Query         psy12164
Match_columns 57
No_of_seqs    96 out of 98
Neff          3.4 
Searched_HMMs 46136
Date          Fri Aug 16 20:20:55 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy12164.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/12164hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG0704|consensus               99.6 9.1E-16   2E-20  115.4   4.8   50    1-50     97-152 (386)
  2 PLN03114 ADP-ribosylation fact  97.0 0.00079 1.7E-08   51.7   3.6   26    1-26     99-124 (395)
  3 KOG0706|consensus               96.6  0.0012 2.7E-08   51.3   2.0   29    2-30    100-128 (454)
  4 COG5347 GTPase-activating prot  89.3    0.56 1.2E-05   34.8   3.7   32    1-32     98-129 (319)
  5 PF02151 UVR:  UvrB/uvrC motif;  70.2     4.3 9.3E-05   20.9   1.8   12   11-22     22-33  (36)
  6 KOG3616|consensus               39.8     5.7 0.00012   34.8  -1.3   35    7-41   1228-1268(1636)
  7 TIGR03231 anthran_1_2_B anthra  33.3      44 0.00095   21.8   2.3   21   14-34     59-79  (155)
  8 smart00105 ArfGap Putative GTP  28.9      33 0.00071   21.1   1.1   22    5-26     89-110 (112)
  9 PF03872 RseA_N:  Anti sigma-E   27.5      46   0.001   20.0   1.6   12   16-27      3-14  (87)
 10 PF12091 DUF3567:  Protein of u  25.6      81  0.0017   19.9   2.5   18   10-27     45-62  (85)
 11 TIGR03232 benzo_1_2_benB benzo  21.6   1E+02  0.0022   20.1   2.5   18   14-31     59-76  (155)
 12 KOG4466|consensus               21.5      76  0.0017   24.0   2.0   19    4-22     29-47  (291)

No 1  
>KOG0704|consensus
Probab=99.60  E-value=9.1e-16  Score=115.41  Aligned_cols=50  Identities=50%  Similarity=0.813  Sum_probs=42.9

Q ss_pred             CcchhhhcchHHHHHHHHHHHHHhCCCC-----CCCCCCCCCCCC-CCcCCCcccc
Q psy12164          1 MTIQQKYNTKAAALYRDKIATLARGEEW-----DQSKSSANSYVS-SNISSSSTGS   50 (57)
Q Consensus         1 ~~i~~KYNs~aAalYRdKI~alaEGr~W-----~~~~s~a~~~~p-~~~s~~~~~~   50 (57)
                      |+|++|||++||++|||||+||||||+|     ..++.|+.+|+| ++++.-++..
T Consensus        97 ~~i~eKYns~aAa~yRdki~~laegr~w~d~~~~k~~~p~~syt~a~~~~~~ss~~  152 (386)
T KOG0704|consen   97 WPIREKYNSRAAALYRDKIAALAEGREWNDPPYLKEDNPAQSYTSAAQLGSKSSET  152 (386)
T ss_pred             ccHHHhhccHHHHHHHHHHHHHhcCCcccccccccccCcccccccCCCcCCCcCCc
Confidence            7999999999999999999999999999     566678889999 7776655433


No 2  
>PLN03114 ADP-ribosylation factor GTPase-activating protein AGD10; Provisional
Probab=97.00  E-value=0.00079  Score=51.67  Aligned_cols=26  Identities=27%  Similarity=0.413  Sum_probs=23.1

Q ss_pred             CcchhhhcchHHHHHHHHHHHHHhCC
Q psy12164          1 MTIQQKYNTKAAALYRDKIATLARGE   26 (57)
Q Consensus         1 ~~i~~KYNs~aAalYRdKI~alaEGr   26 (57)
                      +++++||++++|++||++|++++++.
T Consensus        99 ~~~~~KY~S~aA~~Yre~L~keVa~~  124 (395)
T PLN03114         99 GKTEAKYTSRAADLYKQILAKEVAKS  124 (395)
T ss_pred             CCcccccCCHHHHHHHHHHHHHHHHh
Confidence            36789999999999999999998764


No 3  
>KOG0706|consensus
Probab=96.59  E-value=0.0012  Score=51.31  Aligned_cols=29  Identities=34%  Similarity=0.584  Sum_probs=23.6

Q ss_pred             cchhhhcchHHHHHHHHHHHHHhCCCCCC
Q psy12164          2 TIQQKYNTKAAALYRDKIATLARGEEWDQ   30 (57)
Q Consensus         2 ~i~~KYNs~aAalYRdKI~alaEGr~W~~   30 (57)
                      .++.|||++||.+||+||..|+.+..-..
T Consensus       100 d~~aKY~SraA~~Yr~kl~~lv~kam~~~  128 (454)
T KOG0706|consen  100 DANAKYNSRAAKLYREKLKKLVQKAMAEH  128 (454)
T ss_pred             hhhhhhccHHHHHHHHHHHHHHHHHHHhc
Confidence            46899999999999999998886544333


No 4  
>COG5347 GTPase-activating protein that regulates ARFs (ADP-ribosylation factors), involved in ARF-mediated vesicular transport [Intracellular trafficking and secretion]
Probab=89.33  E-value=0.56  Score=34.84  Aligned_cols=32  Identities=25%  Similarity=0.263  Sum_probs=28.3

Q ss_pred             CcchhhhcchHHHHHHHHHHHHHhCCCCCCCC
Q psy12164          1 MTIQQKYNTKAAALYRDKIATLARGEEWDQSK   32 (57)
Q Consensus         1 ~~i~~KYNs~aAalYRdKI~alaEGr~W~~~~   32 (57)
                      ++|+.|||+..|+.|+.|+..++.+..|....
T Consensus        98 ~~~k~~yd~~v~~~y~~~ky~~~~~~~~~~~~  129 (319)
T COG5347          98 LPIKAKYDSSVAKKYIRKKYELKKFIDDSSSP  129 (319)
T ss_pred             cccccccCHHHHHHHHHHHHHhhhccccccCc
Confidence            46889999999999999999999999994443


No 5  
>PF02151 UVR:  UvrB/uvrC motif;  InterPro: IPR001943 During the process of Escherichia coli nucleotide excision repair, DNA damage recognition and processing are achieved by the action of the uvrA, uvrB, and uvrC gene products []. UvrB and UvrC share a common domain of around 35 amino acids, the so called UVR domain. This domain in UvrB can interact with the homologous domain in UvrC throughout a putative coiled coil structure. This interaction is important for the incision of the damaged strand [].; GO: 0003677 DNA binding, 0004518 nuclease activity, 0006289 nucleotide-excision repair; PDB: 3PXG_D 3PXI_C 1E52_B 1QOJ_B 2D7D_B 2NMV_B.
Probab=70.25  E-value=4.3  Score=20.89  Aligned_cols=12  Identities=50%  Similarity=0.592  Sum_probs=10.2

Q ss_pred             HHHHHHHHHHHH
Q psy12164         11 AAALYRDKIATL   22 (57)
Q Consensus        11 aAalYRdKI~al   22 (57)
                      -|+.|||+|..|
T Consensus        22 ~Aa~~Rd~i~~l   33 (36)
T PF02151_consen   22 KAARLRDQIKAL   33 (36)
T ss_dssp             HHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHH
Confidence            478999999876


No 6  
>KOG3616|consensus
Probab=39.76  E-value=5.7  Score=34.77  Aligned_cols=35  Identities=26%  Similarity=0.467  Sum_probs=29.0

Q ss_pred             hcchHHHHH------HHHHHHHHhCCCCCCCCCCCCCCCCC
Q psy12164          7 YNTKAAALY------RDKIATLARGEEWDQSKSSANSYVSS   41 (57)
Q Consensus         7 YNs~aAalY------RdKI~alaEGr~W~~~~s~a~~~~p~   41 (57)
                      -|..||+||      |+-|-+++||++|......++.++|.
T Consensus      1228 ~~e~aael~l~f~~~keaida~~~~eewakakqvake~~p~ 1268 (1636)
T KOG3616|consen 1228 CHEAAAELLLLFDLSKEAIDAFCEAEEWAKAKQVAKELDPE 1268 (1636)
T ss_pred             ccHHHHHHHHHhhhHHHHHHHHHhHHHHHHHHHHHHHhCch
Confidence            477889887      78899999999999887777777664


No 7  
>TIGR03231 anthran_1_2_B anthranilate 1,2-dioxygenase, small subunit. Anthranilate (2-aminobenzoate) is an intermediate of tryptophan (Trp) biosynthesis and degradation. Members of this family are the small subunit of anthranilate 1,2-dioxygenase, which acts in Trp degradation by converting anthranilate to catechol. Closely related paralogs typically are the benzoate 1,2-dioxygenase small subunit, among the larger set of ring-hydroxylating dioxygenases.
Probab=33.31  E-value=44  Score=21.82  Aligned_cols=21  Identities=10%  Similarity=0.170  Sum_probs=18.1

Q ss_pred             HHHHHHHHHHhCCCCCCCCCC
Q psy12164         14 LYRDKIATLARGEEWDQSKSS   34 (57)
Q Consensus        14 lYRdKI~alaEGr~W~~~~s~   34 (57)
                      .-+++|..+..|+.|++-+.+
T Consensus        59 ~L~~RV~rl~~~~a~s~~P~s   79 (155)
T TIGR03231        59 GLEDRVFRIRTGKAASTTPMP   79 (155)
T ss_pred             HHHHHHHHHhCCCeeecCCCC
Confidence            569999999999999976654


No 8  
>smart00105 ArfGap Putative GTP-ase activating proteins for the small GTPase, ARF. Putative zinc fingers with GTPase activating proteins (GAPs) towards the small GTPase, Arf. The GAP of ARD1 stimulates GTPase hydrolysis for ARD1 but not ARFs.
Probab=28.91  E-value=33  Score=21.15  Aligned_cols=22  Identities=32%  Similarity=0.427  Sum_probs=10.2

Q ss_pred             hhhcchHHHHHHHHHHHHHhCC
Q psy12164          5 QKYNTKAAALYRDKIATLARGE   26 (57)
Q Consensus         5 ~KYNs~aAalYRdKI~alaEGr   26 (57)
                      ++|...+++-|++|.-...+|+
T Consensus        89 ~~~~~fI~~KY~~k~f~~~~~~  110 (112)
T smart00105       89 QKYESFIAAKYEEKLFVPPESA  110 (112)
T ss_pred             HHHHHHHHHHHHhhhccccccC
Confidence            3444444455555444444443


No 9  
>PF03872 RseA_N:  Anti sigma-E protein RseA, N-terminal domain;  InterPro: IPR005572  Sigma-E is important for the induction of proteins involved in heat shock response. RseA binds sigma-E via its N-terminal domain, sequestering sigma-E and preventing transcription from heat-shock promoters []. The C-terminal domain is located in the periplasm, and may interact with other protein that signal periplasmic stress.; GO: 0016989 sigma factor antagonist activity; PDB: 1OR7_F 1YFN_G.
Probab=27.52  E-value=46  Score=20.01  Aligned_cols=12  Identities=25%  Similarity=0.567  Sum_probs=9.9

Q ss_pred             HHHHHHHHhCCC
Q psy12164         16 RDKIATLARGEE   27 (57)
Q Consensus        16 RdKI~alaEGr~   27 (57)
                      +++|+||.+|..
T Consensus         3 ~E~lSAL~DGEl   14 (87)
T PF03872_consen    3 KESLSALMDGEL   14 (87)
T ss_dssp             HHHHHHHHTTS-
T ss_pred             HHHHHHHHcCCC
Confidence            689999999974


No 10 
>PF12091 DUF3567:  Protein of unknown function (DUF3567);  InterPro: IPR021951  This family of proteins is functionally uncharacterised. This protein is found in bacteria. Proteins in this family are about 90 amino acids in length. This protein has a conserved EIVDK sequence motif. 
Probab=25.64  E-value=81  Score=19.86  Aligned_cols=18  Identities=22%  Similarity=0.451  Sum_probs=15.3

Q ss_pred             hHHHHHHHHHHHHHhCCC
Q psy12164         10 KAAALYRDKIATLARGEE   27 (57)
Q Consensus        10 ~aAalYRdKI~alaEGr~   27 (57)
                      ..|+.+|+.|.+|.+..+
T Consensus        45 ~~Ae~Fr~~V~~li~~~P   62 (85)
T PF12091_consen   45 SWAEMFREDVQALIASEP   62 (85)
T ss_pred             HHHHHHHHHHHHHHhcCC
Confidence            379999999999998753


No 11 
>TIGR03232 benzo_1_2_benB benzoate 1,2-dioxygenase, small subunit. Benzoate 1,2-dioxygenase (EC 1.14.12.10) belongs to the larger family of aromatic ring-hydroxylating dioxygenases. Members of this family should all act on benzoate, but several have additional known activities on various benozate analogs. Some members actually may be named more suitably according to such alternate an activity, such as 2-chlorobenzoate 1,2-dioxygenase (1.14.12.13).
Probab=21.60  E-value=1e+02  Score=20.14  Aligned_cols=18  Identities=6%  Similarity=0.028  Sum_probs=16.3

Q ss_pred             HHHHHHHHHHhCCCCCCC
Q psy12164         14 LYRDKIATLARGEEWDQS   31 (57)
Q Consensus        14 lYRdKI~alaEGr~W~~~   31 (57)
                      .-+++|..|..|+.|++-
T Consensus        59 ~L~~RV~rL~t~~a~se~   76 (155)
T TIGR03232        59 GLEDRVFRIKTERSSATV   76 (155)
T ss_pred             HHHHHHHHHhcCCceecC
Confidence            679999999999999983


No 12 
>KOG4466|consensus
Probab=21.50  E-value=76  Score=24.00  Aligned_cols=19  Identities=26%  Similarity=0.672  Sum_probs=15.1

Q ss_pred             hhhhcchHHHHHHHHHHHH
Q psy12164          4 QQKYNTKAAALYRDKIATL   22 (57)
Q Consensus         4 ~~KYNs~aAalYRdKI~al   22 (57)
                      -+-|+..-+.+||||++.|
T Consensus        29 ~~~f~elkeq~yk~kLa~L   47 (291)
T KOG4466|consen   29 EKQFSELKEQMYKDKLAQL   47 (291)
T ss_pred             hhhhhHHHHHHHHHHHHHH
Confidence            3457788889999998876


Done!