacteroides distasonis atcc 8503, has been determined.; PDB: 3LM3_A.
Probab=19.62  E-value=53  Score=20.55  Aligned_cols=11  Identities=27%  Similarity=0.622  Sum_probs=3.1

Q ss_pred             cccccCcCCCC
Q psy12163         26 KMDWGLFDKNA   36 (88)
Q Consensus        26 ~mDWgL~~~~~   36 (88)
                      .+||+|++..+
T Consensus        39 akdwsl~n~in   49 (82)
T PF12980_consen   39 AKDWSLMNVIN   49 (82)
T ss_dssp             --B----SSB-
T ss_pred             ccchHHHHHHh
Confidence            46999987763


No 5  
>PF08412 Ion_trans_N:  Ion transport protein N-terminal;  InterPro: IPR013621 This domain is found to the N terminus of IPR005821 from INTERPRO in voltage- and cyclic nucleotide-gated K/Na ion channels. 
Probab=18.26  E-value=43  Score=20.75  Aligned_cols=12  Identities=33%  Similarity=0.847  Sum_probs=9.3

Q ss_pred             hhhhhhhhhhcc
Q psy12163         16 SSIYSYIWDIKM   27 (88)
Q Consensus        16 nS~Ys~~WDv~m   27 (88)
                      .|.+.++||+.|
T Consensus        42 ~S~fR~~WD~~m   53 (77)
T PF08412_consen   42 FSKFRFYWDLIM   53 (77)
T ss_pred             CccHHHHHHHHH
Confidence            367788999876


No 6  
>PRK00104 scpA segregation and condensation protein A; Reviewed
Probab=12.85  E-value=1.5e+02  Score=21.63  Aligned_cols=17  Identities=18%  Similarity=0.235  Sum_probs=13.9

Q ss_pred             hhHHHHHHHHHhhhhcc
Q psy12163         70 IQFLQSITCLGGVVKTL   86 (88)
Q Consensus        70 ~~~~~~~~~~lEi~RR~   86 (88)
                      .++.+.++|+||++|+.
T Consensus       204 ~~~v~tFLAlLEL~k~~  220 (242)
T PRK00104        204 NEFVVTFLALLELIKLQ  220 (242)
T ss_pred             hhhHHHHHHHHHHHhcC
Confidence            35677899999999975


No 7  
>COG0525 ValS Valyl-tRNA synthetase [Translation, ribosomal structure and biogenesis]
Probab=11.65  E-value=1.1e+02  Score=27.06  Aligned_cols=21  Identities=29%  Similarity=0.714  Sum_probs=18.2

Q ss_pred             HHHHHhhhhhhhhhhcccccC
Q psy12163         11 AASVISSIYSYIWDIKMDWGL   31 (88)
Q Consensus        11 ~~~~inS~Ys~~WDv~mDWgL   31 (88)
                      +..+.+++|.|.||...||=|
T Consensus       630 f~~a~~~ly~F~W~~fcD~Yl  650 (877)
T COG0525         630 FDEAARALYEFIWNDFCDWYL  650 (877)
T ss_pred             HHHHHHHHHHHhHHHHHHHHH
Confidence            345678999999999999998


No 8  
>PF02616 ScpA_ScpB:  ScpA/B protein;  InterPro: IPR003768 This family represents ScpA, which along with ScpB (IPR005234 from INTERPRO) interacts with SMC in vivo forming a complex that is required for chromosome condensation and segregation [, ]. The SMC-Scp complex appears to be similar to the MukB-MukE-Muk-F complex in Escherichia coli [], where MukB (IPR007406 from INTERPRO) is the homologue of SMC. ScpA and ScpB have little sequence similarity to MukE (IPR007385 from INTERPRO) or MukF (IPR005582 from INTERPRO), they are predicted to be structurally similar, being predominantly alpha-helical with coiled coil regions.  In general scpA and scpB form an operon in most bacterial genomes. Flanking genes are highly variable suggesting that the operon has moved throughout evolution. Bacteria containing an smc gene also contain scpA or scpB but not necessarily both. An exception is found in Deinococcus radiodurans, which contains scpB but neither smc nor scpA. In the archaea the gene order SMC-ScpA is conserved in nearly all species, as is the very short distance between the two genes, indicating co-transcription of the both in different archaeal genera and arguing that interaction of the gene products is not confined to the homologues in Bacillus subtilis. It would seem probable that, in light of all the studies, SMC, ScpA and ScpB proteins or homologues act together in chromosome condensation and segregation in all prokaryotes []. 
Probab=10.07  E-value=1.7e+02  Score=20.93  Aligned_cols=17  Identities=18%  Similarity=0.096  Sum_probs=14.2

Q ss_pred             hhHHHHHHHHHhhhhcc
Q psy12163         70 IQFLQSITCLGGVVKTL   86 (88)
Q Consensus        70 ~~~~~~~~~~lEi~RR~   86 (88)
                      .+..+.++|+||++|+.
T Consensus       208 ~~~V~tFLAlLeL~k~~  224 (242)
T PF02616_consen  208 SEVVVTFLALLELVKQG  224 (242)
T ss_pred             CeeHHHHHHHHHHhhcC
Confidence            45678999999999975


No 9  
>PF12534 DUF3733:  Leucine-rich repeat containing protein 8 ;  InterPro: IPR021040  This entry represents a conserved domain, approximately 60 amino acids in length, found in a number of eukaryotic protein; mostly as a duplicated N-terminal domain in proteins having a C-terminal leucine-rich repeat domain (PF00560 from PFAM). Each domain contains two completely conserved residues (W and Y) that may be functionally important. Most of the proteins in this entry are annotated as leucine-rich repeat containing protein 8, but beyond that there is little known about their function. 
Probab=9.83  E-value=91  Score=18.84  Aligned_cols=10  Identities=30%  Similarity=0.660  Sum_probs=7.2

Q ss_pred             hhhhhccccc
Q psy12163         21 YIWDIKMDWG   30 (88)
Q Consensus        21 ~~WDv~mDWg   30 (88)
                      =+||+.+|-=
T Consensus        22 PWwdvf~~YL   31 (65)
T PF12534_consen   22 PWWDVFFDYL   31 (65)
T ss_pred             cHHHHHHHHH
Confidence            3788888864


No 10 
>PF15018 InaF-motif:  TRP-interacting helix
Probab=9.56  E-value=2e+02  Score=15.65  Aligned_cols=15  Identities=40%  Similarity=0.829  Sum_probs=9.5

Q ss_pred             HHHhhhhhhhhhhcc
Q psy12163         13 SVISSIYSYIWDIKM   27 (88)
Q Consensus        13 ~~inS~Ys~~WDv~m   27 (88)
                      ..++--|.+.||=.|
T Consensus        22 i~LsiYY~f~W~p~~   36 (38)
T PF15018_consen   22 IVLSIYYIFFWDPDM   36 (38)
T ss_pred             HHHHHHHheeeCCCC
Confidence            344555888998543


Done!