Diaphorina citri psyllid: psy12168


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150
MSNVTSKEGVIRDSNLYAHYVFKAFDVNCNGAISFRDLLVTLSTLLRGSIYEKLRWTFKLYDINGDGCISRSELTQIVQAVHELMGRKNQTDAARKAKEQIDFVFRKLDLNDDGVVTLEEFIESCLKVSTQLEKSIESCLKVSTQNLRNL
ccHHHHHcccccccHHHHHHHHHcccccccccEEHHHHHHHHHHcccccHHHHHHHHHHcECccccccEEHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHccccccccccHHHHHHHHHccHHHHHHHHHccccHHHHHHccc
MSNVTSKEGVIRDSNLYAHYVFKAFDVNCNGAISFRDLLVTLSTLLRGSIYEKLRWTFKLYDINGDGCISRSELTQIVQAVHELMG***********KEQIDFVFRKLDLNDDGVVTLEEFIESCLKVSTQLEKSIESCLKVS*******
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSNVTSKEGVIRDSNLYAHYVFKAFDVNCNGAISFRDLLVTLSTLLRGSIYEKLRWTFKLYDINGDGCISRSELTQIVQAVHELMGRKNQTDAARKAKEQIDFVFRKLDLNDDGVVTLEEFIESCLKVSTQLEKSIESCLKVSTQNLRNL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0008048 [MF]calcium sensitive guanylate cyclase activator activityprobableGO:0030249, GO:0030234, GO:0030250, GO:0008047, GO:0003674, GO:0010851, GO:0010853
GO:0051716 [BP]cellular response to stimulusprobableGO:0008150, GO:0050896, GO:0009987, GO:0044763, GO:0044699
GO:0001750 [CC]photoreceptor outer segmentprobableGO:0072372, GO:0043231, GO:0044464, GO:0005623, GO:0031513, GO:0005575, GO:0043229, GO:0005929, GO:0044424, GO:0042995, GO:0043227, GO:0043226, GO:0005622
GO:0043025 [CC]neuronal cell bodyprobableGO:0005575, GO:0097458, GO:0044297, GO:0005623, GO:0044464
GO:0048812 [BP]neuron projection morphogenesisprobableGO:0032502, GO:0044707, GO:0030030, GO:0030154, GO:0048468, GO:0031175, GO:0009653, GO:0007275, GO:0071840, GO:0000902, GO:0048869, GO:0016043, GO:0032989, GO:0044699, GO:0048666, GO:0032501, GO:0030182, GO:0009987, GO:0044767, GO:0044763, GO:0048731, GO:0022008, GO:0032990, GO:0048699, GO:0048858, GO:0007399, GO:0048856, GO:0008150
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0001917 [CC]photoreceptor inner segmentprobableGO:0005575, GO:0044464, GO:0005623
GO:0016247 [MF]channel regulator activityprobableGO:0003674
GO:0008092 [MF]cytoskeletal protein bindingprobableGO:0003674, GO:0005488, GO:0005515
GO:0030425 [CC]dendriteprobableGO:0044464, GO:0005623, GO:0005575, GO:0097458, GO:0043005, GO:0042995
GO:0032991 [CC]macromolecular complexprobableGO:0005575
GO:0031284 [BP]positive regulation of guanylate cyclase activityprobableGO:0019220, GO:0031281, GO:0031282, GO:0031326, GO:0031323, GO:1900371, GO:0050789, GO:0043085, GO:0080090, GO:0019222, GO:0051349, GO:0065007, GO:0044093, GO:0065009, GO:0019219, GO:0050790, GO:0009889, GO:0050794, GO:0051174, GO:0008150, GO:0051171, GO:0030799, GO:0031279, GO:0030826, GO:0030802, GO:1900542, GO:0030823, GO:0030808, GO:0051339, GO:0006140
GO:0048190 [BP]wing disc dorsal/ventral pattern formationprobableGO:0032502, GO:0007389, GO:0032501, GO:0009953, GO:0044707, GO:0007444, GO:0007450, GO:0048856, GO:0035222, GO:0035220, GO:0044767, GO:0048513, GO:0008150, GO:0003002, GO:0048731, GO:0007447, GO:0007275, GO:0044699
GO:0005886 [CC]plasma membraneprobableGO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2R2I, chain A
Confidence level:very confident
Coverage over the Query: 15-129
View the alignment between query and template
View the model in PyMOL
Template: 2BE4, chain A
Confidence level:very confident
Coverage over the Query: 13-144
View the alignment between query and template
View the model in PyMOL