Query         psy1217
Match_columns 130
No_of_seqs    135 out of 239
Neff          2.8 
Searched_HMMs 46136
Date          Fri Aug 16 20:28:30 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy1217.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/1217hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG3245|consensus               99.9 1.9E-24   4E-29  160.0   4.3   83    4-130    21-106 (106)
  2 PF07896 DUF1674:  Protein of u  99.8 5.5E-20 1.2E-24  119.7   0.2   44   83-130     4-47  (47)
  3 COG5508 Uncharacterized conser  99.4 3.8E-14 8.2E-19  101.9   1.9   29  102-130    56-84  (84)
  4 PF12124 Nsp3_PL2pro:  Coronavi  17.0      57  0.0012   22.7   0.5   13  117-129    14-26  (66)
  5 KOG3102|consensus               15.8 2.5E+02  0.0055   24.3   4.1   24   93-117    41-64  (269)
  6 PF01989 DUF126:  Protein of un  15.0      75  0.0016   22.6   0.7   16   95-110     3-18  (82)
  7 COG1786 Swiveling domain assoc  15.0      85  0.0018   24.6   1.1   18   95-112    25-42  (131)
  8 cd07496 Peptidases_S8_13 Pepti   9.6 3.8E+02  0.0083   21.1   3.3   43   83-125    13-55  (285)
  9 cd05853 Ig6_Contactin-4 Sixth    9.3 1.4E+02   0.003   20.4   0.6   11  120-130    20-30  (85)
 10 PF06419 COG6:  Conserved oligo   7.8 1.3E+02  0.0028   27.7  -0.1    7  114-120   249-256 (618)

No 1  
>KOG3245|consensus
Probab=99.90  E-value=1.9e-24  Score=159.97  Aligned_cols=83  Identities=53%  Similarity=0.920  Sum_probs=72.1

Q ss_pred             cceeccCCCCCchhhhhhhh--hhccCCCCccchhhccCCCCCC-cCCcCCCCCCCCCCCCcccccccccccCCCcchhc
Q psy1217           4 ARLCRVPAPGELYSKQVAIV--IRSSKVPIGKLEELDAGKHPYQ-EKEPLEAWPDNTNPHKGYEITLKNVFDIPGKLEEL   80 (130)
Q Consensus         4 ~r~c~~p~~~~~~sk~~~~~--~~~~~~p~~~l~~~~~~~H~~~-~KEPl~~w~~NqsP~sG~~~~~k~~~d~~~~~~e~   80 (130)
                      +|+.+.+.+....||++..+  +.-++.|...|+++ .+.|+++ +||||+.|                           
T Consensus        21 ~~s~ll~~~~~k~~k~~~~~qel~r~~~p~~~L~e~-~a~~~~~~Ekepl~~~---------------------------   72 (106)
T KOG3245|consen   21 ARSELLCHPLRKTSKSQGAFQELLRQSLPLPMLPEG-DAPHPSHLEKEPLKPW---------------------------   72 (106)
T ss_pred             ccccccCCCCCCCccccchhHHHHHhhcCccccccc-cccChhhhhcccCCCC---------------------------
Confidence            46777778899999988887  33377899999998 4788888 88888888                           


Q ss_pred             ccCCCCCccCCCCCCCCCCCCCCCCCCCCCCCCCCCcccccccCCeeecC
Q psy1217          81 DAGKHPYQEKEPLEAWPDNTNPHTGEIGGPRGPEPTRYGDWERKGRVTDF  130 (130)
Q Consensus        81 ~~~~hP~~~~~~~~~f~~~vnp~tgE~gGpk~~EPtryGDWe~~Gr~~DF  130 (130)
                                      +++|||.|||||||.|+|||||||||++|||+||
T Consensus        73 ----------------p~~vNp~TgEiGGprGPEPTRYGDWErkgr~~~F  106 (106)
T KOG3245|consen   73 ----------------PNDVNPYTGEIGGPRGPEPTRYGDWERKGRCSDF  106 (106)
T ss_pred             ----------------cccCCccccccCCCCCCCCccccchhhccccccC
Confidence                            6789999999999999999999999999999999


No 2  
>PF07896 DUF1674:  Protein of unknown function (DUF1674);  InterPro: IPR012875 The members of this family are sequences derived from hypothetical eukaryotic and bacterial proteins. The region in question is approximately 60 residues long. ; PDB: 2K5K_A.
Probab=99.76  E-value=5.5e-20  Score=119.65  Aligned_cols=44  Identities=61%  Similarity=1.224  Sum_probs=7.8

Q ss_pred             CCCCCccCCCCCCCCCCCCCCCCCCCCCCCCCCCcccccccCCeeecC
Q psy1217          83 GKHPYQEKEPLEAWPDNTNPHTGEIGGPRGPEPTRYGDWERKGRVTDF  130 (130)
Q Consensus        83 ~~hP~~~~~~~~~f~~~vnp~tgE~gGpk~~EPtryGDWe~~Gr~~DF  130 (130)
                      ..|++++....    .+++|+|+|+|||+|+|||||||||+|||||||
T Consensus         4 ~rr~~~~~~~~----~~~~P~~~E~gGp~g~ePtRyGDWe~kGr~~DF   47 (47)
T PF07896_consen    4 ERRPDARAAAK----GDVNPKTGEIGGPKGPEPTRYGDWERKGRASDF   47 (47)
T ss_dssp             T--TTTTT----------------S---------S-------STT---
T ss_pred             HHhhhHhhccc----cccCCCccccCCCCCCCCccccccccCCEeccC
Confidence            34555443222    889999999999999999999999999999999


No 3  
>COG5508 Uncharacterized conserved small protein [Function unknown]
Probab=99.43  E-value=3.8e-14  Score=101.89  Aligned_cols=29  Identities=69%  Similarity=1.212  Sum_probs=27.6

Q ss_pred             CCCCCCCCCCCCCCCcccccccCCeeecC
Q psy1217         102 PHTGEIGGPRGPEPTRYGDWERKGRVTDF  130 (130)
Q Consensus       102 p~tgE~gGpk~~EPtryGDWe~~Gr~~DF  130 (130)
                      ++..||||.+|+|||||||||.|||||||
T Consensus        56 s~pkEiGGrgGlePtRyGDWe~KGr~iDF   84 (84)
T COG5508          56 SLPKEIGGRGGLEPTRYGDWEHKGRVIDF   84 (84)
T ss_pred             ccchhhCCCCCCCccccccccccceecCC
Confidence            46789999999999999999999999999


No 4  
>PF12124 Nsp3_PL2pro:  Coronavirus polyprotein cleavage domain;  InterPro: IPR022733  This domain is found in SARS coronaviruses, and is about 70 amino acids in length. It is found associated with various other coronavirus proteins due to the polyprotein nature of most viral translation. PL2pro is a domain of the non-structural protein nsp3. The domain performs three of the cleavages required to separate the translated polyprotein into its distinct proteins. ; GO: 0004197 cysteine-type endopeptidase activity, 0008242 omega peptidase activity, 0016740 transferase activity, 0016788 hydrolase activity, acting on ester bonds, 0016817 hydrolase activity, acting on acid anhydrides; PDB: 2KAF_A 2KQW_A.
Probab=16.97  E-value=57  Score=22.74  Aligned_cols=13  Identities=38%  Similarity=0.905  Sum_probs=6.5

Q ss_pred             cccccccCCeeec
Q psy1217         117 RYGDWERKGRVTD  129 (130)
Q Consensus       117 ryGDWe~~Gr~~D  129 (130)
                      .|-||++.|..+.
T Consensus        14 sy~dwsysgqrte   26 (66)
T PF12124_consen   14 SYRDWSYSGQRTE   26 (66)
T ss_dssp             EETTEE----EET
T ss_pred             cccccccccceeh
Confidence            3779999997664


No 5  
>KOG3102|consensus
Probab=15.76  E-value=2.5e+02  Score=24.31  Aligned_cols=24  Identities=21%  Similarity=0.140  Sum_probs=11.4

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCc
Q psy1217          93 LEAWPDNTNPHTGEIGGPRGPEPTR  117 (130)
Q Consensus        93 ~~~f~~~vnp~tgE~gGpk~~EPtr  117 (130)
                      +|.-.-.++|++|---++.. .||.
T Consensus        41 lp~~dsil~pkpg~eef~eD-vpte   64 (269)
T KOG3102|consen   41 LPLLDSILSPKPGSEEFFED-VPTE   64 (269)
T ss_pred             CCchhhhcCCCCCccccccc-Cccc
Confidence            33333455555555555544 3443


No 6  
>PF01989 DUF126:  Protein of unknown function DUF126;  InterPro: IPR002840 These archaebacterial proteins have no known function.; PDB: 2HI6_A.
Probab=15.05  E-value=75  Score=22.55  Aligned_cols=16  Identities=25%  Similarity=0.347  Sum_probs=8.8

Q ss_pred             CCCCCCCCCCCCCCCC
Q psy1217          95 AWPDNTNPHTGEIGGP  110 (130)
Q Consensus        95 ~f~~~vnp~tgE~gGp  110 (130)
                      .|=+++||+||++--+
T Consensus         3 Sf~ggvDp~tG~ii~~   18 (82)
T PF01989_consen    3 SFWGGVDPETGVIIDK   18 (82)
T ss_dssp             -TTS-B-TTT-BB-S-
T ss_pred             cccccccCCceEEEec
Confidence            4789999999999644


No 7  
>COG1786 Swiveling domain associated with predicted aconitase [Energy    production and conversion]
Probab=15.01  E-value=85  Score=24.63  Aligned_cols=18  Identities=22%  Similarity=0.536  Sum_probs=15.9

Q ss_pred             CCCCCCCCCCCCCCCCCC
Q psy1217          95 AWPDNTNPHTGEIGGPRG  112 (130)
Q Consensus        95 ~f~~~vnp~tgE~gGpk~  112 (130)
                      .|=|.|||.||++-+++-
T Consensus        25 SFlGgVDPeTG~vid~~h   42 (131)
T COG1786          25 SFLGGVDPETGKVIDPHH   42 (131)
T ss_pred             eeecccCcccccCcCCCC
Confidence            689999999999998753


No 8  
>cd07496 Peptidases_S8_13 Peptidase S8 family domain, uncharacterized subfamily 13. This family is a member of the Peptidases S8 or Subtilases serine endo- and exo-peptidase clan. They have an Asp/His/Ser catalytic triad similar to that found in trypsin-like proteases, but do not share their three-dimensional structure and are not homologous to trypsin. The stability of subtilases may be enhanced by calcium, some members have been shown to bind up to 4 ions via binding sites with different affinity. Some members of this clan contain disulfide bonds. These enzymes can be intra- and extracellular, some function at extreme temperatures and pH values.
Probab=9.61  E-value=3.8e+02  Score=21.08  Aligned_cols=43  Identities=26%  Similarity=0.381  Sum_probs=25.1

Q ss_pred             CCCCCccCCCCCCCCCCCCCCCCCCCCCCCCCCCcccccccCC
Q psy1217          83 GKHPYQEKEPLEAWPDNTNPHTGEIGGPRGPEPTRYGDWERKG  125 (130)
Q Consensus        83 ~~hP~~~~~~~~~f~~~vnp~tgE~gGpk~~EPtryGDWe~~G  125 (130)
                      ..||++....+..+.-..+.....-|.....+|...+||...+
T Consensus        13 ~~Hp~l~~~~~~g~d~~~~~~~~~~~~~~~~~~~d~~~~~~~~   55 (285)
T cd07496          13 FHHPDLAGVLLPGYDFISDPAIANDGDGRDSDPTDPGDWVTGD   55 (285)
T ss_pred             CCCcchhhccccCcccccCcccccCCCCCCCCCCCcccccccc
Confidence            4688887666555532223333333434455788888987654


No 9  
>cd05853 Ig6_Contactin-4 Sixth Ig domain of contactin-4. Ig6_Contactin-4: sixth Ig domain of the neural cell adhesion molecule contactin-4. Contactins are neural cell adhesion molecules, and are comprised of six Ig domains followed by four fibronectin type III (FnIII) domains anchored to the membrane by glycosylphosphatidylinositol. The different contactins show different expression patterns in the central nervous system. Highest expresson of contactin-4 is in testes, thyroid, small intestine, uterus and brain. Contactin-4 plays a role in the response of neuroblastoma cells to differentiating agents, such as retinoids. The contactin 4 gene is associated with cerebellar degeneration in spinocerebellar ataxia type 16.
Probab=9.30  E-value=1.4e+02  Score=20.43  Aligned_cols=11  Identities=36%  Similarity=0.972  Sum_probs=9.5

Q ss_pred             ccccCCeeecC
Q psy1217         120 DWERKGRVTDF  130 (130)
Q Consensus       120 DWe~~Gr~~DF  130 (130)
                      .|.++|+.+||
T Consensus        20 ~W~~dg~~i~~   30 (85)
T cd05853          20 TWSFNGHLIDF   30 (85)
T ss_pred             EEEECCEECcc
Confidence            89999998875


No 10 
>PF06419 COG6:  Conserved oligomeric complex COG6;  InterPro: IPR010490 COG6 is a component of the conserved oligomeric golgi complex, which is composed of eight different subunits and is required for normal golgi morphology and localisation.
Probab=7.79  E-value=1.3e+02  Score=27.68  Aligned_cols=7  Identities=71%  Similarity=1.559  Sum_probs=6.2

Q ss_pred             CCCcc-cc
Q psy1217         114 EPTRY-GD  120 (130)
Q Consensus       114 EPtry-GD  120 (130)
                      ||+|| ||
T Consensus       249 DP~RYvGD  256 (618)
T PF06419_consen  249 DPLRYVGD  256 (618)
T ss_pred             ChHHHHHH
Confidence            89998 87


Done!