Query         psy12195
Match_columns 254
No_of_seqs    148 out of 1798
Neff          11.1
Searched_HMMs 46136
Date          Fri Aug 16 21:15:54 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy12195.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/12195hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG2462|consensus              100.0 3.6E-32 7.7E-37  198.2   6.2  139  101-242   127-266 (279)
  2 KOG3608|consensus              100.0 1.6E-29 3.5E-34  189.4  11.0  231   14-253   133-386 (467)
  3 KOG2462|consensus               99.9   5E-27 1.1E-31  171.4   5.5  116  134-254   130-249 (279)
  4 KOG1074|consensus               99.9 8.1E-25 1.7E-29  180.7   5.9  170   75-250   605-937 (958)
  5 KOG3608|consensus               99.9 7.1E-24 1.5E-28  159.3   8.6  202   45-251   135-355 (467)
  6 KOG3623|consensus               99.9 5.7E-23 1.2E-27  167.5   2.7  109   15-124   210-329 (1007)
  7 KOG1074|consensus               99.8 1.2E-21 2.5E-26  162.3  -2.3   84  160-245   604-693 (958)
  8 KOG3576|consensus               99.7 3.2E-18 6.9E-23  119.5   3.1  112  134-246   117-239 (267)
  9 KOG3623|consensus               99.6 2.7E-16 5.9E-21  129.0   3.3  105  105-210   211-330 (1007)
 10 KOG3576|consensus               99.6 7.3E-17 1.6E-21  112.8  -0.2   88  160-249   116-203 (267)
 11 PLN03086 PRLI-interacting fact  99.3 7.1E-12 1.5E-16  103.5   9.0  147   75-244   407-565 (567)
 12 PHA00733 hypothetical protein   99.3 3.8E-12 8.1E-17   86.0   4.9   80  160-243    39-123 (128)
 13 PLN03086 PRLI-interacting fact  99.2 9.3E-11   2E-15   97.0  10.8  146   44-214   407-565 (567)
 14 PHA00733 hypothetical protein   99.2 3.5E-11 7.7E-16   81.3   5.5   80  134-215    40-125 (128)
 15 PHA02768 hypothetical protein;  99.1 5.6E-11 1.2E-15   66.1   1.8   42  190-235     6-47  (55)
 16 PHA02768 hypothetical protein;  99.0 8.6E-11 1.9E-15   65.3   1.7   44  161-206     5-48  (55)
 17 PF05605 zf-Di19:  Drought indu  98.9 2.8E-09 6.1E-14   60.8   5.1   53  189-244     2-54  (54)
 18 PF13465 zf-H2C2_2:  Zinc-finge  98.9 1.2E-09 2.6E-14   52.0   2.0   26  176-201     1-26  (26)
 19 KOG3993|consensus               98.8   9E-10   2E-14   86.0  -0.5  167   75-246   267-485 (500)
 20 PHA00616 hypothetical protein   98.7   5E-09 1.1E-13   55.4   1.7   32  219-251     1-32  (44)
 21 KOG3993|consensus               98.6 4.4E-09 9.6E-14   82.2  -1.1  201   13-215   265-484 (500)
 22 PHA00732 hypothetical protein   98.6 5.2E-08 1.1E-12   59.7   2.9   55  161-222     1-56  (79)
 23 PHA00616 hypothetical protein   98.5 5.3E-08 1.2E-12   51.5   1.4   25  189-213     1-25  (44)
 24 PF13465 zf-H2C2_2:  Zinc-finge  98.4 1.5E-07 3.2E-12   44.7   1.6   26  204-231     1-26  (26)
 25 PHA00732 hypothetical protein   98.4 3.1E-07 6.6E-12   56.3   2.6   44  189-239     1-44  (79)
 26 PF00096 zf-C2H2:  Zinc finger,  98.2 7.2E-07 1.6E-11   41.1   1.1   21  220-240     1-21  (23)
 27 PF05605 zf-Di19:  Drought indu  98.2   4E-06 8.6E-11   47.7   4.1   37  105-142     3-39  (54)
 28 PF13894 zf-C2H2_4:  C2H2-type   97.9 4.8E-06   1E-10   38.7   1.5   22  220-241     1-22  (24)
 29 PF00096 zf-C2H2:  Zinc finger,  97.9 6.3E-06 1.4E-10   37.9   1.9   22  190-211     1-22  (23)
 30 COG5189 SFP1 Putative transcri  97.9 1.8E-06   4E-11   65.4  -0.0   54  186-239   346-418 (423)
 31 PF13894 zf-C2H2_4:  C2H2-type   97.8 1.5E-05 3.2E-10   37.0   2.2   24  190-213     1-24  (24)
 32 PF12756 zf-C2H2_2:  C2H2 type   97.8 9.6E-06 2.1E-10   52.9   2.1   23  137-159     2-24  (100)
 33 PF12756 zf-C2H2_2:  C2H2 type   97.8 1.1E-05 2.4E-10   52.5   2.4   21  220-240    51-71  (100)
 34 PF13912 zf-C2H2_6:  C2H2-type   97.7 2.2E-05 4.8E-10   37.6   1.2   20  220-239     2-21  (27)
 35 COG5189 SFP1 Putative transcri  97.7 9.5E-06   2E-10   61.7  -0.2   52  159-210   347-419 (423)
 36 PF13912 zf-C2H2_6:  C2H2-type   97.6 1.5E-05 3.2E-10   38.2   0.3   25  189-213     1-25  (27)
 37 PF09237 GAGA:  GAGA factor;  I  97.3   8E-05 1.7E-09   40.4   0.6   30  216-245    21-50  (54)
 38 smart00355 ZnF_C2H2 zinc finge  97.3 0.00023 4.9E-09   33.4   2.1   20  220-239     1-20  (26)
 39 PF13909 zf-H2C2_5:  C2H2-type   97.3 0.00015 3.3E-09   33.5   1.4   23  220-243     1-23  (24)
 40 smart00355 ZnF_C2H2 zinc finge  96.9  0.0012 2.7E-08   30.8   2.6   21  190-210     1-21  (26)
 41 PRK04860 hypothetical protein;  96.8 0.00078 1.7E-08   47.5   2.2   38  160-201   118-155 (160)
 42 PF12874 zf-met:  Zinc-finger o  96.8 0.00043 9.2E-09   32.3   0.6   20  220-239     1-20  (25)
 43 PF13909 zf-H2C2_5:  C2H2-type   96.7  0.0017 3.7E-08   29.9   2.3   23  190-213     1-23  (24)
 44 PF12874 zf-met:  Zinc-finger o  96.6  0.0013 2.8E-08   30.6   1.5   18  192-209     3-20  (25)
 45 PF09237 GAGA:  GAGA factor;  I  96.6  0.0025 5.5E-08   34.7   2.5   30  186-215    21-50  (54)
 46 PF12171 zf-C2H2_jaz:  Zinc-fin  96.5 0.00039 8.4E-09   33.2  -0.7   20  220-239     2-21  (27)
 47 PF12171 zf-C2H2_jaz:  Zinc-fin  96.2  0.0034 7.3E-08   29.9   1.6   22   16-37      2-23  (27)
 48 KOG2482|consensus               96.1   0.021 4.5E-07   44.5   6.2  147   90-239   130-354 (423)
 49 PRK04860 hypothetical protein;  95.7  0.0049 1.1E-07   43.5   1.1   40  188-233   118-157 (160)
 50 KOG1146|consensus               95.7  0.0029 6.3E-08   57.7  -0.1   61  188-248   517-618 (1406)
 51 KOG2231|consensus               95.5   0.057 1.2E-06   46.7   6.8   69  162-240   183-260 (669)
 52 PF13913 zf-C2HC_2:  zinc-finge  95.4   0.013 2.9E-07   27.2   1.7   18  221-239     4-21  (25)
 53 KOG2231|consensus               95.1    0.14   3E-06   44.4   7.9   19  137-155   185-203 (669)
 54 KOG2482|consensus               94.5    0.13 2.7E-06   40.4   5.7   22  189-210   334-355 (423)
 55 KOG1146|consensus               94.3   0.018 3.9E-07   52.9   1.1   76  166-241   441-540 (1406)
 56 COG4049 Uncharacterized protei  94.1   0.027 5.8E-07   31.2   1.1   30  185-214    13-42  (65)
 57 smart00451 ZnF_U1 U1-like zinc  94.1   0.032 6.8E-07   28.2   1.4   23  219-241     3-25  (35)
 58 KOG4173|consensus               94.1   0.013 2.8E-07   42.2  -0.2   87   13-103    77-174 (253)
 59 smart00451 ZnF_U1 U1-like zinc  94.0   0.049 1.1E-06   27.5   2.0   22  189-210     3-24  (35)
 60 KOG4173|consensus               93.7   0.046 9.9E-07   39.5   1.9   79  135-215    80-172 (253)
 61 cd00350 rubredoxin_like Rubred  93.5    0.04 8.7E-07   27.5   1.1    9  163-171     3-11  (33)
 62 PF12907 zf-met2:  Zinc-binding  93.3   0.053 1.1E-06   28.3   1.3   32  220-251     2-36  (40)
 63 KOG2785|consensus               93.1    0.52 1.1E-05   37.7   7.1   55  188-242   165-243 (390)
 64 KOG2893|consensus               92.2   0.028   6E-07   41.5  -0.9   48   45-99     11-58  (341)
 65 COG4049 Uncharacterized protei  92.1   0.064 1.4E-06   29.8   0.7   30   10-39     12-41  (65)
 66 PF12013 DUF3505:  Protein of u  91.3    0.46 9.9E-06   31.4   4.2   25  219-243    80-108 (109)
 67 KOG2785|consensus               91.2    0.47   1E-05   38.0   4.8   24   15-38      3-26  (390)
 68 KOG2893|consensus               91.1    0.07 1.5E-06   39.5   0.2   41  192-238    13-53  (341)
 69 PF06524 NOA36:  NOA36 protein;  90.9    0.19 4.1E-06   37.9   2.3   81   10-91    137-225 (314)
 70 COG5236 Uncharacterized conser  90.5    0.51 1.1E-05   37.2   4.4  124  110-244   159-306 (493)
 71 COG5236 Uncharacterized conser  90.3    0.32 6.9E-06   38.3   3.1  103  134-243   151-275 (493)
 72 TIGR00373 conserved hypothetic  89.8    0.36 7.8E-06   34.2   2.9   33  185-228   105-137 (158)
 73 cd00729 rubredoxin_SM Rubredox  89.8    0.19 4.2E-06   25.3   1.1   25  189-227     2-26  (34)
 74 PF09538 FYDLN_acid:  Protein o  89.6    0.23 4.9E-06   32.6   1.6   14  219-232    26-39  (108)
 75 PF12013 DUF3505:  Protein of u  89.4    0.95 2.1E-05   29.8   4.5   25  190-214    81-109 (109)
 76 PF13719 zinc_ribbon_5:  zinc-r  89.0    0.42 9.2E-06   24.5   2.1   34   16-55      3-36  (37)
 77 TIGR02098 MJ0042_CXXC MJ0042 f  89.0    0.32   7E-06   25.0   1.7   34   16-55      3-36  (38)
 78 COG5048 FOG: Zn-finger [Genera  88.8   0.076 1.6E-06   44.3  -1.3   48   13-61     31-80  (467)
 79 PF13717 zinc_ribbon_4:  zinc-r  88.8    0.44 9.6E-06   24.3   2.0   33   16-54      3-35  (36)
 80 PF02892 zf-BED:  BED zinc fing  88.5    0.27   6E-06   26.4   1.2   26  218-243    15-44  (45)
 81 smart00614 ZnF_BED BED zinc fi  88.4    0.35 7.7E-06   26.7   1.6   25  220-244    19-48  (50)
 82 TIGR00622 ssl1 transcription f  88.1    0.77 1.7E-05   30.2   3.3   89  133-244    14-105 (112)
 83 PF10571 UPF0547:  Uncharacteri  87.8    0.35 7.6E-06   22.6   1.2    8  192-199    17-24  (26)
 84 PRK06266 transcription initiat  87.7    0.48   1E-05   34.3   2.4   32  186-228   114-145 (178)
 85 COG2888 Predicted Zn-ribbon RN  87.2    0.92   2E-05   25.8   2.7   10   74-83     49-58  (61)
 86 PF09538 FYDLN_acid:  Protein o  86.5    0.48 1.1E-05   31.1   1.7   15  188-202    25-39  (108)
 87 COG5048 FOG: Zn-finger [Genera  86.1     0.4 8.7E-06   39.9   1.5   53   15-67    289-346 (467)
 88 smart00531 TFIIE Transcription  86.1    0.83 1.8E-05   32.0   2.8   16  186-201    96-111 (147)
 89 COG1592 Rubrerythrin [Energy p  85.8    0.46   1E-05   33.7   1.4   24  188-226   133-156 (166)
 90 smart00659 RPOLCX RNA polymera  84.9    0.58 1.3E-05   25.1   1.2   10  162-171     3-12  (44)
 91 TIGR00622 ssl1 transcription f  84.8     1.7 3.7E-05   28.6   3.6   47   77-126    57-103 (112)
 92 PF09986 DUF2225:  Uncharacteri  84.5   0.098 2.1E-06   39.2  -2.6   45  188-232     4-61  (214)
 93 PHA00626 hypothetical protein   84.5    0.25 5.4E-06   27.6  -0.3   12  219-230    23-34  (59)
 94 smart00734 ZnF_Rad18 Rad18-lik  84.0     1.2 2.6E-05   20.8   2.0   19  191-210     3-21  (26)
 95 PRK00398 rpoP DNA-directed RNA  83.7    0.91   2E-05   24.6   1.7   12   15-26      3-14  (46)
 96 PF09986 DUF2225:  Uncharacteri  83.7    0.35 7.6E-06   36.2   0.1   19   13-31      3-21  (214)
 97 COG1997 RPL43A Ribosomal prote  82.7    0.63 1.4E-05   28.8   0.9   35  187-233    33-67  (89)
 98 smart00531 TFIIE Transcription  81.3     1.4   3E-05   30.8   2.3   17   13-29     97-113 (147)
 99 PRK00464 nrdR transcriptional   80.3    0.32 6.8E-06   34.2  -1.1   13  162-174    29-41  (154)
100 KOG2186|consensus               80.1       1 2.2E-05   34.0   1.4   56  135-192     4-59  (276)
101 PRK14890 putative Zn-ribbon RN  80.0     1.9   4E-05   24.7   2.1   10   74-83     47-56  (59)
102 PF09723 Zn-ribbon_8:  Zinc rib  79.9     1.1 2.4E-05   23.7   1.2   14   44-57      5-18  (42)
103 KOG2186|consensus               79.6    0.83 1.8E-05   34.4   0.8   47  104-155     3-49  (276)
104 COG1592 Rubrerythrin [Energy p  78.7     1.5 3.4E-05   31.1   1.9   23  161-196   134-156 (166)
105 KOG1280|consensus               78.4     1.9 4.2E-05   34.2   2.4   40  187-226    77-116 (381)
106 PF03604 DNA_RNApol_7kD:  DNA d  77.9     1.6 3.6E-05   21.5   1.3    8  189-196    17-24  (32)
107 PF08274 PhnA_Zn_Ribbon:  PhnA   77.3    0.66 1.4E-05   22.6  -0.2   11  218-228    18-28  (30)
108 COG1996 RPC10 DNA-directed RNA  77.1     1.3 2.9E-05   24.3   0.9   10  162-171     7-16  (49)
109 TIGR00373 conserved hypothetic  76.2     1.6 3.4E-05   31.0   1.4   29  161-198   109-137 (158)
110 PF07754 DUF1610:  Domain of un  76.1     1.6 3.5E-05   19.9   0.9   11   13-23     14-24  (24)
111 TIGR02300 FYDLN_acid conserved  75.7     2.1 4.6E-05   28.7   1.8   12  188-199    25-36  (129)
112 PF14353 CpXC:  CpXC protein     75.3     2.3   5E-05   28.9   2.0   19  189-207    38-56  (128)
113 PRK06266 transcription initiat  75.0     1.6 3.5E-05   31.6   1.2   31  160-199   116-146 (178)
114 PF04780 DUF629:  Protein of un  74.9     1.9 4.1E-05   36.1   1.7   30  217-246    55-84  (466)
115 smart00834 CxxC_CXXC_SSSS Puta  74.5       2 4.4E-05   22.3   1.2   10   45-54      6-15  (41)
116 PF04959 ARS2:  Arsenite-resist  74.3     1.7 3.6E-05   32.5   1.1   26  219-244    77-102 (214)
117 TIGR02605 CxxC_CxxC_SSSS putat  73.5     2.3 4.9E-05   23.6   1.3   11   45-55      6-16  (52)
118 PF05290 Baculo_IE-1:  Baculovi  70.8     2.4 5.3E-05   28.6   1.2   55  160-234    79-136 (140)
119 KOG2593|consensus               70.2     3.1 6.8E-05   34.2   1.9   42   12-57    125-166 (436)
120 PRK09678 DNA-binding transcrip  68.3     1.4   3E-05   26.5  -0.3    8  224-231    34-41  (72)
121 PF13451 zf-trcl:  Probable zin  66.9     2.3 4.9E-05   23.4   0.3   14   13-26      2-15  (49)
122 PF00301 Rubredoxin:  Rubredoxi  65.2     6.1 0.00013   21.5   1.8   13   45-57      2-14  (47)
123 PF02176 zf-TRAF:  TRAF-type zi  64.9     1.1 2.4E-05   25.7  -1.2   43   11-55      5-53  (60)
124 COG3364 Zn-ribbon containing p  64.6     4.5 9.8E-05   25.9   1.4   14  134-147     2-15  (112)
125 COG5216 Uncharacterized conser  64.1     6.5 0.00014   22.3   1.8   29   15-51     22-51  (67)
126 PF15269 zf-C2H2_7:  Zinc-finge  62.1     6.5 0.00014   20.9   1.5   21  190-210    21-41  (54)
127 COG0068 HypF Hydrogenase matur  61.4     2.9 6.3E-05   36.8   0.2   66    7-83    110-181 (750)
128 KOG4124|consensus               61.0     1.1 2.4E-05   35.4  -2.1   52  187-238   347-417 (442)
129 PF05495 zf-CHY:  CHY zinc fing  60.6     5.9 0.00013   23.8   1.4   58   14-83      9-69  (71)
130 COG4530 Uncharacterized protei  59.8     9.3  0.0002   24.9   2.2   12  188-199    25-36  (129)
131 PF04959 ARS2:  Arsenite-resist  59.0     6.8 0.00015   29.3   1.7   27  161-187    77-103 (214)
132 COG4306 Uncharacterized protei  59.0     4.1 8.9E-05   27.1   0.5   18   73-90     66-83  (160)
133 COG3357 Predicted transcriptio  58.4     6.6 0.00014   24.6   1.3   14   43-56     57-70  (97)
134 KOG1280|consensus               57.5     9.6 0.00021   30.5   2.4   38  104-141    79-116 (381)
135 PF09845 DUF2072:  Zn-ribbon co  57.3     6.7 0.00014   26.6   1.3   14  135-148     2-15  (131)
136 PF06524 NOA36:  NOA36 protein;  57.2     5.2 0.00011   30.5   0.9   40  101-141   139-178 (314)
137 PF14205 Cys_rich_KTR:  Cystein  57.1     5.2 0.00011   22.4   0.6   36   13-53      2-37  (55)
138 cd00730 rubredoxin Rubredoxin;  57.0     2.9 6.2E-05   23.2  -0.4    7  190-196    35-41  (50)
139 COG1675 TFA1 Transcription ini  56.8      13 0.00029   26.8   2.8   32  185-227   109-140 (176)
140 PTZ00255 60S ribosomal protein  56.2     4.3 9.2E-05   25.6   0.3   33  187-231    34-66  (90)
141 PRK03824 hypA hydrogenase nick  55.4     5.6 0.00012   27.4   0.8   14   14-27     69-82  (135)
142 PRK04023 DNA polymerase II lar  54.9      15 0.00033   34.0   3.5   10  219-228   663-672 (1121)
143 COG1198 PriA Primosomal protei  53.1      12 0.00027   33.6   2.6   13   72-84    472-484 (730)
144 TIGR00280 L37a ribosomal prote  53.0     4.2   9E-05   25.7  -0.2   33  187-231    33-65  (91)
145 KOG4118|consensus               52.9     9.8 0.00021   22.1   1.3   29  219-247    38-66  (74)
146 COG0068 HypF Hydrogenase matur  52.9     1.6 3.5E-05   38.2  -2.6   56  136-197   125-181 (750)
147 KOG2923|consensus               52.2      12 0.00026   21.7   1.6   28   16-51     23-51  (67)
148 KOG2593|consensus               52.2      14  0.0003   30.6   2.6   17  188-204   127-143 (436)
149 PF05443 ROS_MUCR:  ROS/MUCR tr  51.1     9.2  0.0002   26.2   1.2   27  187-216    70-96  (132)
150 PF08271 TF_Zn_Ribbon:  TFIIB z  51.1     6.8 0.00015   20.7   0.5    9   76-84     20-28  (43)
151 PF13878 zf-C2H2_3:  zinc-finge  49.2      22 0.00047   18.7   2.2   22  163-184    15-38  (41)
152 PRK04023 DNA polymerase II lar  48.6      20 0.00043   33.4   3.2   12  189-200   663-674 (1121)
153 smart00440 ZnF_C2C2 C2C2 Zinc   48.4     4.6  0.0001   21.1  -0.4    9   76-84     29-37  (40)
154 PF06397 Desulfoferrod_N:  Desu  47.3      10 0.00022   19.3   0.7   12   14-25      5-16  (36)
155 COG1773 Rubredoxin [Energy pro  46.5     8.9 0.00019   21.7   0.5   13   45-57      4-16  (55)
156 TIGR00686 phnA alkylphosphonat  45.7      11 0.00024   24.6   0.9   13  219-231    19-31  (109)
157 PF14369 zf-RING_3:  zinc-finge  45.5      23 0.00049   17.9   1.9   10   77-86     23-32  (35)
158 PF01096 TFIIS_C:  Transcriptio  45.3     1.8 3.8E-05   22.5  -2.3    9   76-84     29-37  (39)
159 KOG2807|consensus               45.0      29 0.00064   27.6   3.2   25  218-243   344-368 (378)
160 PF07282 OrfB_Zn_ribbon:  Putat  44.6      12 0.00026   22.1   1.0   13  187-199    44-56  (69)
161 PF13824 zf-Mss51:  Zinc-finger  43.9      20 0.00043   20.3   1.6    8  189-196    14-21  (55)
162 PF01363 FYVE:  FYVE zinc finge  43.6      12 0.00025   22.1   0.8    8  164-171    12-19  (69)
163 PRK10220 hypothetical protein;  43.3      14  0.0003   24.2   1.1   14  219-232    20-33  (111)
164 COG5151 SSL1 RNA polymerase II  43.0      22 0.00048   28.0   2.3   26  101-126   385-410 (421)
165 PF09332 Mcm10:  Mcm10 replicat  43.0      10 0.00022   30.7   0.6   69   12-93    249-321 (344)
166 COG1571 Predicted DNA-binding   42.7      17 0.00037   30.2   1.8   30  191-233   352-381 (421)
167 cd00065 FYVE FYVE domain; Zinc  42.6      21 0.00045   20.0   1.7   14  188-201    17-30  (57)
168 PF04780 DUF629:  Protein of un  42.5      20 0.00043   30.3   2.2   33   10-42     52-84  (466)
169 COG4888 Uncharacterized Zn rib  42.2      11 0.00023   24.2   0.5   15   13-27     20-34  (104)
170 PF12760 Zn_Tnp_IS1595:  Transp  42.0      15 0.00032   19.8   1.0    8  219-226    37-44  (46)
171 KOG3408|consensus               41.6      16 0.00036   24.3   1.3   25  186-210    54-78  (129)
172 PF13453 zf-TFIIB:  Transcripti  41.4      12 0.00027   19.5   0.6    8  192-199    22-29  (41)
173 PF04423 Rad50_zn_hook:  Rad50   40.2     9.8 0.00021   21.3   0.1   12  221-232    22-33  (54)
174 smart00661 RPOL9 RNA polymeras  39.7      16 0.00035   20.0   0.9    7  190-196    21-27  (52)
175 PF08209 Sgf11:  Sgf11 (transcr  39.1      19 0.00041   17.9   1.0   21   14-35      3-23  (33)
176 KOG4167|consensus               39.0     9.7 0.00021   33.8  -0.1   25  218-243   791-815 (907)
177 KOG3408|consensus               38.9      19  0.0004   24.1   1.2   25  159-183    55-79  (129)
178 PF14446 Prok-RING_1:  Prokaryo  38.9      22 0.00048   20.0   1.3   12  188-199    20-31  (54)
179 PF07503 zf-HYPF:  HypF finger;  37.9     2.7 5.8E-05   21.3  -2.2    8  163-170    23-30  (35)
180 KOG2907|consensus               37.7      38 0.00082   22.4   2.4   11   76-86    103-113 (116)
181 COG1326 Uncharacterized archae  37.5      46 0.00099   24.4   3.0   39   13-56      4-42  (201)
182 KOG1842|consensus               37.2      20 0.00043   29.9   1.4   27  189-215    15-41  (505)
183 smart00154 ZnF_AN1 AN1-like Zi  36.6      18 0.00039   18.7   0.7   14  189-202    12-25  (39)
184 PF10083 DUF2321:  Uncharacteri  36.4      12 0.00025   26.3   0.0   48   44-93     39-86  (158)
185 COG3091 SprT Zn-dependent meta  35.9      31 0.00067   24.2   1.9   37   41-85    114-150 (156)
186 smart00064 FYVE Protein presen  35.8      26 0.00056   20.5   1.5   14  188-201    25-38  (68)
187 TIGR00100 hypA hydrogenase nic  35.2      15 0.00032   24.5   0.4   11  162-172    71-81  (115)
188 PRK03681 hypA hydrogenase nick  35.2      19 0.00042   23.9   0.9    9  162-170    71-79  (114)
189 KOG0782|consensus               34.7     9.3  0.0002   32.8  -0.8   54  173-233   237-290 (1004)
190 COG1594 RPB9 DNA-directed RNA   34.7     6.8 0.00015   26.0  -1.3   10  190-199   101-110 (113)
191 KOG1842|consensus               34.6      23  0.0005   29.5   1.4   31   73-103    13-43  (505)
192 PF11789 zf-Nse:  Zinc-finger o  34.3      18 0.00038   20.7   0.5   31  188-224    23-53  (57)
193 PF07975 C1_4:  TFIIH C1-like d  34.3      25 0.00054   19.6   1.1   25   13-37     19-43  (51)
194 PRK12380 hydrogenase nickel in  34.2      18 0.00039   24.0   0.6   11  162-172    71-81  (113)
195 cd00924 Cyt_c_Oxidase_Vb Cytoc  34.1      18  0.0004   23.3   0.6   16   11-26     75-90  (97)
196 PRK08222 hydrogenase 4 subunit  33.4      53  0.0011   23.9   3.0   18  188-205   113-130 (181)
197 PF01780 Ribosomal_L37ae:  Ribo  32.8      13 0.00029   23.4  -0.2   11   75-85     53-63  (90)
198 PF10276 zf-CHCC:  Zinc-finger   32.6      15 0.00033   19.2   0.1   12  188-199    28-39  (40)
199 PF10013 DUF2256:  Uncharacteri  32.6      34 0.00075   18.1   1.3   18  191-208    10-27  (42)
200 COG4896 Uncharacterized protei  31.7      18 0.00038   20.8   0.2    7  190-196    32-38  (68)
201 smart00731 SprT SprT homologue  31.2      44 0.00095   23.3   2.2   34   42-85    110-143 (146)
202 PRK00564 hypA hydrogenase nick  31.0      30 0.00065   23.1   1.3   11  162-172    72-82  (117)
203 PF07800 DUF1644:  Protein of u  31.0   2E+02  0.0042   20.6   5.2   57  189-249    80-138 (162)
204 PRK12496 hypothetical protein;  30.8      38 0.00082   24.3   1.8   11  162-172   128-138 (164)
205 PF01428 zf-AN1:  AN1-like Zinc  30.6      16 0.00035   19.3  -0.0   15  188-202    12-26  (43)
206 PF08790 zf-LYAR:  LYAR-type C2  30.0     7.1 0.00015   18.6  -1.3    6  139-144     5-10  (28)
207 PRK04351 hypothetical protein;  29.7      25 0.00055   24.7   0.8   34   43-87    111-144 (149)
208 PF12230 PRP21_like_P:  Pre-mRN  29.5      18 0.00039   27.5   0.0   25   12-37    165-189 (229)
209 KOG0717|consensus               29.2      27 0.00058   29.4   0.9   21  220-240   293-313 (508)
210 KOG0717|consensus               29.2      31 0.00068   29.0   1.3   21  190-210   293-313 (508)
211 COG1198 PriA Primosomal protei  28.6      14 0.00031   33.3  -0.8   11  187-197   473-483 (730)
212 KOG2636|consensus               28.2      40 0.00086   28.2   1.7   28  183-210   395-423 (497)
213 TIGR00319 desulf_FeS4 desulfof  28.0      33 0.00071   16.9   0.8   12   14-25      6-17  (34)
214 smart00504 Ubox Modified RING   27.7 1.2E+02  0.0026   17.1   3.4   10  221-230    37-46  (63)
215 PF02591 DUF164:  Putative zinc  27.6      60  0.0013   18.2   2.0   11  187-197    44-54  (56)
216 PHA02998 RNA polymerase subuni  27.5      20 0.00043   25.8  -0.0   14   44-57    171-184 (195)
217 COG4391 Uncharacterized protei  27.4      30 0.00065   20.0   0.7   39  158-200    21-59  (62)
218 TIGR01206 lysW lysine biosynth  27.3      23 0.00049   20.0   0.2   12  220-231     3-14  (54)
219 COG4957 Predicted transcriptio  26.8      39 0.00085   23.1   1.2   23  189-214    76-98  (148)
220 PF04438 zf-HIT:  HIT zinc fing  26.7      62  0.0014   15.6   1.6   17   13-29     11-27  (30)
221 KOG4167|consensus               26.5      23  0.0005   31.6   0.2   21   75-95    792-812 (907)
222 cd00974 DSRD Desulforedoxin (D  26.5      35 0.00077   16.8   0.8   11   15-25      4-14  (34)
223 KOG2272|consensus               26.2      65  0.0014   24.7   2.4   76   97-174    92-176 (332)
224 PRK01343 zinc-binding protein;  25.9      35 0.00076   19.5   0.7   11  189-199     9-19  (57)
225 COG2331 Uncharacterized protei  25.8      36 0.00078   20.6   0.8   10  162-171    13-22  (82)
226 TIGR00595 priA primosomal prot  25.7      47   0.001   28.8   1.8   10  187-196   238-247 (505)
227 COG1998 RPS31 Ribosomal protei  25.6      45 0.00098   18.3   1.1    8  161-168    37-44  (51)
228 PF03811 Zn_Tnp_IS1:  InsA N-te  25.3      75  0.0016   16.2   1.8   12   39-50     24-35  (36)
229 PTZ00448 hypothetical protein;  25.2      44 0.00096   27.3   1.5   25   14-38    313-337 (373)
230 PF11672 DUF3268:  Protein of u  25.1      40 0.00087   22.0   1.0    9   15-23      2-10  (102)
231 PLN02294 cytochrome c oxidase   24.8      36 0.00079   24.4   0.8   15  186-200   138-152 (174)
232 KOG2857|consensus               24.7      38 0.00083   23.3   0.9   25   12-36     14-38  (157)
233 cd00162 RING RING-finger (Real  24.7 1.1E+02  0.0023   15.3   3.2    8  220-227    36-43  (45)
234 PRK00420 hypothetical protein;  24.0      58  0.0013   21.6   1.6    9  162-170    41-49  (112)
235 PF14803 Nudix_N_2:  Nudix N-te  23.9     8.6 0.00019   19.3  -1.7   12  217-228    20-31  (34)
236 PRK12387 formate hydrogenlyase  23.8      34 0.00073   24.9   0.6   17  188-204   113-129 (180)
237 PLN03239 histone acetyltransfe  23.7      85  0.0018   25.6   2.8   24   13-36    104-127 (351)
238 PF09963 DUF2197:  Uncharacteri  23.6      19 0.00042   20.4  -0.6   38   45-84      3-40  (56)
239 PRK14714 DNA polymerase II lar  23.5   1E+02  0.0023   29.9   3.6   12   14-25    666-677 (1337)
240 PF04606 Ogr_Delta:  Ogr/Delta-  23.4      12 0.00025   20.3  -1.4    6  107-112     2-7   (47)
241 PF14634 zf-RING_5:  zinc-RING   23.2      76  0.0016   16.6   1.8    8  219-226    36-43  (44)
242 KOG3002|consensus               22.6 1.3E+02  0.0028   24.1   3.6   79  134-215    80-165 (299)
243 KOG4727|consensus               22.5      48   0.001   23.7   1.0   23  188-210    74-96  (193)
244 PF01155 HypA:  Hydrogenase exp  22.3      25 0.00054   23.3  -0.3   11  162-172    71-81  (113)
245 PF06220 zf-U1:  U1 zinc finger  22.0   1E+02  0.0022   15.9   2.0   11  189-199     3-13  (38)
246 PF03833 PolC_DP2:  DNA polymer  22.0      30 0.00065   31.6   0.0   10  221-230   694-703 (900)
247 PF14255 Cys_rich_CPXG:  Cystei  21.6      45 0.00097   18.6   0.7    9  191-199     2-10  (52)
248 PF07295 DUF1451:  Protein of u  21.6      66  0.0014   22.6   1.6    8   45-52    113-120 (146)
249 PF01286 XPA_N:  XPA protein N-  21.5      58  0.0013   16.4   1.0   17   45-61      4-20  (34)
250 PF12156 ATPase-cat_bd:  Putati  21.2      39 0.00085   21.2   0.4   36   46-86      2-37  (88)
251 PTZ00448 hypothetical protein;  20.7      68  0.0015   26.3   1.7   24  219-242   314-337 (373)
252 KOG3214|consensus               20.4      41 0.00088   21.6   0.4   14  220-233    48-61  (109)
253 PF13821 DUF4187:  Domain of un  20.3   1E+02  0.0022   17.5   1.9   17  221-237    29-45  (55)
254 PTZ00064 histone acetyltransfe  20.2 1.2E+02  0.0025   26.2   3.0   26   12-37    277-302 (552)
255 PF10263 SprT-like:  SprT-like   20.1      29 0.00062   24.4  -0.4   11  189-199   123-133 (157)

No 1  
>KOG2462|consensus
Probab=99.97  E-value=3.6e-32  Score=198.23  Aligned_cols=139  Identities=27%  Similarity=0.506  Sum_probs=128.5

Q ss_pred             CCCCcccccchhhccChHHHHHHHHhhhcc-CCCcccccccccccCCHHHHHHHHHhcCCcccccCCCcccCCChHHHHH
Q psy12195        101 MDINMSCVPCDVLFHNKATLYKHLYLEHKA-TSLSIQCNMCSLVLDSKESLVTHISQTHTLMFTCRRCPSTFLNSATLSK  179 (254)
Q Consensus       101 ~~~~~~C~~C~~~f~~~~~l~~H~~~~~~~-~~~~~~C~~C~~~f~~~~~l~~h~~~~~~~~~~C~~C~~~f~~~~~l~~  179 (254)
                      ....|.|+.|++.+.+.++|-.|.+.|... ....+.|++|++.|.+...|..|++ +|..+.+|.+||+.|...+.|+.
T Consensus       127 ~~~r~~c~eCgk~ysT~snLsrHkQ~H~~~~s~ka~~C~~C~K~YvSmpALkMHir-TH~l~c~C~iCGKaFSRPWLLQG  205 (279)
T KOG2462|consen  127 KHPRYKCPECGKSYSTSSNLSRHKQTHRSLDSKKAFSCKYCGKVYVSMPALKMHIR-THTLPCECGICGKAFSRPWLLQG  205 (279)
T ss_pred             cCCceeccccccccccccccchhhcccccccccccccCCCCCceeeehHHHhhHhh-ccCCCcccccccccccchHHhhc
Confidence            445699999999999999999999986543 3446899999999999999999998 99999999999999999999999


Q ss_pred             HHhHhhCCCcccCCCCcccCCCHHHHHHHHHHhhcCCCCCccCcchhhccCCchHHHHHHHHh
Q psy12195        180 HVKMEHNSKSYQCNECPESFERLNKLKRHKFQAHNDSVHQIQCPYCITDFSEDKNLIQHIVSV  242 (254)
Q Consensus       180 H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~~h~~~~~~~~C~~C~~~f~~~~~l~~H~~~~  242 (254)
                      |+++|+|||||.|+.|+|+|.++++|..|+. +|.+ .+.|+|+.|+|.|+..+.|..|.+.-
T Consensus       206 HiRTHTGEKPF~C~hC~kAFADRSNLRAHmQ-THS~-~K~~qC~~C~KsFsl~SyLnKH~ES~  266 (279)
T KOG2462|consen  206 HIRTHTGEKPFSCPHCGKAFADRSNLRAHMQ-THSD-VKKHQCPRCGKSFALKSYLNKHSESA  266 (279)
T ss_pred             ccccccCCCCccCCcccchhcchHHHHHHHH-hhcC-CccccCcchhhHHHHHHHHHHhhhhc
Confidence            9999999999999999999999999999998 7888 78999999999999999999998554


No 2  
>KOG3608|consensus
Probab=99.96  E-value=1.6e-29  Score=189.38  Aligned_cols=231  Identities=23%  Similarity=0.474  Sum_probs=200.9

Q ss_pred             eeeec--ccccccCCCHHHHHhhhccccc------------Cc-ceeecC--cCCcccCCCCccchhhhhccCCCCCCcc
Q psy12195         14 VIIRC--ETCTRNYESLESLTTHLSFKHS------------NQ-FLMKCT--NCNVLVPRDEILPHLSIQHCQGTTPSIY   76 (254)
Q Consensus        14 ~~~~C--~~C~~~f~~~~~l~~H~~~~h~------------~~-~~~~C~--~C~~~~~~~~~l~~~~~~h~~~~~~~~~   76 (254)
                      ..|.|  ..|+..|.+..+|..|+.. |.            .+ ..+-|.  -|.+.+.++..|..|++.|   ++++..
T Consensus       133 ~~f~C~WedCe~~F~s~~ef~dHV~~-H~l~ceyd~~~~~~D~~pv~~C~W~~Ct~~~~~k~~LreH~r~H---s~eKvv  208 (467)
T KOG3608|consen  133 QNFRCGWEDCEREFVSIVEFQDHVVK-HALFCEYDIQKTPEDERPVTMCNWAMCTKHMGNKYRLREHIRTH---SNEKVV  208 (467)
T ss_pred             hhhccChhhcCCcccCHHHHHHHHHH-hhhhhhhhhhhCCCCCCceeeccchhhhhhhccHHHHHHHHHhc---CCCeEE
Confidence            34566  5699999999999999886 43            11 224454  4888999999999888889   999999


Q ss_pred             cccccccccccHHHHHhHHhhhc-cCCCCcccccchhhccChHHHHHHHHhhhccCCCcccccccccccCCHHHHHHHHH
Q psy12195         77 ECNQCKEKTNDMTTMLNHYSVKH-YMDINMSCVPCDVLFHNKATLYKHLYLEHKATSLSIQCNMCSLVLDSKESLVTHIS  155 (254)
Q Consensus        77 ~C~~C~~~~~~~~~l~~h~~~~h-~~~~~~~C~~C~~~f~~~~~l~~H~~~~~~~~~~~~~C~~C~~~f~~~~~l~~h~~  155 (254)
                      .|+.||..|..+..|.+|.++.. ....+|.|..|.+.|.++..|..|+..+..    .|+|++|+.+....++|..|++
T Consensus       209 ACp~Cg~~F~~~tkl~DH~rRqt~l~~n~fqC~~C~KrFaTeklL~~Hv~rHvn----~ykCplCdmtc~~~ssL~~H~r  284 (467)
T KOG3608|consen  209 ACPHCGELFRTKTKLFDHLRRQTELNTNSFQCAQCFKRFATEKLLKSHVVRHVN----CYKCPLCDMTCSSASSLTTHIR  284 (467)
T ss_pred             ecchHHHHhccccHHHHHHHhhhhhcCCchHHHHHHHHHhHHHHHHHHHHHhhh----cccccccccCCCChHHHHHHHH
Confidence            99999999999999999985532 345689999999999999999999987432    6899999999999999999988


Q ss_pred             hcCC--cccccCCCcccCCChHHHHHHHhHhhCCCcccCCC--CcccCCCHHHHHHHHHHhhc-CCCCCccCcchhhccC
Q psy12195        156 QTHT--LMFTCRRCPSTFLNSATLSKHVKMEHNSKSYQCNE--CPESFERLNKLKRHKFQAHN-DSVHQIQCPYCITDFS  230 (254)
Q Consensus       156 ~~~~--~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~--C~~~f~~~~~l~~H~~~~h~-~~~~~~~C~~C~~~f~  230 (254)
                      ..|.  +||+|+.|+..+...+.|.+|..+|+ +-.|+|..  |..+|++...+.+|++.+|. .++.+|.|-+|++.|+
T Consensus       285 ~rHs~dkpfKCd~Cd~~c~~esdL~kH~~~HS-~~~y~C~h~~C~~s~r~~~q~~~H~~evhEg~np~~Y~CH~Cdr~ft  363 (467)
T KOG3608|consen  285 YRHSKDKPFKCDECDTRCVRESDLAKHVQVHS-KTVYQCEHPDCHYSVRTYTQMRRHFLEVHEGNNPILYACHCCDRFFT  363 (467)
T ss_pred             hhhccCCCccccchhhhhccHHHHHHHHHhcc-ccceecCCCCCcHHHHHHHHHHHHHHHhccCCCCCceeeecchhhhc
Confidence            6554  89999999999999999999999998 88899988  99999999999999999994 4456799999999999


Q ss_pred             CchHHHHHHHHhcCCCCCCCCCC
Q psy12195        231 EDKNLIQHIVSVHLGKEGTAPAR  253 (254)
Q Consensus       231 ~~~~l~~H~~~~h~~~~~~~c~~  253 (254)
                      +..+|..|+.+.|.-.-||.-+|
T Consensus       364 ~G~~L~~HL~kkH~f~~PsGh~R  386 (467)
T KOG3608|consen  364 SGKSLSAHLMKKHGFRLPSGHKR  386 (467)
T ss_pred             cchhHHHHHHHhhcccCCCCCCc
Confidence            99999999999999988887665


No 3  
>KOG2462|consensus
Probab=99.93  E-value=5e-27  Score=171.43  Aligned_cols=116  Identities=22%  Similarity=0.483  Sum_probs=108.8

Q ss_pred             cccccccccccCCHHHHHHHHHhcCC----cccccCCCcccCCChHHHHHHHhHhhCCCcccCCCCcccCCCHHHHHHHH
Q psy12195        134 SIQCNMCSLVLDSKESLVTHISQTHT----LMFTCRRCPSTFLNSATLSKHVKMEHNSKSYQCNECPESFERLNKLKRHK  209 (254)
Q Consensus       134 ~~~C~~C~~~f~~~~~l~~h~~~~~~----~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~  209 (254)
                      .|.|+.||+.+...+.|.+|......    +.+.|..||+.|.+-..|..|+++|+  -+.+|++|||+|...+-|+.|+
T Consensus       130 r~~c~eCgk~ysT~snLsrHkQ~H~~~~s~ka~~C~~C~K~YvSmpALkMHirTH~--l~c~C~iCGKaFSRPWLLQGHi  207 (279)
T KOG2462|consen  130 RYKCPECGKSYSTSSNLSRHKQTHRSLDSKKAFSCKYCGKVYVSMPALKMHIRTHT--LPCECGICGKAFSRPWLLQGHI  207 (279)
T ss_pred             ceeccccccccccccccchhhcccccccccccccCCCCCceeeehHHHhhHhhccC--CCcccccccccccchHHhhccc
Confidence            68999999999999999999763322    77999999999999999999999998  7899999999999999999999


Q ss_pred             HHhhcCCCCCccCcchhhccCCchHHHHHHHHhcCCCCCCCCCCC
Q psy12195        210 FQAHNDSVHQIQCPYCITDFSEDKNLIQHIVSVHLGKEGTAPART  254 (254)
Q Consensus       210 ~~~h~~~~~~~~C~~C~~~f~~~~~l~~H~~~~h~~~~~~~c~~~  254 (254)
                      + .|+| +|||.|+.|++.|++++||..|| .+|++.|+|+|.||
T Consensus       208 R-THTG-EKPF~C~hC~kAFADRSNLRAHm-QTHS~~K~~qC~~C  249 (279)
T KOG2462|consen  208 R-THTG-EKPFSCPHCGKAFADRSNLRAHM-QTHSDVKKHQCPRC  249 (279)
T ss_pred             c-cccC-CCCccCCcccchhcchHHHHHHH-HhhcCCccccCcch
Confidence            9 7888 89999999999999999999999 99999999999997


No 4  
>KOG1074|consensus
Probab=99.91  E-value=8.1e-25  Score=180.69  Aligned_cols=170  Identities=22%  Similarity=0.445  Sum_probs=142.3

Q ss_pred             cccccccccccccHHHHHhHHhhhccCCCCcccccchhhccChHHHHHHHHhhhccCC---Cccccc---ccccccCCHH
Q psy12195         75 IYECNQCKEKTNDMTTMLNHYSVKHYMDINMSCVPCDVLFHNKATLYKHLYLEHKATS---LSIQCN---MCSLVLDSKE  148 (254)
Q Consensus        75 ~~~C~~C~~~~~~~~~l~~h~~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~~~~~~~---~~~~C~---~C~~~f~~~~  148 (254)
                      +-.|-+|.+++.-.+.|..|+ +.|++++||.|.+||+.|.++.+|+.|+..|- ..+   .++.|+   +|.+.|.+.-
T Consensus       605 PNqCiiC~rVlSC~saLqmHy-rtHtGERPFkCKiCgRAFtTkGNLkaH~~vHk-a~p~~R~q~ScP~~~ic~~kftn~V  682 (958)
T KOG1074|consen  605 PNQCIICLRVLSCPSALQMHY-RTHTGERPFKCKICGRAFTTKGNLKAHMSVHK-AKPPARVQFSCPSTFICQKKFTNAV  682 (958)
T ss_pred             ccceeeeeecccchhhhhhhh-hcccCcCccccccccchhccccchhhcccccc-cCccccccccCCchhhhcccccccc
Confidence            567999999999999999999 77999999999999999999999999998733 222   368899   9999999988


Q ss_pred             HHHHHHHhcCC---------------cccccCCCcccCCChHHHHHHHhHhhCC--------------------------
Q psy12195        149 SLVTHISQTHT---------------LMFTCRRCPSTFLNSATLSKHVKMEHNS--------------------------  187 (254)
Q Consensus       149 ~l~~h~~~~~~---------------~~~~C~~C~~~f~~~~~l~~H~~~h~~~--------------------------  187 (254)
                      .|..|++ .|.               -.-+|..|.+.|.....+..++..+.++                          
T Consensus       683 ~lpQhIr-iH~~~~~s~g~~a~e~~~~adq~~~~qk~~~~a~~f~~~~se~~~~~s~~~~~~~~~t~t~~~~~tp~~~e~  761 (958)
T KOG1074|consen  683 TLPQHIR-IHLGGQISNGGTAAEGILAADQCSSCQKTFSDARSFSQQISEQPSPESEPDEQMDERTETEELDVTPPPPEN  761 (958)
T ss_pred             cccceEE-eecCCCCCCCcccccccchhcccchhhhcccccccchhhhhccCCcccCCcccccccccccccccCCCcccc
Confidence            8888866 221               1256888888887777777777765211                          


Q ss_pred             --------------------------------------------------------------------------------
Q psy12195        188 --------------------------------------------------------------------------------  187 (254)
Q Consensus       188 --------------------------------------------------------------------------------  187 (254)
                                                                                                      
T Consensus       762 ~~~~~~~~e~~i~~~g~te~asa~~~~vg~~s~~~~~~~~~~T~~k~~~~~~~~~~~~~~~v~~~pvl~~~~~~~l~eg~  841 (958)
T KOG1074|consen  762 SCGRELEGEMAISVRGSTEEASANLDEVGTVSAAGEAGEEDDTSEKPTQASSFPGEILAPSVNMDPVLWNQETSMLNEGL  841 (958)
T ss_pred             ccccccCcccccccccchhhhhcChhhhcCccccchhhhhcccCCCCcccccCCCcCCccccccCchhhccccccccccc
Confidence                                                                                            


Q ss_pred             ------------------------------------CcccCCCCcccCCCHHHHHHHHHHhhcCCCCCccCcchhhccCC
Q psy12195        188 ------------------------------------KSYQCNECPESFERLNKLKRHKFQAHNDSVHQIQCPYCITDFSE  231 (254)
Q Consensus       188 ------------------------------------~~~~C~~C~~~f~~~~~l~~H~~~~h~~~~~~~~C~~C~~~f~~  231 (254)
                                                          ....|.+||+.|...+.|..|++ .|++ .++|.|..|++.|.+
T Consensus       842 ~t~~n~~t~~~~~~sv~qs~~~p~l~p~l~~~~pvnn~h~C~vCgk~FsSSsALqiH~r-THtg-~KPF~C~fC~~aFtt  919 (958)
T KOG1074|consen  842 ATKTNEITPEGPADSVIQSGGVPTLEPSLGRPGPVNNAHVCNVCGKQFSSSAALEIHMR-THTG-PKPFFCHFCEEAFTT  919 (958)
T ss_pred             ccccccccCCCcchhhhhhccccccCCCCCCCCcccchhhhccchhcccchHHHHHhhh-cCCC-CCCccchhhhhhhhh
Confidence                                                12789999999999999999999 7888 789999999999999


Q ss_pred             chHHHHHHHHhcCCCCCCC
Q psy12195        232 DKNLIQHIVSVHLGKEGTA  250 (254)
Q Consensus       232 ~~~l~~H~~~~h~~~~~~~  250 (254)
                      +.+|..|| .+|.+..|..
T Consensus       920 rgnLKvHM-gtH~w~q~~s  937 (958)
T KOG1074|consen  920 RGNLKVHM-GTHMWVQPPS  937 (958)
T ss_pred             hhhhhhhh-ccccccCCCc
Confidence            99999999 7999887754


No 5  
>KOG3608|consensus
Probab=99.90  E-value=7.1e-24  Score=159.31  Aligned_cols=202  Identities=21%  Similarity=0.434  Sum_probs=174.6

Q ss_pred             eec--CcCCcccCCCCccchhhhhccCC----------CCCCcc--cccccccccccHHHHHhHHhhhccCCCCcccccc
Q psy12195         45 MKC--TNCNVLVPRDEILPHLSIQHCQG----------TTPSIY--ECNQCKEKTNDMTTMLNHYSVKHYMDINMSCVPC  110 (254)
Q Consensus        45 ~~C--~~C~~~~~~~~~l~~~~~~h~~~----------~~~~~~--~C~~C~~~~~~~~~l~~h~~~~h~~~~~~~C~~C  110 (254)
                      +.|  +.|+..|.....+..|...|...          .....+  .+..|-..+.++..|+.|+ ..|.+++...|+.|
T Consensus       135 f~C~WedCe~~F~s~~ef~dHV~~H~l~ceyd~~~~~~D~~pv~~C~W~~Ct~~~~~k~~LreH~-r~Hs~eKvvACp~C  213 (467)
T KOG3608|consen  135 FRCGWEDCEREFVSIVEFQDHVVKHALFCEYDIQKTPEDERPVTMCNWAMCTKHMGNKYRLREHI-RTHSNEKVVACPHC  213 (467)
T ss_pred             hccChhhcCCcccCHHHHHHHHHHhhhhhhhhhhhCCCCCCceeeccchhhhhhhccHHHHHHHH-HhcCCCeEEecchH
Confidence            455  55999999998888666656321          111223  4567889999999999998 77999999999999


Q ss_pred             hhhccChHHHHHHHHhhhccCCCcccccccccccCCHHHHHHHHHhcCCcccccCCCcccCCChHHHHHHHhH-hhCCCc
Q psy12195        111 DVLFHNKATLYKHLYLEHKATSLSIQCNMCSLVLDSKESLVTHISQTHTLMFTCRRCPSTFLNSATLSKHVKM-EHNSKS  189 (254)
Q Consensus       111 ~~~f~~~~~l~~H~~~~~~~~~~~~~C~~C~~~f~~~~~l~~h~~~~~~~~~~C~~C~~~f~~~~~l~~H~~~-h~~~~~  189 (254)
                      |.-|.++..|..|.+........+|.|..|.+.|.....|..|+. .|-..|+|++|+......++|..|++. |...+|
T Consensus       214 g~~F~~~tkl~DH~rRqt~l~~n~fqC~~C~KrFaTeklL~~Hv~-rHvn~ykCplCdmtc~~~ssL~~H~r~rHs~dkp  292 (467)
T KOG3608|consen  214 GELFRTKTKLFDHLRRQTELNTNSFQCAQCFKRFATEKLLKSHVV-RHVNCYKCPLCDMTCSSASSLTTHIRYRHSKDKP  292 (467)
T ss_pred             HHHhccccHHHHHHHhhhhhcCCchHHHHHHHHHhHHHHHHHHHH-HhhhcccccccccCCCChHHHHHHHHhhhccCCC
Confidence            999999999999998877777779999999999999999999998 888999999999999999999999998 888999


Q ss_pred             ccCCCCcccCCCHHHHHHHHHHhhcCCCCCccCcc--hhhccCCchHHHHHHHHhcCCCCC--CCC
Q psy12195        190 YQCNECPESFERLNKLKRHKFQAHNDSVHQIQCPY--CITDFSEDKNLIQHIVSVHLGKEG--TAP  251 (254)
Q Consensus       190 ~~C~~C~~~f~~~~~l~~H~~~~h~~~~~~~~C~~--C~~~f~~~~~l~~H~~~~h~~~~~--~~c  251 (254)
                      |+|..|++.|.+.+.|.+|+. .|++  ..|+|..  |..+|.+...|.+|++.+|.|..|  |.|
T Consensus       293 fKCd~Cd~~c~~esdL~kH~~-~HS~--~~y~C~h~~C~~s~r~~~q~~~H~~evhEg~np~~Y~C  355 (467)
T KOG3608|consen  293 FKCDECDTRCVRESDLAKHVQ-VHSK--TVYQCEHPDCHYSVRTYTQMRRHFLEVHEGNNPILYAC  355 (467)
T ss_pred             ccccchhhhhccHHHHHHHHH-hccc--cceecCCCCCcHHHHHHHHHHHHHHHhccCCCCCceee
Confidence            999999999999999999998 7775  3688977  999999999999999999966654  554


No 6  
>KOG3623|consensus
Probab=99.86  E-value=5.7e-23  Score=167.46  Aligned_cols=109  Identities=21%  Similarity=0.461  Sum_probs=63.1

Q ss_pred             eeecccccccCCCHHHHHhhhccccc-CcceeecCcCCcccCCCCccchhhhhccCCC----------CCCccccccccc
Q psy12195         15 IIRCETCTRNYESLESLTTHLSFKHS-NQFLMKCTNCNVLVPRDEILPHLSIQHCQGT----------TPSIYECNQCKE   83 (254)
Q Consensus        15 ~~~C~~C~~~f~~~~~l~~H~~~~h~-~~~~~~C~~C~~~~~~~~~l~~~~~~h~~~~----------~~~~~~C~~C~~   83 (254)
                      ...|+.|+..|.....|+.|+...|. .+.-|.|..|.+.|-.+..|..|+..|....          ....|+|.+||+
T Consensus       210 lltcpycdrgykrltslkeHikyrhekne~nfsC~lCsytFAyRtQLErhm~~hkpg~dqa~sltqsa~lRKFKCtECgK  289 (1007)
T KOG3623|consen  210 LLTCPYCDRGYKRLTSLKEHIKYRHEKNEPNFSCMLCSYTFAYRTQLERHMQLHKPGGDQAISLTQSALLRKFKCTECGK  289 (1007)
T ss_pred             hhcchhHHHHHHHHHHHHHHHHHHHhhCCCCCcchhhhhhhhhHHHHHHHHHhhcCCCcccccccchhhhccccccccch
Confidence            44566666666666666666655332 2334566666666666666665554453221          123466666666


Q ss_pred             ccccHHHHHhHHhhhccCCCCcccccchhhccChHHHHHHH
Q psy12195         84 KTNDMTTMLNHYSVKHYMDINMSCVPCDVLFHNKATLYKHL  124 (254)
Q Consensus        84 ~~~~~~~l~~h~~~~h~~~~~~~C~~C~~~f~~~~~l~~H~  124 (254)
                      .|..+..|..|+ ++|.|++||.|+.|++.|+-.+++-.||
T Consensus       290 AFKfKHHLKEHl-RIHSGEKPfeCpnCkKRFSHSGSySSHm  329 (1007)
T KOG3623|consen  290 AFKFKHHLKEHL-RIHSGEKPFECPNCKKRFSHSGSYSSHM  329 (1007)
T ss_pred             hhhhHHHHHhhh-eeecCCCCcCCcccccccccCCcccccc
Confidence            666666666665 5566666666666666666555555555


No 7  
>KOG1074|consensus
Probab=99.81  E-value=1.2e-21  Score=162.27  Aligned_cols=84  Identities=27%  Similarity=0.550  Sum_probs=75.8

Q ss_pred             cccccCCCcccCCChHHHHHHHhHhhCCCcccCCCCcccCCCHHHHHHHHHHhhcCC---CCCccCc---chhhccCCch
Q psy12195        160 LMFTCRRCPSTFLNSATLSKHVKMEHNSKSYQCNECPESFERLNKLKRHKFQAHNDS---VHQIQCP---YCITDFSEDK  233 (254)
Q Consensus       160 ~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~~h~~~---~~~~~C~---~C~~~f~~~~  233 (254)
                      -|-+|-+|.++.+=.+.|+.|.++|+||+||+|.+||++|.++.+|+.|+. +|...   .-+|.||   +|.+.|+..-
T Consensus       604 dPNqCiiC~rVlSC~saLqmHyrtHtGERPFkCKiCgRAFtTkGNLkaH~~-vHka~p~~R~q~ScP~~~ic~~kftn~V  682 (958)
T KOG1074|consen  604 DPNQCIICLRVLSCPSALQMHYRTHTGERPFKCKICGRAFTTKGNLKAHMS-VHKAKPPARVQFSCPSTFICQKKFTNAV  682 (958)
T ss_pred             CccceeeeeecccchhhhhhhhhcccCcCccccccccchhccccchhhccc-ccccCccccccccCCchhhhcccccccc
Confidence            348899999999999999999999999999999999999999999999997 55442   2468999   9999999999


Q ss_pred             HHHHHHHHhcCC
Q psy12195        234 NLIQHIVSVHLG  245 (254)
Q Consensus       234 ~l~~H~~~~h~~  245 (254)
                      .|.+|+ +.|.+
T Consensus       683 ~lpQhI-riH~~  693 (958)
T KOG1074|consen  683 TLPQHI-RIHLG  693 (958)
T ss_pred             cccceE-EeecC
Confidence            999999 88874


No 8  
>KOG3576|consensus
Probab=99.72  E-value=3.2e-18  Score=119.54  Aligned_cols=112  Identities=20%  Similarity=0.390  Sum_probs=99.6

Q ss_pred             cccccccccccCCHHHHHHHHHhcCC--cccccCCCcccCCChHHHHHHHhHhhCCCcccCCCCcccCCCHHHHHHHHHH
Q psy12195        134 SIQCNMCSLVLDSKESLVTHISQTHT--LMFTCRRCPSTFLNSATLSKHVKMEHNSKSYQCNECPESFERLNKLKRHKFQ  211 (254)
Q Consensus       134 ~~~C~~C~~~f~~~~~l~~h~~~~~~--~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~  211 (254)
                      .|.|.+|++.|...--|.+|+. -|.  +.+-|..||+.|...-.|++|+++|+|.+||+|..|+|+|.+..+|..|++.
T Consensus       117 ~ftCrvCgK~F~lQRmlnrh~k-ch~~vkr~lct~cgkgfndtfdlkrh~rthtgvrpykc~~c~kaftqrcsleshl~k  195 (267)
T KOG3576|consen  117 SFTCRVCGKKFGLQRMLNRHLK-CHSDVKRHLCTFCGKGFNDTFDLKRHTRTHTGVRPYKCSLCEKAFTQRCSLESHLKK  195 (267)
T ss_pred             eeeeehhhhhhhHHHHHHHHhh-hccHHHHHHHhhccCcccchhhhhhhhccccCccccchhhhhHHHHhhccHHHHHHH
Confidence            6889999999988888888887 444  7889999999999999999999999999999999999999999999999998


Q ss_pred             hhcCC---------CCCccCcchhhccCCchHHHHHHHHhcCCC
Q psy12195        212 AHNDS---------VHQIQCPYCITDFSEDKNLIQHIVSVHLGK  246 (254)
Q Consensus       212 ~h~~~---------~~~~~C~~C~~~f~~~~~l~~H~~~~h~~~  246 (254)
                      +|+..         .+.|.|..||..-.....+..|++..|..-
T Consensus       196 vhgv~~~yaykerr~kl~vcedcg~t~~~~e~~~~h~~~~hp~S  239 (267)
T KOG3576|consen  196 VHGVQHQYAYKERRAKLYVCEDCGYTSERPEVYYLHLKLHHPFS  239 (267)
T ss_pred             HcCchHHHHHHHhhhheeeecccCCCCCChhHHHHHHHhcCCCC
Confidence            88752         366999999999999999999997777543


No 9  
>KOG3623|consensus
Probab=99.61  E-value=2.7e-16  Score=129.03  Aligned_cols=105  Identities=22%  Similarity=0.557  Sum_probs=90.3

Q ss_pred             cccccchhhccChHHHHHHHHhhhccCCCcccccccccccCCHHHHHHHHHhcCC---------------cccccCCCcc
Q psy12195        105 MSCVPCDVLFHNKATLYKHLYLEHKATSLSIQCNMCSLVLDSKESLVTHISQTHT---------------LMFTCRRCPS  169 (254)
Q Consensus       105 ~~C~~C~~~f~~~~~l~~H~~~~~~~~~~~~~C~~C~~~f~~~~~l~~h~~~~~~---------------~~~~C~~C~~  169 (254)
                      ..|++|++.+....+|+.|++..|...+-.|.|.+|..+|-.+..|.+|+. .|.               +.|+|.+||+
T Consensus       211 ltcpycdrgykrltslkeHikyrhekne~nfsC~lCsytFAyRtQLErhm~-~hkpg~dqa~sltqsa~lRKFKCtECgK  289 (1007)
T KOG3623|consen  211 LTCPYCDRGYKRLTSLKEHIKYRHEKNEPNFSCMLCSYTFAYRTQLERHMQ-LHKPGGDQAISLTQSALLRKFKCTECGK  289 (1007)
T ss_pred             hcchhHHHHHHHHHHHHHHHHHHHhhCCCCCcchhhhhhhhhHHHHHHHHH-hhcCCCcccccccchhhhccccccccch
Confidence            689999999999999999999877666657899999999999999999976 332               5688999999


Q ss_pred             cCCChHHHHHHHhHhhCCCcccCCCCcccCCCHHHHHHHHH
Q psy12195        170 TFLNSATLSKHVKMEHNSKSYQCNECPESFERLNKLKRHKF  210 (254)
Q Consensus       170 ~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~  210 (254)
                      .|..+-.|+.|+++|.|||||.|+.|+|+|+-..++..|+.
T Consensus       290 AFKfKHHLKEHlRIHSGEKPfeCpnCkKRFSHSGSySSHmS  330 (1007)
T KOG3623|consen  290 AFKFKHHLKEHLRIHSGEKPFECPNCKKRFSHSGSYSSHMS  330 (1007)
T ss_pred             hhhhHHHHHhhheeecCCCCcCCcccccccccCCccccccc
Confidence            99999999999999999999999999999988888888875


No 10 
>KOG3576|consensus
Probab=99.61  E-value=7.3e-17  Score=112.80  Aligned_cols=88  Identities=30%  Similarity=0.505  Sum_probs=82.5

Q ss_pred             cccccCCCcccCCChHHHHHHHhHhhCCCcccCCCCcccCCCHHHHHHHHHHhhcCCCCCccCcchhhccCCchHHHHHH
Q psy12195        160 LMFTCRRCPSTFLNSATLSKHVKMEHNSKSYQCNECPESFERLNKLKRHKFQAHNDSVHQIQCPYCITDFSEDKNLIQHI  239 (254)
Q Consensus       160 ~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~~h~~~~~~~~C~~C~~~f~~~~~l~~H~  239 (254)
                      ..|.|.+|++.|.....|.+|+.-|...+.|-|..|||+|++--.|++|++ .|++ .+||+|.+|+|.|++...|..|+
T Consensus       116 d~ftCrvCgK~F~lQRmlnrh~kch~~vkr~lct~cgkgfndtfdlkrh~r-thtg-vrpykc~~c~kaftqrcsleshl  193 (267)
T KOG3576|consen  116 DSFTCRVCGKKFGLQRMLNRHLKCHSDVKRHLCTFCGKGFNDTFDLKRHTR-THTG-VRPYKCSLCEKAFTQRCSLESHL  193 (267)
T ss_pred             CeeeeehhhhhhhHHHHHHHHhhhccHHHHHHHhhccCcccchhhhhhhhc-cccC-ccccchhhhhHHHHhhccHHHHH
Confidence            569999999999999999999999999999999999999999999999999 7888 89999999999999999999999


Q ss_pred             HHhcCCCCCC
Q psy12195        240 VSVHLGKEGT  249 (254)
Q Consensus       240 ~~~h~~~~~~  249 (254)
                      +.+|.-...|
T Consensus       194 ~kvhgv~~~y  203 (267)
T KOG3576|consen  194 KKVHGVQHQY  203 (267)
T ss_pred             HHHcCchHHH
Confidence            9999765443


No 11 
>PLN03086 PRLI-interacting factor K; Provisional
Probab=99.32  E-value=7.1e-12  Score=103.47  Aligned_cols=147  Identities=17%  Similarity=0.388  Sum_probs=112.3

Q ss_pred             cccccccccccccHHHHHhHHhhhccCCCCccccc--chhhccChHHHHHHHHhhhccCCCcccccccccccCCHHHHHH
Q psy12195         75 IYECNQCKEKTNDMTTMLNHYSVKHYMDINMSCVP--CDVLFHNKATLYKHLYLEHKATSLSIQCNMCSLVLDSKESLVT  152 (254)
Q Consensus        75 ~~~C~~C~~~~~~~~~l~~h~~~~h~~~~~~~C~~--C~~~f~~~~~l~~H~~~~~~~~~~~~~C~~C~~~f~~~~~l~~  152 (254)
                      ...|+.|...... ..|..|. . +=.-..-.|+.  |+..|.. ..+..|           +.|+.|++.|. .+.|..
T Consensus       407 ~V~C~NC~~~i~l-~~l~lHe-~-~C~r~~V~Cp~~~Cg~v~~r-~el~~H-----------~~C~~Cgk~f~-~s~Lek  470 (567)
T PLN03086        407 TVECRNCKHYIPS-RSIALHE-A-YCSRHNVVCPHDGCGIVLRV-EEAKNH-----------VHCEKCGQAFQ-QGEMEK  470 (567)
T ss_pred             eEECCCCCCccch-hHHHHHH-h-hCCCcceeCCcccccceeec-cccccC-----------ccCCCCCCccc-hHHHHH
Confidence            4579989877554 5566776 3 33345556874  9888732 333333           47999999996 678999


Q ss_pred             HHHhcCCcccccCCCcccCCChHHHHHHHhHhhCCCcccCCCCcccCC----------CHHHHHHHHHHhhcCCCCCccC
Q psy12195        153 HISQTHTLMFTCRRCPSTFLNSATLSKHVKMEHNSKSYQCNECPESFE----------RLNKLKRHKFQAHNDSVHQIQC  222 (254)
Q Consensus       153 h~~~~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~----------~~~~l~~H~~~~h~~~~~~~~C  222 (254)
                      |+... ..++.|+ ||..+ ....|..|+.+|.+++++.|+.|++.|.          ..+.|..|... . + .+++.|
T Consensus       471 H~~~~-Hkpv~Cp-Cg~~~-~R~~L~~H~~thCp~Kpi~C~fC~~~v~~g~~~~d~~d~~s~Lt~HE~~-C-G-~rt~~C  544 (567)
T PLN03086        471 HMKVF-HEPLQCP-CGVVL-EKEQMVQHQASTCPLRLITCRFCGDMVQAGGSAMDVRDRLRGMSEHESI-C-G-SRTAPC  544 (567)
T ss_pred             HHHhc-CCCccCC-CCCCc-chhHHHhhhhccCCCCceeCCCCCCccccCccccchhhhhhhHHHHHHh-c-C-CcceEc
Confidence            98844 5899999 99755 6789999999999999999999999995          24689999874 3 4 678999


Q ss_pred             cchhhccCCchHHHHHHHHhcC
Q psy12195        223 PYCITDFSEDKNLIQHIVSVHL  244 (254)
Q Consensus       223 ~~C~~~f~~~~~l~~H~~~~h~  244 (254)
                      ..|++.+..+ .|..|+...|.
T Consensus       545 ~~Cgk~Vrlr-dm~~H~~~~h~  565 (567)
T PLN03086        545 DSCGRSVMLK-EMDIHQIAVHQ  565 (567)
T ss_pred             cccCCeeeeh-hHHHHHHHhhc
Confidence            9999888765 68899977774


No 12 
>PHA00733 hypothetical protein
Probab=99.30  E-value=3.8e-12  Score=86.02  Aligned_cols=80  Identities=20%  Similarity=0.360  Sum_probs=54.2

Q ss_pred             cccccCCCcccCCChHHHHHH--H---hHhhCCCcccCCCCcccCCCHHHHHHHHHHhhcCCCCCccCcchhhccCCchH
Q psy12195        160 LMFTCRRCPSTFLNSATLSKH--V---KMEHNSKSYQCNECPESFERLNKLKRHKFQAHNDSVHQIQCPYCITDFSEDKN  234 (254)
Q Consensus       160 ~~~~C~~C~~~f~~~~~l~~H--~---~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~~h~~~~~~~~C~~C~~~f~~~~~  234 (254)
                      +++.|++|+..|..+..|..+  +   ..+.+++||.|+.||+.|.+.+.|..|++. +   ..+|.|+.|++.|.....
T Consensus        39 ~~~~~~~~~~~~~~~~~l~~~~~l~~~~~~~~~kPy~C~~Cgk~Fss~s~L~~H~r~-h---~~~~~C~~CgK~F~~~~s  114 (128)
T PHA00733         39 KRLIRAVVKTLIYNPQLLDESSYLYKLLTSKAVSPYVCPLCLMPFSSSVSLKQHIRY-T---EHSKVCPVCGKEFRNTDS  114 (128)
T ss_pred             hhHHHHHHhhhccChhhhcchHHHHhhcccCCCCCccCCCCCCcCCCHHHHHHHHhc-C---CcCccCCCCCCccCCHHH
Confidence            556666666666555544444  1   122347788888888888888888888763 3   235788888888888888


Q ss_pred             HHHHHHHhc
Q psy12195        235 LIQHIVSVH  243 (254)
Q Consensus       235 l~~H~~~~h  243 (254)
                      |..|+...|
T Consensus       115 L~~H~~~~h  123 (128)
T PHA00733        115 TLDHVCKKH  123 (128)
T ss_pred             HHHHHHHhc
Confidence            888886655


No 13 
>PLN03086 PRLI-interacting factor K; Provisional
Probab=99.23  E-value=9.3e-11  Score=96.98  Aligned_cols=146  Identities=25%  Similarity=0.506  Sum_probs=88.8

Q ss_pred             eeecCcCCcccCCCCccchhhhhccCCCCCCccccc--ccccccccHHHHHhHHhhhccCCCCcccccchhhccChHHHH
Q psy12195         44 LMKCTNCNVLVPRDEILPHLSIQHCQGTTPSIYECN--QCKEKTNDMTTMLNHYSVKHYMDINMSCVPCDVLFHNKATLY  121 (254)
Q Consensus        44 ~~~C~~C~~~~~~~~~l~~~~~~h~~~~~~~~~~C~--~C~~~~~~~~~l~~h~~~~h~~~~~~~C~~C~~~f~~~~~l~  121 (254)
                      ...|..|.+..+......|... -    .-....|+  .|+..|.. ..+          +..+.|+.|+..|. ...|.
T Consensus       407 ~V~C~NC~~~i~l~~l~lHe~~-C----~r~~V~Cp~~~Cg~v~~r-~el----------~~H~~C~~Cgk~f~-~s~Le  469 (567)
T PLN03086        407 TVECRNCKHYIPSRSIALHEAY-C----SRHNVVCPHDGCGIVLRV-EEA----------KNHVHCEKCGQAFQ-QGEME  469 (567)
T ss_pred             eEECCCCCCccchhHHHHHHhh-C----CCcceeCCcccccceeec-ccc----------ccCccCCCCCCccc-hHHHH
Confidence            4567777665555543322221 1    12234565  37766631 112          22246777777774 56677


Q ss_pred             HHHHhhhccCCCcccccccccccCCHHHHHHHHHh-cCCcccccCCCcccCC----------ChHHHHHHHhHhhCCCcc
Q psy12195        122 KHLYLEHKATSLSIQCNMCSLVLDSKESLVTHISQ-THTLMFTCRRCPSTFL----------NSATLSKHVKMEHNSKSY  190 (254)
Q Consensus       122 ~H~~~~~~~~~~~~~C~~C~~~f~~~~~l~~h~~~-~~~~~~~C~~C~~~f~----------~~~~l~~H~~~h~~~~~~  190 (254)
                      .|+..+|    .++.|+ ||..+ .+..|..|+.. ...+++.|+.|+..|.          ....|..|..++ +.+++
T Consensus       470 kH~~~~H----kpv~Cp-Cg~~~-~R~~L~~H~~thCp~Kpi~C~fC~~~v~~g~~~~d~~d~~s~Lt~HE~~C-G~rt~  542 (567)
T PLN03086        470 KHMKVFH----EPLQCP-CGVVL-EKEQMVQHQASTCPLRLITCRFCGDMVQAGGSAMDVRDRLRGMSEHESIC-GSRTA  542 (567)
T ss_pred             HHHHhcC----CCccCC-CCCCc-chhHHHhhhhccCCCCceeCCCCCCccccCccccchhhhhhhHHHHHHhc-CCcce
Confidence            7777743    267777 77644 45677777652 2237788888887774          134688888875 88888


Q ss_pred             cCCCCcccCCCHHHHHHHHHHhhc
Q psy12195        191 QCNECPESFERLNKLKRHKFQAHN  214 (254)
Q Consensus       191 ~C~~C~~~f~~~~~l~~H~~~~h~  214 (254)
                      .|..||+.+. ...+..|+.+.|.
T Consensus       543 ~C~~Cgk~Vr-lrdm~~H~~~~h~  565 (567)
T PLN03086        543 PCDSCGRSVM-LKEMDIHQIAVHQ  565 (567)
T ss_pred             EccccCCeee-ehhHHHHHHHhhc
Confidence            8888888874 4567777776664


No 14 
>PHA00733 hypothetical protein
Probab=99.20  E-value=3.5e-11  Score=81.31  Aligned_cols=80  Identities=18%  Similarity=0.342  Sum_probs=62.5

Q ss_pred             cccccccccccCCHHHHHH------HHHhcCCcccccCCCcccCCChHHHHHHHhHhhCCCcccCCCCcccCCCHHHHHH
Q psy12195        134 SIQCNMCSLVLDSKESLVT------HISQTHTLMFTCRRCPSTFLNSATLSKHVKMEHNSKSYQCNECPESFERLNKLKR  207 (254)
Q Consensus       134 ~~~C~~C~~~f~~~~~l~~------h~~~~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~  207 (254)
                      ++.|.+|...|.....|..      ++.....+||.|+.|++.|.....|..|++.+  +.+|.|++|+++|.....|.+
T Consensus        40 ~~~~~~~~~~~~~~~~l~~~~~l~~~~~~~~~kPy~C~~Cgk~Fss~s~L~~H~r~h--~~~~~C~~CgK~F~~~~sL~~  117 (128)
T PHA00733         40 RLIRAVVKTLIYNPQLLDESSYLYKLLTSKAVSPYVCPLCLMPFSSSVSLKQHIRYT--EHSKVCPVCGKEFRNTDSTLD  117 (128)
T ss_pred             hHHHHHHhhhccChhhhcchHHHHhhcccCCCCCccCCCCCCcCCCHHHHHHHHhcC--CcCccCCCCCCccCCHHHHHH
Confidence            5666666666655444433      33334458999999999999999999999976  467999999999999999999


Q ss_pred             HHHHhhcC
Q psy12195        208 HKFQAHND  215 (254)
Q Consensus       208 H~~~~h~~  215 (254)
                      |+...|+-
T Consensus       118 H~~~~h~~  125 (128)
T PHA00733        118 HVCKKHNI  125 (128)
T ss_pred             HHHHhcCc
Confidence            99887754


No 15 
>PHA02768 hypothetical protein; Provisional
Probab=99.07  E-value=5.6e-11  Score=66.05  Aligned_cols=42  Identities=19%  Similarity=0.384  Sum_probs=22.7

Q ss_pred             ccCCCCcccCCCHHHHHHHHHHhhcCCCCCccCcchhhccCCchHH
Q psy12195        190 YQCNECPESFERLNKLKRHKFQAHNDSVHQIQCPYCITDFSEDKNL  235 (254)
Q Consensus       190 ~~C~~C~~~f~~~~~l~~H~~~~h~~~~~~~~C~~C~~~f~~~~~l  235 (254)
                      |.|++||+.|...++|.+|++. |.   ++|+|..|++.|...+.|
T Consensus         6 y~C~~CGK~Fs~~~~L~~H~r~-H~---k~~kc~~C~k~f~~~s~l   47 (55)
T PHA02768          6 YECPICGEIYIKRKSMITHLRK-HN---TNLKLSNCKRISLRTGEY   47 (55)
T ss_pred             cCcchhCCeeccHHHHHHHHHh-cC---CcccCCcccceeccccee
Confidence            4555555555555555555553 32   245555555555555544


No 16 
>PHA02768 hypothetical protein; Provisional
Probab=99.04  E-value=8.6e-11  Score=65.32  Aligned_cols=44  Identities=11%  Similarity=0.381  Sum_probs=40.7

Q ss_pred             ccccCCCcccCCChHHHHHHHhHhhCCCcccCCCCcccCCCHHHHH
Q psy12195        161 MFTCRRCPSTFLNSATLSKHVKMEHNSKSYQCNECPESFERLNKLK  206 (254)
Q Consensus       161 ~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~  206 (254)
                      .|.|+.||+.|.....|..|+++|+  ++|+|..|++.|...+.|.
T Consensus         5 ~y~C~~CGK~Fs~~~~L~~H~r~H~--k~~kc~~C~k~f~~~s~l~   48 (55)
T PHA02768          5 GYECPICGEIYIKRKSMITHLRKHN--TNLKLSNCKRISLRTGEYI   48 (55)
T ss_pred             ccCcchhCCeeccHHHHHHHHHhcC--CcccCCcccceecccceeE
Confidence            4899999999999999999999999  7999999999999887764


No 17 
>PF05605 zf-Di19:  Drought induced 19 protein (Di19), zinc-binding;  InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins. Di19 has been found to be strongly expressed in both the roots and leaves of Arabidopsis thaliana during progressive drought [], whilst RING finger proteins are thought to play a role in spermatogenesis. The precise function is unknown.
Probab=98.93  E-value=2.8e-09  Score=60.77  Aligned_cols=53  Identities=28%  Similarity=0.557  Sum_probs=44.6

Q ss_pred             cccCCCCcccCCCHHHHHHHHHHhhcCCCCCccCcchhhccCCchHHHHHHHHhcC
Q psy12195        189 SYQCNECPESFERLNKLKRHKFQAHNDSVHQIQCPYCITDFSEDKNLIQHIVSVHL  244 (254)
Q Consensus       189 ~~~C~~C~~~f~~~~~l~~H~~~~h~~~~~~~~C~~C~~~f~~~~~l~~H~~~~h~  244 (254)
                      .|.||+|++. .+..+|..|....|....+.+.||+|...++  .+|..||...|.
T Consensus         2 ~f~CP~C~~~-~~~~~L~~H~~~~H~~~~~~v~CPiC~~~~~--~~l~~Hl~~~H~   54 (54)
T PF05605_consen    2 SFTCPYCGKG-FSESSLVEHCEDEHRSESKNVVCPICSSRVT--DNLIRHLNSQHR   54 (54)
T ss_pred             CcCCCCCCCc-cCHHHHHHHHHhHCcCCCCCccCCCchhhhh--hHHHHHHHHhcC
Confidence            4899999995 5678999999989988778899999998655  499999977763


No 18 
>PF13465 zf-H2C2_2:  Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A ....
Probab=98.87  E-value=1.2e-09  Score=51.99  Aligned_cols=26  Identities=31%  Similarity=0.756  Sum_probs=21.7

Q ss_pred             HHHHHHhHhhCCCcccCCCCcccCCC
Q psy12195        176 TLSKHVKMEHNSKSYQCNECPESFER  201 (254)
Q Consensus       176 ~l~~H~~~h~~~~~~~C~~C~~~f~~  201 (254)
                      +|..|+++|++++||.|++|+++|.+
T Consensus         1 ~l~~H~~~H~~~k~~~C~~C~k~F~~   26 (26)
T PF13465_consen    1 NLRRHMRTHTGEKPYKCPYCGKSFSN   26 (26)
T ss_dssp             HHHHHHHHHSSSSSEEESSSSEEESS
T ss_pred             CHHHHhhhcCCCCCCCCCCCcCeeCc
Confidence            47788888999999999999888853


No 19 
>KOG3993|consensus
Probab=98.78  E-value=9e-10  Score=85.97  Aligned_cols=167  Identities=19%  Similarity=0.306  Sum_probs=111.0

Q ss_pred             cccccccccccccHHHHHhHHhhhccCCCCcccccchhhccChHHHHHHHHhhhccCCCccc--ccccccccCCHHHHHH
Q psy12195         75 IYECNQCKEKTNDMTTMLNHYSVKHYMDINMSCVPCDVLFHNKATLYKHLYLEHKATSLSIQ--CNMCSLVLDSKESLVT  152 (254)
Q Consensus        75 ~~~C~~C~~~~~~~~~l~~h~~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~~~~~~~~~~~--C~~C~~~f~~~~~l~~  152 (254)
                      .|.|..|...|.+...|..|. -.-.....|.|+.|++.|+...+|..|.+.|-.... .-.  -+.=...-... .+..
T Consensus       267 dyiCqLCK~kYeD~F~LAQHr-C~RIV~vEYrCPEC~KVFsCPANLASHRRWHKPR~e-aa~a~~~P~k~~~~~r-ae~~  343 (500)
T KOG3993|consen  267 DYICQLCKEKYEDAFALAQHR-CPRIVHVEYRCPECDKVFSCPANLASHRRWHKPRPE-AAKAGSPPPKQAVETR-AEVQ  343 (500)
T ss_pred             HHHHHHHHHhhhhHHHHhhcc-CCeeEEeeecCCcccccccCchhhhhhhcccCCchh-hhhcCCCChhhhhhhh-hhhh
Confidence            589999999999999999996 545666789999999999999999999988432221 111  00000000000 1111


Q ss_pred             HHHhc----CCcccccCCCcccCCChHHHHHHHhHhhCC-----------------------------------------
Q psy12195        153 HISQT----HTLMFTCRRCPSTFLNSATLSKHVKMEHNS-----------------------------------------  187 (254)
Q Consensus       153 h~~~~----~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~-----------------------------------------  187 (254)
                      .....    .+.-|.|..|++.|.....|+.|+.+|...                                         
T Consensus       344 ea~rsg~dss~gi~~C~~C~KkFrRqAYLrKHqlthq~~~~~k~~a~~f~~s~~~~l~~~~~~~a~h~~a~~~~g~~vl~  423 (500)
T KOG3993|consen  344 EAERSGDDSSSGIFSCHTCGKKFRRQAYLRKHQLTHQRAPLAKEKAPKFLLSRVIPLMHFNQAVATHSSASDSHGDEVLY  423 (500)
T ss_pred             hccccCCcccCceeecHHhhhhhHHHHHHHHhHHhhhccccchhcccCcchhhcccccccccccccccccccccccceee
Confidence            11111    124688888888888888888888876521                                         


Q ss_pred             -----CcccCCCCcccCCCHHHHHHHHHHhhcCCCCCccCcchhhccCCchHHHHHHHHhcCCC
Q psy12195        188 -----KSYQCNECPESFERLNKLKRHKFQAHNDSVHQIQCPYCITDFSEDKNLIQHIVSVHLGK  246 (254)
Q Consensus       188 -----~~~~C~~C~~~f~~~~~l~~H~~~~h~~~~~~~~C~~C~~~f~~~~~l~~H~~~~h~~~  246 (254)
                           ....++++|-.+.++..-..+.+..+.  ...|.|.+|.-.|.+..+|.+|+..-|..+
T Consensus       424 ~a~sael~~pp~~~~ppsss~~sgg~~rlg~~--~q~f~~ky~~atfyss~~ltrhin~~Hpse  485 (500)
T KOG3993|consen  424 VAGSAELELPPYDGSPPSSSGSSGGYGRLGIA--EQGFTCKYCPATFYSSPGLTRHINKCHPSE  485 (500)
T ss_pred             eeccccccCCCCCCCCcccCCCCCccccccch--hhccccccchHhhhcCcchHhHhhhcChHH
Confidence                 114677888777666554444432121  346889999999999999999987777543


No 20 
>PHA00616 hypothetical protein
Probab=98.74  E-value=5e-09  Score=55.41  Aligned_cols=32  Identities=22%  Similarity=0.310  Sum_probs=19.1

Q ss_pred             CccCcchhhccCCchHHHHHHHHhcCCCCCCCC
Q psy12195        219 QIQCPYCITDFSEDKNLIQHIVSVHLGKEGTAP  251 (254)
Q Consensus       219 ~~~C~~C~~~f~~~~~l~~H~~~~h~~~~~~~c  251 (254)
                      +|+|+.||+.|.++++|..|+ +.|.|++|+.+
T Consensus         1 pYqC~~CG~~F~~~s~l~~H~-r~~hg~~~~~~   32 (44)
T PHA00616          1 MYQCLRCGGIFRKKKEVIEHL-LSVHKQNKLTL   32 (44)
T ss_pred             CCccchhhHHHhhHHHHHHHH-HHhcCCCccce
Confidence            355666666666666666666 55555566554


No 21 
>KOG3993|consensus
Probab=98.61  E-value=4.4e-09  Score=82.22  Aligned_cols=201  Identities=16%  Similarity=0.166  Sum_probs=127.3

Q ss_pred             eeeeecccccccCCCHHHHHhhhcccccCcceeecCcCCcccCCCCccchhhhhccCCCCCCcccccccccccccHHHHH
Q psy12195         13 VVIIRCETCTRNYESLESLTTHLSFKHSNQFLMKCTNCNVLVPRDEILPHLSIQHCQGTTPSIYECNQCKEKTNDMTTML   92 (254)
Q Consensus        13 ~~~~~C~~C~~~f~~~~~l~~H~~~~h~~~~~~~C~~C~~~~~~~~~l~~~~~~h~~~~~~~~~~C~~C~~~~~~~~~l~   92 (254)
                      ...|.|..|...|.+.-.|.+|... .-....|+|.+|+|.|....+|..|+++|.+..+...-.-+.=... .....+.
T Consensus       265 iGdyiCqLCK~kYeD~F~LAQHrC~-RIV~vEYrCPEC~KVFsCPANLASHRRWHKPR~eaa~a~~~P~k~~-~~~rae~  342 (500)
T KOG3993|consen  265 IGDYICQLCKEKYEDAFALAQHRCP-RIVHVEYRCPECDKVFSCPANLASHRRWHKPRPEAAKAGSPPPKQA-VETRAEV  342 (500)
T ss_pred             HHHHHHHHHHHhhhhHHHHhhccCC-eeEEeeecCCcccccccCchhhhhhhcccCCchhhhhcCCCChhhh-hhhhhhh
Confidence            5678899999999999999999876 5556679999999999999999999998854322110000000000 0000111


Q ss_pred             hHH--hhhccCCCCcccccchhhccChHHHHHHHHhhhccCCC---------------cccccccccccCCHHHHHHHHH
Q psy12195         93 NHY--SVKHYMDINMSCVPCDVLFHNKATLYKHLYLEHKATSL---------------SIQCNMCSLVLDSKESLVTHIS  155 (254)
Q Consensus        93 ~h~--~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~~~~~~~~---------------~~~C~~C~~~f~~~~~l~~h~~  155 (254)
                      ...  ......+.-|.|..|++.|.....|+.|+..++.....               -+-+..++..+.....-..+..
T Consensus       343 ~ea~rsg~dss~gi~~C~~C~KkFrRqAYLrKHqlthq~~~~~k~~a~~f~~s~~~~l~~~~~~~a~h~~a~~~~g~~vl  422 (500)
T KOG3993|consen  343 QEAERSGDDSSSGIFSCHTCGKKFRRQAYLRKHQLTHQRAPLAKEKAPKFLLSRVIPLMHFNQAVATHSSASDSHGDEVL  422 (500)
T ss_pred             hhccccCCcccCceeecHHhhhhhHHHHHHHHhHHhhhccccchhcccCcchhhccccccccccccccccccccccccee
Confidence            110  01113345799999999999999999998886633221               1224444443332222111110


Q ss_pred             h-cC-CcccccCCCcccCCChHHHHHHHhHhhCCCcccCCCCcccCCCHHHHHHHHHHhhcC
Q psy12195        156 Q-TH-TLMFTCRRCPSTFLNSATLSKHVKMEHNSKSYQCNECPESFERLNKLKRHKFQAHND  215 (254)
Q Consensus       156 ~-~~-~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~~h~~  215 (254)
                      . .. ..-..++.++..+.++..--.+.+.-..+..|.|.+|.-+|.+...|.+|+.+.|..
T Consensus       423 ~~a~sael~~pp~~~~ppsss~~sgg~~rlg~~~q~f~~ky~~atfyss~~ltrhin~~Hps  484 (500)
T KOG3993|consen  423 YVAGSAELELPPYDGSPPSSSGSSGGYGRLGIAEQGFTCKYCPATFYSSPGLTRHINKCHPS  484 (500)
T ss_pred             eeeccccccCCCCCCCCcccCCCCCccccccchhhccccccchHhhhcCcchHhHhhhcChH
Confidence            0 00 122456778877766655444545455667899999999999999999999877755


No 22 
>PHA00732 hypothetical protein
Probab=98.57  E-value=5.2e-08  Score=59.71  Aligned_cols=55  Identities=29%  Similarity=0.612  Sum_probs=36.2

Q ss_pred             ccccCCCcccCCChHHHHHHHhH-hhCCCcccCCCCcccCCCHHHHHHHHHHhhcCCCCCccC
Q psy12195        161 MFTCRRCPSTFLNSATLSKHVKM-EHNSKSYQCNECPESFERLNKLKRHKFQAHNDSVHQIQC  222 (254)
Q Consensus       161 ~~~C~~C~~~f~~~~~l~~H~~~-h~~~~~~~C~~C~~~f~~~~~l~~H~~~~h~~~~~~~~C  222 (254)
                      ||.|+.|++.|.+...|..|++. |.   ++.|+.||++|.   .|..|.. ...+-.....|
T Consensus         1 py~C~~Cgk~F~s~s~Lk~H~r~~H~---~~~C~~CgKsF~---~l~~H~~-~~~~~~~~~~~   56 (79)
T PHA00732          1 MFKCPICGFTTVTLFALKQHARRNHT---LTKCPVCNKSYR---RLNQHFY-SQYDIEHLIYC   56 (79)
T ss_pred             CccCCCCCCccCCHHHHHHHhhcccC---CCccCCCCCEeC---Chhhhhc-ccCCccceEEe
Confidence            56788888888888888888774 54   357888888886   4677764 33332333333


No 23 
>PHA00616 hypothetical protein
Probab=98.49  E-value=5.3e-08  Score=51.53  Aligned_cols=25  Identities=28%  Similarity=0.635  Sum_probs=13.3

Q ss_pred             cccCCCCcccCCCHHHHHHHHHHhh
Q psy12195        189 SYQCNECPESFERLNKLKRHKFQAH  213 (254)
Q Consensus       189 ~~~C~~C~~~f~~~~~l~~H~~~~h  213 (254)
                      ||+|+.||+.|.+++.|.+|++.+|
T Consensus         1 pYqC~~CG~~F~~~s~l~~H~r~~h   25 (44)
T PHA00616          1 MYQCLRCGGIFRKKKEVIEHLLSVH   25 (44)
T ss_pred             CCccchhhHHHhhHHHHHHHHHHhc
Confidence            4555555555555555555555333


No 24 
>PF13465 zf-H2C2_2:  Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A ....
Probab=98.41  E-value=1.5e-07  Score=44.74  Aligned_cols=26  Identities=38%  Similarity=0.829  Sum_probs=22.4

Q ss_pred             HHHHHHHHhhcCCCCCccCcchhhccCC
Q psy12195        204 KLKRHKFQAHNDSVHQIQCPYCITDFSE  231 (254)
Q Consensus       204 ~l~~H~~~~h~~~~~~~~C~~C~~~f~~  231 (254)
                      +|.+|++ .|.+ +++|.|+.|++.|.+
T Consensus         1 ~l~~H~~-~H~~-~k~~~C~~C~k~F~~   26 (26)
T PF13465_consen    1 NLRRHMR-THTG-EKPYKCPYCGKSFSN   26 (26)
T ss_dssp             HHHHHHH-HHSS-SSSEEESSSSEEESS
T ss_pred             CHHHHhh-hcCC-CCCCCCCCCcCeeCc
Confidence            5889999 6888 789999999999974


No 25 
>PHA00732 hypothetical protein
Probab=98.36  E-value=3.1e-07  Score=56.35  Aligned_cols=44  Identities=30%  Similarity=0.575  Sum_probs=32.8

Q ss_pred             cccCCCCcccCCCHHHHHHHHHHhhcCCCCCccCcchhhccCCchHHHHHH
Q psy12195        189 SYQCNECPESFERLNKLKRHKFQAHNDSVHQIQCPYCITDFSEDKNLIQHI  239 (254)
Q Consensus       189 ~~~C~~C~~~f~~~~~l~~H~~~~h~~~~~~~~C~~C~~~f~~~~~l~~H~  239 (254)
                      ||.|++||+.|.+.+.|..|++.+|.+    +.|+.|++.|+   .|..|+
T Consensus         1 py~C~~Cgk~F~s~s~Lk~H~r~~H~~----~~C~~CgKsF~---~l~~H~   44 (79)
T PHA00732          1 MFKCPICGFTTVTLFALKQHARRNHTL----TKCPVCNKSYR---RLNQHF   44 (79)
T ss_pred             CccCCCCCCccCCHHHHHHHhhcccCC----CccCCCCCEeC---Chhhhh
Confidence            577888888888888888887644433    46888888887   466776


No 26 
>PF00096 zf-C2H2:  Zinc finger, C2H2 type;  InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger: #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C], where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter []. This entry represents the classical C2H2 zinc finger domain.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0005622 intracellular; PDB: 2D9H_A 2EPC_A 1SP1_A 1VA3_A 2WBT_B 2ELR_A 2YTP_A 2YTT_A 1VA1_A 2ELO_A ....
Probab=98.17  E-value=7.2e-07  Score=41.14  Aligned_cols=21  Identities=38%  Similarity=0.801  Sum_probs=13.0

Q ss_pred             ccCcchhhccCCchHHHHHHH
Q psy12195        220 IQCPYCITDFSEDKNLIQHIV  240 (254)
Q Consensus       220 ~~C~~C~~~f~~~~~l~~H~~  240 (254)
                      |+|+.|++.|++.++|..|++
T Consensus         1 y~C~~C~~~f~~~~~l~~H~~   21 (23)
T PF00096_consen    1 YKCPICGKSFSSKSNLKRHMR   21 (23)
T ss_dssp             EEETTTTEEESSHHHHHHHHH
T ss_pred             CCCCCCCCccCCHHHHHHHHh
Confidence            456666666666666666663


No 27 
>PF05605 zf-Di19:  Drought induced 19 protein (Di19), zinc-binding;  InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins. Di19 has been found to be strongly expressed in both the roots and leaves of Arabidopsis thaliana during progressive drought [], whilst RING finger proteins are thought to play a role in spermatogenesis. The precise function is unknown.
Probab=98.15  E-value=4e-06  Score=47.73  Aligned_cols=37  Identities=27%  Similarity=0.562  Sum_probs=14.4

Q ss_pred             cccccchhhccChHHHHHHHHhhhccCCCccccccccc
Q psy12195        105 MSCVPCDVLFHNKATLYKHLYLEHKATSLSIQCNMCSL  142 (254)
Q Consensus       105 ~~C~~C~~~f~~~~~l~~H~~~~~~~~~~~~~C~~C~~  142 (254)
                      |.||.|++. .+...|..|....|..+...+.|++|..
T Consensus         3 f~CP~C~~~-~~~~~L~~H~~~~H~~~~~~v~CPiC~~   39 (54)
T PF05605_consen    3 FTCPYCGKG-FSESSLVEHCEDEHRSESKNVVCPICSS   39 (54)
T ss_pred             cCCCCCCCc-cCHHHHHHHHHhHCcCCCCCccCCCchh
Confidence            334444442 2233344444443433333344444443


No 28 
>PF13894 zf-C2H2_4:  C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A ....
Probab=97.95  E-value=4.8e-06  Score=38.70  Aligned_cols=22  Identities=36%  Similarity=0.765  Sum_probs=10.9

Q ss_pred             ccCcchhhccCCchHHHHHHHH
Q psy12195        220 IQCPYCITDFSEDKNLIQHIVS  241 (254)
Q Consensus       220 ~~C~~C~~~f~~~~~l~~H~~~  241 (254)
                      |.|++|++.|.+...|..|++.
T Consensus         1 ~~C~~C~~~~~~~~~l~~H~~~   22 (24)
T PF13894_consen    1 FQCPICGKSFRSKSELRQHMRT   22 (24)
T ss_dssp             EE-SSTS-EESSHHHHHHHHHH
T ss_pred             CCCcCCCCcCCcHHHHHHHHHh
Confidence            3455555555555555555533


No 29 
>PF00096 zf-C2H2:  Zinc finger, C2H2 type;  InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger: #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C], where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter []. This entry represents the classical C2H2 zinc finger domain.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0005622 intracellular; PDB: 2D9H_A 2EPC_A 1SP1_A 1VA3_A 2WBT_B 2ELR_A 2YTP_A 2YTT_A 1VA1_A 2ELO_A ....
Probab=97.94  E-value=6.3e-06  Score=37.91  Aligned_cols=22  Identities=41%  Similarity=0.786  Sum_probs=15.5

Q ss_pred             ccCCCCcccCCCHHHHHHHHHH
Q psy12195        190 YQCNECPESFERLNKLKRHKFQ  211 (254)
Q Consensus       190 ~~C~~C~~~f~~~~~l~~H~~~  211 (254)
                      |.|++|++.|.+...|.+|++.
T Consensus         1 y~C~~C~~~f~~~~~l~~H~~~   22 (23)
T PF00096_consen    1 YKCPICGKSFSSKSNLKRHMRR   22 (23)
T ss_dssp             EEETTTTEEESSHHHHHHHHHH
T ss_pred             CCCCCCCCccCCHHHHHHHHhH
Confidence            5677777777777777777664


No 30 
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning]
Probab=97.94  E-value=1.8e-06  Score=65.44  Aligned_cols=54  Identities=24%  Similarity=0.552  Sum_probs=45.6

Q ss_pred             CCCcccCCC--CcccCCCHHHHHHHHHHhhcC-----------------CCCCccCcchhhccCCchHHHHHH
Q psy12195        186 NSKSYQCNE--CPESFERLNKLKRHKFQAHND-----------------SVHQIQCPYCITDFSEDKNLIQHI  239 (254)
Q Consensus       186 ~~~~~~C~~--C~~~f~~~~~l~~H~~~~h~~-----------------~~~~~~C~~C~~~f~~~~~l~~H~  239 (254)
                      +++||+||+  |.|++.....|+.|+.-.|..                 +.+||+|++|+|.+.....|.-|.
T Consensus       346 d~KpykCpV~gC~K~YknqnGLKYH~lhGH~~~~~~~~p~p~~~~~F~~~~KPYrCevC~KRYKNlNGLKYHr  418 (423)
T COG5189         346 DGKPYKCPVEGCNKKYKNQNGLKYHMLHGHQNQKLHENPSPEKMNIFSAKDKPYRCEVCDKRYKNLNGLKYHR  418 (423)
T ss_pred             cCceecCCCCCchhhhccccchhhhhhccccCcccCCCCCccccccccccCCceeccccchhhccCccceecc
Confidence            358999987  999999999999999754411                 248999999999999999998885


No 31 
>PF13894 zf-C2H2_4:  C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A ....
Probab=97.85  E-value=1.5e-05  Score=36.96  Aligned_cols=24  Identities=33%  Similarity=0.708  Sum_probs=15.9

Q ss_pred             ccCCCCcccCCCHHHHHHHHHHhh
Q psy12195        190 YQCNECPESFERLNKLKRHKFQAH  213 (254)
Q Consensus       190 ~~C~~C~~~f~~~~~l~~H~~~~h  213 (254)
                      |.|++|++.|.+...|..|+..+|
T Consensus         1 ~~C~~C~~~~~~~~~l~~H~~~~H   24 (24)
T PF13894_consen    1 FQCPICGKSFRSKSELRQHMRTHH   24 (24)
T ss_dssp             EE-SSTS-EESSHHHHHHHHHHHS
T ss_pred             CCCcCCCCcCCcHHHHHHHHHhhC
Confidence            567777777777777777776543


No 32 
>PF12756 zf-C2H2_2:  C2H2 type zinc-finger (2 copies); PDB: 2DMI_A.
Probab=97.84  E-value=9.6e-06  Score=52.86  Aligned_cols=23  Identities=26%  Similarity=0.658  Sum_probs=0.0

Q ss_pred             ccccccccCCHHHHHHHHHhcCC
Q psy12195        137 CNMCSLVLDSKESLVTHISQTHT  159 (254)
Q Consensus       137 C~~C~~~f~~~~~l~~h~~~~~~  159 (254)
                      |..|+..|.+...|..|+...|.
T Consensus         2 C~~C~~~f~~~~~l~~H~~~~H~   24 (100)
T PF12756_consen    2 CLFCDESFSSVDDLLQHMKKKHG   24 (100)
T ss_dssp             -----------------------
T ss_pred             ccccccccccccccccccccccc
Confidence            55566666555555555544444


No 33 
>PF12756 zf-C2H2_2:  C2H2 type zinc-finger (2 copies); PDB: 2DMI_A.
Probab=97.84  E-value=1.1e-05  Score=52.55  Aligned_cols=21  Identities=33%  Similarity=0.890  Sum_probs=9.5

Q ss_pred             ccCcchhhccCCchHHHHHHH
Q psy12195        220 IQCPYCITDFSEDKNLIQHIV  240 (254)
Q Consensus       220 ~~C~~C~~~f~~~~~l~~H~~  240 (254)
                      +.|..|++.|.+...|..||+
T Consensus        51 ~~C~~C~~~f~s~~~l~~Hm~   71 (100)
T PF12756_consen   51 FRCPYCNKTFRSREALQEHMR   71 (100)
T ss_dssp             EEBSSSS-EESSHHHHHHHHH
T ss_pred             CCCCccCCCCcCHHHHHHHHc
Confidence            444444444444444444443


No 34 
>PF13912 zf-C2H2_6:  C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B.
Probab=97.66  E-value=2.2e-05  Score=37.61  Aligned_cols=20  Identities=30%  Similarity=0.506  Sum_probs=9.0

Q ss_pred             ccCcchhhccCCchHHHHHH
Q psy12195        220 IQCPYCITDFSEDKNLIQHI  239 (254)
Q Consensus       220 ~~C~~C~~~f~~~~~l~~H~  239 (254)
                      |+|..|++.|.+..+|..|+
T Consensus         2 ~~C~~C~~~F~~~~~l~~H~   21 (27)
T PF13912_consen    2 FECDECGKTFSSLSALREHK   21 (27)
T ss_dssp             EEETTTTEEESSHHHHHHHH
T ss_pred             CCCCccCCccCChhHHHHHh
Confidence            34444444444444444444


No 35 
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning]
Probab=97.65  E-value=9.5e-06  Score=61.69  Aligned_cols=52  Identities=27%  Similarity=0.597  Sum_probs=44.5

Q ss_pred             CcccccCC--CcccCCChHHHHHHHhH-hh------------------CCCcccCCCCcccCCCHHHHHHHHH
Q psy12195        159 TLMFTCRR--CPSTFLNSATLSKHVKM-EH------------------NSKSYQCNECPESFERLNKLKRHKF  210 (254)
Q Consensus       159 ~~~~~C~~--C~~~f~~~~~l~~H~~~-h~------------------~~~~~~C~~C~~~f~~~~~l~~H~~  210 (254)
                      ++||+|++  |.+.+.+...|+-|+.- |.                  .+|||.|++|+|++.....|+.|+.
T Consensus       347 ~KpykCpV~gC~K~YknqnGLKYH~lhGH~~~~~~~~p~p~~~~~F~~~~KPYrCevC~KRYKNlNGLKYHr~  419 (423)
T COG5189         347 GKPYKCPVEGCNKKYKNQNGLKYHMLHGHQNQKLHENPSPEKMNIFSAKDKPYRCEVCDKRYKNLNGLKYHRK  419 (423)
T ss_pred             CceecCCCCCchhhhccccchhhhhhccccCcccCCCCCccccccccccCCceeccccchhhccCccceeccc
Confidence            48899976  88999999999999875 31                  2489999999999999999999975


No 36 
>PF13912 zf-C2H2_6:  C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B.
Probab=97.63  E-value=1.5e-05  Score=38.24  Aligned_cols=25  Identities=32%  Similarity=0.797  Sum_probs=22.4

Q ss_pred             cccCCCCcccCCCHHHHHHHHHHhh
Q psy12195        189 SYQCNECPESFERLNKLKRHKFQAH  213 (254)
Q Consensus       189 ~~~C~~C~~~f~~~~~l~~H~~~~h  213 (254)
                      ||.|..|++.|.+...|..|++.++
T Consensus         1 ~~~C~~C~~~F~~~~~l~~H~~~h~   25 (27)
T PF13912_consen    1 PFECDECGKTFSSLSALREHKRSHC   25 (27)
T ss_dssp             SEEETTTTEEESSHHHHHHHHCTTT
T ss_pred             CCCCCccCCccCChhHHHHHhHHhc
Confidence            6899999999999999999997543


No 37 
>PF09237 GAGA:  GAGA factor;  InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  Members of this entry bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 1YUI_A 1YUJ_A.
Probab=97.30  E-value=8e-05  Score=40.38  Aligned_cols=30  Identities=27%  Similarity=0.514  Sum_probs=17.5

Q ss_pred             CCCCccCcchhhccCCchHHHHHHHHhcCC
Q psy12195        216 SVHQIQCPYCITDFSEDKNLIQHIVSVHLG  245 (254)
Q Consensus       216 ~~~~~~C~~C~~~f~~~~~l~~H~~~~h~~  245 (254)
                      ++.+-.||+|+..+.+..+|.+|+++.|..
T Consensus        21 S~~PatCP~C~a~~~~srnLrRHle~~H~~   50 (54)
T PF09237_consen   21 SEQPATCPICGAVIRQSRNLRRHLEIRHFK   50 (54)
T ss_dssp             TS--EE-TTT--EESSHHHHHHHHHHHTTT
T ss_pred             cCCCCCCCcchhhccchhhHHHHHHHHhcc
Confidence            356667777777777777777777666643


No 38 
>smart00355 ZnF_C2H2 zinc finger.
Probab=97.29  E-value=0.00023  Score=33.43  Aligned_cols=20  Identities=30%  Similarity=0.685  Sum_probs=11.8

Q ss_pred             ccCcchhhccCCchHHHHHH
Q psy12195        220 IQCPYCITDFSEDKNLIQHI  239 (254)
Q Consensus       220 ~~C~~C~~~f~~~~~l~~H~  239 (254)
                      |+|+.|++.|.+.+.|..|+
T Consensus         1 ~~C~~C~~~f~~~~~l~~H~   20 (26)
T smart00355        1 YRCPECGKVFKSKSALKEHM   20 (26)
T ss_pred             CCCCCCcchhCCHHHHHHHH
Confidence            34566666666666666665


No 39 
>PF13909 zf-H2C2_5:  C2H2-type zinc-finger domain; PDB: 1X5W_A.
Probab=97.28  E-value=0.00015  Score=33.55  Aligned_cols=23  Identities=35%  Similarity=0.648  Sum_probs=13.4

Q ss_pred             ccCcchhhccCCchHHHHHHHHhc
Q psy12195        220 IQCPYCITDFSEDKNLIQHIVSVH  243 (254)
Q Consensus       220 ~~C~~C~~~f~~~~~l~~H~~~~h  243 (254)
                      |+|+.|+...+ .++|.+|++..|
T Consensus         1 y~C~~C~y~t~-~~~l~~H~~~~H   23 (24)
T PF13909_consen    1 YKCPHCSYSTS-KSNLKRHLKRHH   23 (24)
T ss_dssp             EE-SSSS-EES-HHHHHHHHHHHH
T ss_pred             CCCCCCCCcCC-HHHHHHHHHhhC
Confidence            45677776666 667777765544


No 40 
>smart00355 ZnF_C2H2 zinc finger.
Probab=96.89  E-value=0.0012  Score=30.77  Aligned_cols=21  Identities=38%  Similarity=0.778  Sum_probs=13.2

Q ss_pred             ccCCCCcccCCCHHHHHHHHH
Q psy12195        190 YQCNECPESFERLNKLKRHKF  210 (254)
Q Consensus       190 ~~C~~C~~~f~~~~~l~~H~~  210 (254)
                      |.|+.|+++|.....|..|++
T Consensus         1 ~~C~~C~~~f~~~~~l~~H~~   21 (26)
T smart00355        1 YRCPECGKVFKSKSALKEHMR   21 (26)
T ss_pred             CCCCCCcchhCCHHHHHHHHH
Confidence            456666666666666666665


No 41 
>PRK04860 hypothetical protein; Provisional
Probab=96.84  E-value=0.00078  Score=47.48  Aligned_cols=38  Identities=21%  Similarity=0.672  Sum_probs=28.6

Q ss_pred             cccccCCCcccCCChHHHHHHHhHhhCCCcccCCCCcccCCC
Q psy12195        160 LMFTCRRCPSTFLNSATLSKHVKMEHNSKSYQCNECPESFER  201 (254)
Q Consensus       160 ~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~  201 (254)
                      -+|.|. |+.   ....+..|.++++++++|.|..|+..|..
T Consensus       118 ~~Y~C~-C~~---~~~~~rrH~ri~~g~~~YrC~~C~~~l~~  155 (160)
T PRK04860        118 FPYRCK-CQE---HQLTVRRHNRVVRGEAVYRCRRCGETLVF  155 (160)
T ss_pred             EEEEcC-CCC---eeCHHHHHHHHhcCCccEECCCCCceeEE
Confidence            367887 876   55677788888888888888888877754


No 42 
>PF12874 zf-met:  Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A.
Probab=96.83  E-value=0.00043  Score=32.33  Aligned_cols=20  Identities=35%  Similarity=0.760  Sum_probs=14.3

Q ss_pred             ccCcchhhccCCchHHHHHH
Q psy12195        220 IQCPYCITDFSEDKNLIQHI  239 (254)
Q Consensus       220 ~~C~~C~~~f~~~~~l~~H~  239 (254)
                      |.|.+|++.|++...|..|+
T Consensus         1 ~~C~~C~~~f~s~~~~~~H~   20 (25)
T PF12874_consen    1 FYCDICNKSFSSENSLRQHL   20 (25)
T ss_dssp             EEETTTTEEESSHHHHHHHH
T ss_pred             CCCCCCCCCcCCHHHHHHHH
Confidence            45777777777777777776


No 43 
>PF13909 zf-H2C2_5:  C2H2-type zinc-finger domain; PDB: 1X5W_A.
Probab=96.73  E-value=0.0017  Score=29.91  Aligned_cols=23  Identities=39%  Similarity=0.703  Sum_probs=13.6

Q ss_pred             ccCCCCcccCCCHHHHHHHHHHhh
Q psy12195        190 YQCNECPESFERLNKLKRHKFQAH  213 (254)
Q Consensus       190 ~~C~~C~~~f~~~~~l~~H~~~~h  213 (254)
                      |+|+.|+.... ...|.+|++.+|
T Consensus         1 y~C~~C~y~t~-~~~l~~H~~~~H   23 (24)
T PF13909_consen    1 YKCPHCSYSTS-KSNLKRHLKRHH   23 (24)
T ss_dssp             EE-SSSS-EES-HHHHHHHHHHHH
T ss_pred             CCCCCCCCcCC-HHHHHHHHHhhC
Confidence            56667776666 666777766554


No 44 
>PF12874 zf-met:  Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A.
Probab=96.63  E-value=0.0013  Score=30.62  Aligned_cols=18  Identities=39%  Similarity=0.837  Sum_probs=7.7

Q ss_pred             CCCCcccCCCHHHHHHHH
Q psy12195        192 CNECPESFERLNKLKRHK  209 (254)
Q Consensus       192 C~~C~~~f~~~~~l~~H~  209 (254)
                      |.+|++.|.+...|..|+
T Consensus         3 C~~C~~~f~s~~~~~~H~   20 (25)
T PF12874_consen    3 CDICNKSFSSENSLRQHL   20 (25)
T ss_dssp             ETTTTEEESSHHHHHHHH
T ss_pred             CCCCCCCcCCHHHHHHHH
Confidence            444444444444444443


No 45 
>PF09237 GAGA:  GAGA factor;  InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  Members of this entry bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 1YUI_A 1YUJ_A.
Probab=96.58  E-value=0.0025  Score=34.69  Aligned_cols=30  Identities=20%  Similarity=0.355  Sum_probs=17.4

Q ss_pred             CCCcccCCCCcccCCCHHHHHHHHHHhhcC
Q psy12195        186 NSKSYQCNECPESFERLNKLKRHKFQAHND  215 (254)
Q Consensus       186 ~~~~~~C~~C~~~f~~~~~l~~H~~~~h~~  215 (254)
                      .+.|-.||+|+..+++..+|.+|+...|..
T Consensus        21 S~~PatCP~C~a~~~~srnLrRHle~~H~~   50 (54)
T PF09237_consen   21 SEQPATCPICGAVIRQSRNLRRHLEIRHFK   50 (54)
T ss_dssp             TS--EE-TTT--EESSHHHHHHHHHHHTTT
T ss_pred             cCCCCCCCcchhhccchhhHHHHHHHHhcc
Confidence            456777777777777777777777666644


No 46 
>PF12171 zf-C2H2_jaz:  Zinc-finger double-stranded RNA-binding;  InterPro: IPR022755  This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length. The mammalian members of this group occur multiple times along the protein, joined by flexible linkers, and are referred to as JAZ - dsRNA-binding ZF protein - zinc-fingers. The JAZ proteins are expressed in all tissues tested and localise in the nucleus, particularly the nucleolus []. JAZ preferentially binds to double-stranded (ds) RNA or RNA/DNA hybrids rather than DNA. In addition to binding double-stranded RNA, these zinc-fingers are required for nucleolar localisation.   This entry represents the multiple-adjacent-C2H2 zinc finger, JAZ. ; PDB: 4DGW_A 1ZR9_A.
Probab=96.55  E-value=0.00039  Score=33.19  Aligned_cols=20  Identities=35%  Similarity=0.660  Sum_probs=14.1

Q ss_pred             ccCcchhhccCCchHHHHHH
Q psy12195        220 IQCPYCITDFSEDKNLIQHI  239 (254)
Q Consensus       220 ~~C~~C~~~f~~~~~l~~H~  239 (254)
                      |.|..|++.|++...|..|+
T Consensus         2 ~~C~~C~k~f~~~~~~~~H~   21 (27)
T PF12171_consen    2 FYCDACDKYFSSENQLKQHM   21 (27)
T ss_dssp             CBBTTTTBBBSSHHHHHCCT
T ss_pred             CCcccCCCCcCCHHHHHHHH
Confidence            56777777777777776666


No 47 
>PF12171 zf-C2H2_jaz:  Zinc-finger double-stranded RNA-binding;  InterPro: IPR022755  This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length. The mammalian members of this group occur multiple times along the protein, joined by flexible linkers, and are referred to as JAZ - dsRNA-binding ZF protein - zinc-fingers. The JAZ proteins are expressed in all tissues tested and localise in the nucleus, particularly the nucleolus []. JAZ preferentially binds to double-stranded (ds) RNA or RNA/DNA hybrids rather than DNA. In addition to binding double-stranded RNA, these zinc-fingers are required for nucleolar localisation.   This entry represents the multiple-adjacent-C2H2 zinc finger, JAZ. ; PDB: 4DGW_A 1ZR9_A.
Probab=96.21  E-value=0.0034  Score=29.86  Aligned_cols=22  Identities=23%  Similarity=0.649  Sum_probs=20.1

Q ss_pred             eecccccccCCCHHHHHhhhcc
Q psy12195         16 IRCETCTRNYESLESLTTHLSF   37 (254)
Q Consensus        16 ~~C~~C~~~f~~~~~l~~H~~~   37 (254)
                      |-|..|++.|.+...|..|+++
T Consensus         2 ~~C~~C~k~f~~~~~~~~H~~s   23 (27)
T PF12171_consen    2 FYCDACDKYFSSENQLKQHMKS   23 (27)
T ss_dssp             CBBTTTTBBBSSHHHHHCCTTS
T ss_pred             CCcccCCCCcCCHHHHHHHHcc
Confidence            6799999999999999999876


No 48 
>KOG2482|consensus
Probab=96.12  E-value=0.021  Score=44.53  Aligned_cols=147  Identities=15%  Similarity=0.307  Sum_probs=84.3

Q ss_pred             HHHhHHhhhccCCCCcccccchhhcc-ChHHHHHHHHhhhccCC--------------------CcccccccccccCCHH
Q psy12195         90 TMLNHYSVKHYMDINMSCVPCDVLFH-NKATLYKHLYLEHKATS--------------------LSIQCNMCSLVLDSKE  148 (254)
Q Consensus        90 ~l~~h~~~~h~~~~~~~C~~C~~~f~-~~~~l~~H~~~~~~~~~--------------------~~~~C~~C~~~f~~~~  148 (254)
                      .|..++...-......+|-.|...+. .++.+..|+-..|+-.-                    ..+.|.+|.+.|.++.
T Consensus       130 aLeqqQ~Eredt~fslqClFCn~e~lgnRs~~l~Hlf~~H~lniGlpDniVyvnelLehLkekL~r~~CLyCekifrdkn  209 (423)
T KOG2482|consen  130 ALEQQQKEREDTIFSLQCLFCNNEGLGNRSEILEHLFHVHGLNIGLPDNIVYVNELLEHLKEKLERLRCLYCEKIFRDKN  209 (423)
T ss_pred             HHHHHHHHhcCCeeeeEEEEecchhcccHHHHHHHHHHHhhhccCCCcceeeHHHHHHHHHHHHhhheeeeeccccCCcH
Confidence            34455433333445567877866543 45666667654443211                    1356888888888888


Q ss_pred             HHHHHHHhcCCc---c--------ccc--CCCcccCCChHHHHHHH--hHh--h-------------CCCc--ccCCCCc
Q psy12195        149 SLVTHISQTHTL---M--------FTC--RRCPSTFLNSATLSKHV--KME--H-------------NSKS--YQCNECP  196 (254)
Q Consensus       149 ~l~~h~~~~~~~---~--------~~C--~~C~~~f~~~~~l~~H~--~~h--~-------------~~~~--~~C~~C~  196 (254)
                      .|+.||+..+-+   |        |.=  ..=|++-.   ....+-  .+-  .             +..+  ..|-.|.
T Consensus       210 tLkeHMrkK~HrrinPknreYDkfyiINY~ev~ks~t---~~~~e~dret~~d~~E~D~~wsDw~ed~a~a~~v~CLfC~  286 (423)
T KOG2482|consen  210 TLKEHMRKKRHRRINPKNREYDKFYIINYLEVGKSWT---IVHSEDDRETNEDINETDDTWSDWNEDDAEALSVVCLFCT  286 (423)
T ss_pred             HHHHHHHhccCcccCCCccccceEEEEeHhhcCCccc---hhhhhhhhhhhccccccccchhhhhcCCCCccceEEEeec
Confidence            888887633211   1        000  00011110   111111  110  0             0112  5888898


Q ss_pred             ccCCCHHHHHHHHHHhhcCC-------------------------CCCccCcchhhccCCchHHHHHH
Q psy12195        197 ESFERLNKLKRHKFQAHNDS-------------------------VHQIQCPYCITDFSEDKNLIQHI  239 (254)
Q Consensus       197 ~~f~~~~~l~~H~~~~h~~~-------------------------~~~~~C~~C~~~f~~~~~l~~H~  239 (254)
                      ...-+...|..|++.+|.-.                         .+.-.|-.|..+|.....|..||
T Consensus       287 ~~~en~~~l~eHmk~vHe~Dl~Ki~sd~~Ln~YqrvrviNyiRkq~~~~~c~~cd~~F~~e~~l~~hm  354 (423)
T KOG2482|consen  287 NFYENPVFLFEHMKIVHEFDLLKIQSDYSLNFYQRVRVINYIRKQKKKSRCAECDLSFWKEPGLLIHM  354 (423)
T ss_pred             cchhhHHHHHHHHHHHHHhhHHhhccccccchhhhhhHHHHHHHHhhccccccccccccCcchhhhhc
Confidence            88888888999988777421                         12235888999999999999998


No 49 
>PRK04860 hypothetical protein; Provisional
Probab=95.66  E-value=0.0049  Score=43.53  Aligned_cols=40  Identities=20%  Similarity=0.416  Sum_probs=32.0

Q ss_pred             CcccCCCCcccCCCHHHHHHHHHHhhcCCCCCccCcchhhccCCch
Q psy12195        188 KSYQCNECPESFERLNKLKRHKFQAHNDSVHQIQCPYCITDFSEDK  233 (254)
Q Consensus       188 ~~~~C~~C~~~f~~~~~l~~H~~~~h~~~~~~~~C~~C~~~f~~~~  233 (254)
                      -+|.|. |+.   ...++.+|.+ .+.+ .++|.|..|+..|....
T Consensus       118 ~~Y~C~-C~~---~~~~~rrH~r-i~~g-~~~YrC~~C~~~l~~~~  157 (160)
T PRK04860        118 FPYRCK-CQE---HQLTVRRHNR-VVRG-EAVYRCRRCGETLVFKG  157 (160)
T ss_pred             EEEEcC-CCC---eeCHHHHHHH-HhcC-CccEECCCCCceeEEec
Confidence            479998 987   6778889988 5666 67899999998876543


No 50 
>KOG1146|consensus
Probab=95.65  E-value=0.0029  Score=57.66  Aligned_cols=61  Identities=21%  Similarity=0.347  Sum_probs=43.9

Q ss_pred             CcccCCCCcccCCCHHHHHHHHHHh-hc----------------------------------------CCCCCccCcchh
Q psy12195        188 KSYQCNECPESFERLNKLKRHKFQA-HN----------------------------------------DSVHQIQCPYCI  226 (254)
Q Consensus       188 ~~~~C~~C~~~f~~~~~l~~H~~~~-h~----------------------------------------~~~~~~~C~~C~  226 (254)
                      ++|.|..|..++..+.+|..|+... |.                                        .....|.|.+|+
T Consensus       517 ~p~~C~~C~~stttng~LsihlqS~~h~~~lee~~~~~g~~v~~~~~~v~s~~P~~ag~~~~ags~~pktkP~~~C~vc~  596 (1406)
T KOG1146|consen  517 KPYPCRACNYSTTTNGNLSIHLQSDLHRNELEEAEENAGEQVRLLPASVTSAVPEEAGLGPSAGSSGPKTKPSWRCEVCS  596 (1406)
T ss_pred             CcccceeeeeeeecchHHHHHHHHHhhHHHHHHHHhccccchhhhhhhhcccCcccccCCCCCCCCCCCCCCCcchhhhc
Confidence            5788888888888888888886421 10                                        001248899999


Q ss_pred             hccCCchHHHHHHHHhcCCCCC
Q psy12195        227 TDFSEDKNLIQHIVSVHLGKEG  248 (254)
Q Consensus       227 ~~f~~~~~l~~H~~~~h~~~~~  248 (254)
                      ...+-..+|..||...+....|
T Consensus       597 yetniarnlrihmtss~~s~~p  618 (1406)
T KOG1146|consen  597 YETNIARNLRIHMTASPSSSPP  618 (1406)
T ss_pred             chhhhhhccccccccCCCCCCh
Confidence            9999999999999776655443


No 51 
>KOG2231|consensus
Probab=95.47  E-value=0.057  Score=46.66  Aligned_cols=69  Identities=25%  Similarity=0.576  Sum_probs=39.7

Q ss_pred             cccCCCcccCCChHHHHHHHhHhhCCCcccCCCC------cccCCCHHHHHHHHHHhhcCCCCCccCc--chh-hccCCc
Q psy12195        162 FTCRRCPSTFLNSATLSKHVKMEHNSKSYQCNEC------PESFERLNKLKRHKFQAHNDSVHQIQCP--YCI-TDFSED  232 (254)
Q Consensus       162 ~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C------~~~f~~~~~l~~H~~~~h~~~~~~~~C~--~C~-~~f~~~  232 (254)
                      -.|..|...|.....|..|++.+.    |.|-.|      +.-|.....|..|.+..|      |.|.  .|. +.|...
T Consensus       183 p~C~~C~~~fld~~el~rH~~~~h----~~chfC~~~~~~neyy~~~~dLe~HfR~~H------flCE~~~C~~~~f~~~  252 (669)
T KOG2231|consen  183 PLCKFCHERFLDDDELYRHLRFDH----EFCHFCDYKTGQNEYYNDYDDLEEHFRKGH------FLCEEEFCRTKKFYVA  252 (669)
T ss_pred             ccchhhhhhhccHHHHHHhhccce----eheeecCcccccchhcccchHHHHHhhhcC------ccccccccccceeeeh
Confidence            356777777777777777776533    233333      455666677777777444      4455  453 344444


Q ss_pred             hHHHHHHH
Q psy12195        233 KNLIQHIV  240 (254)
Q Consensus       233 ~~l~~H~~  240 (254)
                      -.+.++++
T Consensus       253 ~~~ei~lk  260 (669)
T KOG2231|consen  253 FELEIELK  260 (669)
T ss_pred             hHHHHHHH
Confidence            44555553


No 52 
>PF13913 zf-C2HC_2:  zinc-finger of a C2HC-type
Probab=95.40  E-value=0.013  Score=27.22  Aligned_cols=18  Identities=33%  Similarity=0.733  Sum_probs=9.3

Q ss_pred             cCcchhhccCCchHHHHHH
Q psy12195        221 QCPYCITDFSEDKNLIQHI  239 (254)
Q Consensus       221 ~C~~C~~~f~~~~~l~~H~  239 (254)
                      .|+.|++.| ..+.|..|+
T Consensus         4 ~C~~CgR~F-~~~~l~~H~   21 (25)
T PF13913_consen    4 PCPICGRKF-NPDRLEKHE   21 (25)
T ss_pred             cCCCCCCEE-CHHHHHHHH
Confidence            455555555 444455554


No 53 
>KOG2231|consensus
Probab=95.06  E-value=0.14  Score=44.40  Aligned_cols=19  Identities=21%  Similarity=0.590  Sum_probs=9.2

Q ss_pred             ccccccccCCHHHHHHHHH
Q psy12195        137 CNMCSLVLDSKESLVTHIS  155 (254)
Q Consensus       137 C~~C~~~f~~~~~l~~h~~  155 (254)
                      |..|...|.....|..|++
T Consensus       185 C~~C~~~fld~~el~rH~~  203 (669)
T KOG2231|consen  185 CKFCHERFLDDDELYRHLR  203 (669)
T ss_pred             chhhhhhhccHHHHHHhhc
Confidence            4444444444444444444


No 54 
>KOG2482|consensus
Probab=94.48  E-value=0.13  Score=40.41  Aligned_cols=22  Identities=32%  Similarity=0.448  Sum_probs=18.5

Q ss_pred             cccCCCCcccCCCHHHHHHHHH
Q psy12195        189 SYQCNECPESFERLNKLKRHKF  210 (254)
Q Consensus       189 ~~~C~~C~~~f~~~~~l~~H~~  210 (254)
                      .-.|-.|.-.|.....|..|+.
T Consensus       334 ~~~c~~cd~~F~~e~~l~~hm~  355 (423)
T KOG2482|consen  334 KSRCAECDLSFWKEPGLLIHMV  355 (423)
T ss_pred             ccccccccccccCcchhhhhcc
Confidence            4577888899999999999986


No 55 
>KOG1146|consensus
Probab=94.34  E-value=0.018  Score=52.87  Aligned_cols=76  Identities=17%  Similarity=0.288  Sum_probs=55.5

Q ss_pred             CCcccCCChHHHHHHHhH-hhCCCcccCCCCcccCCCHHHHHHHHHHhhcC-----------------------CCCCcc
Q psy12195        166 RCPSTFLNSATLSKHVKM-EHNSKSYQCNECPESFERLNKLKRHKFQAHND-----------------------SVHQIQ  221 (254)
Q Consensus       166 ~C~~~f~~~~~l~~H~~~-h~~~~~~~C~~C~~~f~~~~~l~~H~~~~h~~-----------------------~~~~~~  221 (254)
                      .++..+.....+..|+.. +.-.+-|.|+.|+-.|.....|..|++..|..                       ..++|.
T Consensus       441 ~~e~~~~s~r~~~~~t~~L~S~~kt~~cpkc~~~yk~a~~L~vhmRskhp~~~~~~c~~gq~~~~~arg~~~~~~~~p~~  520 (1406)
T KOG1146|consen  441 KAEPLLESKRSLEGQTVVLHSFFKTLKCPKCNWHYKLAQTLGVHMRSKHPESQSAYCKAGQNHPRLARGEVYRCPGKPYP  520 (1406)
T ss_pred             chhhhhhhhcccccceeeeecccccccCCccchhhhhHHHhhhcccccccccchhHhHhccccccccccccccCCCCccc
Confidence            344444444444444433 45567899999999999999999999875532                       136799


Q ss_pred             CcchhhccCCchHHHHHHHH
Q psy12195        222 CPYCITDFSEDKNLIQHIVS  241 (254)
Q Consensus       222 C~~C~~~f~~~~~l~~H~~~  241 (254)
                      |..|..+++++-+|-+||..
T Consensus       521 C~~C~~stttng~LsihlqS  540 (1406)
T KOG1146|consen  521 CRACNYSTTTNGNLSIHLQS  540 (1406)
T ss_pred             ceeeeeeeecchHHHHHHHH
Confidence            99999999999999999854


No 56 
>COG4049 Uncharacterized protein containing archaeal-type C2H2 Zn-finger [General function prediction only]
Probab=94.14  E-value=0.027  Score=31.24  Aligned_cols=30  Identities=27%  Similarity=0.491  Sum_probs=24.0

Q ss_pred             hCCCcccCCCCcccCCCHHHHHHHHHHhhc
Q psy12195        185 HNSKSYQCNECPESFERLNKLKRHKFQAHN  214 (254)
Q Consensus       185 ~~~~~~~C~~C~~~f~~~~~l~~H~~~~h~  214 (254)
                      .||..+.||-||..|+......+|+...|.
T Consensus        13 DGE~~lrCPRC~~~FR~~K~Y~RHVNKaH~   42 (65)
T COG4049          13 DGEEFLRCPRCGMVFRRRKDYIRHVNKAHG   42 (65)
T ss_pred             CCceeeeCCchhHHHHHhHHHHHHhhHHhh
Confidence            467778888888888888888888876664


No 57 
>smart00451 ZnF_U1 U1-like zinc finger. Family of C2H2-type zinc fingers, present in matrin, U1 small nuclear ribonucleoprotein C and other RNA-binding proteins.
Probab=94.13  E-value=0.032  Score=28.22  Aligned_cols=23  Identities=17%  Similarity=0.537  Sum_probs=18.5

Q ss_pred             CccCcchhhccCCchHHHHHHHH
Q psy12195        219 QIQCPYCITDFSEDKNLIQHIVS  241 (254)
Q Consensus       219 ~~~C~~C~~~f~~~~~l~~H~~~  241 (254)
                      +|.|.+|++.|.+...+..|+..
T Consensus         3 ~~~C~~C~~~~~~~~~~~~H~~g   25 (35)
T smart00451        3 GFYCKLCNVTFTDEISVEAHLKG   25 (35)
T ss_pred             CeEccccCCccCCHHHHHHHHCh
Confidence            47788999888888888888743


No 58 
>KOG4173|consensus
Probab=94.09  E-value=0.013  Score=42.16  Aligned_cols=87  Identities=23%  Similarity=0.490  Sum_probs=59.9

Q ss_pred             eeeeeccc--ccccCCCHHHHHhhhcccccCcceeecCcCCcccCCCCccc-hhhhhccC------CCCCCcccc--ccc
Q psy12195         13 VVIIRCET--CTRNYESLESLTTHLSFKHSNQFLMKCTNCNVLVPRDEILP-HLSIQHCQ------GTTPSIYEC--NQC   81 (254)
Q Consensus        13 ~~~~~C~~--C~~~f~~~~~l~~H~~~~h~~~~~~~C~~C~~~~~~~~~l~-~~~~~h~~------~~~~~~~~C--~~C   81 (254)
                      ...|.|++  |-..|...++...|+.+.|.+    .|..|.+.|+....|. |+...|-.      .-+...|.|  ..|
T Consensus        77 ~~~~~cqvagc~~~~d~lD~~E~hY~~~h~~----sCs~C~r~~Pt~hLLd~HI~E~HDs~Fqa~veRG~dMy~ClvEgC  152 (253)
T KOG4173|consen   77 VPAFACQVAGCCQVFDALDDYEHHYHTLHGN----SCSFCKRAFPTGHLLDAHILEWHDSLFQALVERGQDMYQCLVEGC  152 (253)
T ss_pred             cccccccccchHHHHhhhhhHHHhhhhcccc----hhHHHHHhCCchhhhhHHHHHHHHHHHHHHHHcCccHHHHHHHhh
Confidence            34566866  778899999999998875654    4999999999999999 77776610      012344556  456


Q ss_pred             ccccccHHHHHhHHhhhccCCC
Q psy12195         82 KEKTNDMTTMLNHYSVKHYMDI  103 (254)
Q Consensus        82 ~~~~~~~~~l~~h~~~~h~~~~  103 (254)
                      +..|.+...-.+|++..|.-..
T Consensus       153 t~KFkT~r~RkdH~I~~Hk~Pa  174 (253)
T KOG4173|consen  153 TEKFKTSRDRKDHMIRMHKYPA  174 (253)
T ss_pred             hhhhhhhhhhhhHHHHhccCCc
Confidence            6666666666666655554433


No 59 
>smart00451 ZnF_U1 U1-like zinc finger. Family of C2H2-type zinc fingers, present in matrin, U1 small nuclear ribonucleoprotein C and other RNA-binding proteins.
Probab=94.02  E-value=0.049  Score=27.51  Aligned_cols=22  Identities=18%  Similarity=0.419  Sum_probs=17.6

Q ss_pred             cccCCCCcccCCCHHHHHHHHH
Q psy12195        189 SYQCNECPESFERLNKLKRHKF  210 (254)
Q Consensus       189 ~~~C~~C~~~f~~~~~l~~H~~  210 (254)
                      +|.|.+|++.|.+...+..|+.
T Consensus         3 ~~~C~~C~~~~~~~~~~~~H~~   24 (35)
T smart00451        3 GFYCKLCNVTFTDEISVEAHLK   24 (35)
T ss_pred             CeEccccCCccCCHHHHHHHHC
Confidence            5778888888888888888874


No 60 
>KOG4173|consensus
Probab=93.66  E-value=0.046  Score=39.49  Aligned_cols=79  Identities=25%  Similarity=0.512  Sum_probs=45.7

Q ss_pred             ccccc--cccccCCHHHHHHHHHhcCCcccccCCCcccCCChHHHHHHHhHh----------hCCCcccCC--CCcccCC
Q psy12195        135 IQCNM--CSLVLDSKESLVTHISQTHTLMFTCRRCPSTFLNSATLSKHVKME----------HNSKSYQCN--ECPESFE  200 (254)
Q Consensus       135 ~~C~~--C~~~f~~~~~l~~h~~~~~~~~~~C~~C~~~f~~~~~l~~H~~~h----------~~~~~~~C~--~C~~~f~  200 (254)
                      |.|+.  |-..|.+..+...|-...|+.  .|+.|.+.|.....|..|+...          .|...|+|-  .|+..|.
T Consensus        80 ~~cqvagc~~~~d~lD~~E~hY~~~h~~--sCs~C~r~~Pt~hLLd~HI~E~HDs~Fqa~veRG~dMy~ClvEgCt~KFk  157 (253)
T KOG4173|consen   80 FACQVAGCCQVFDALDDYEHHYHTLHGN--SCSFCKRAFPTGHLLDAHILEWHDSLFQALVERGQDMYQCLVEGCTEKFK  157 (253)
T ss_pred             ccccccchHHHHhhhhhHHHhhhhcccc--hhHHHHHhCCchhhhhHHHHHHHHHHHHHHHHcCccHHHHHHHhhhhhhh
Confidence            44544  444555444444443323332  5666666666666666665542          245567774  4888888


Q ss_pred             CHHHHHHHHHHhhcC
Q psy12195        201 RLNKLKRHKFQAHND  215 (254)
Q Consensus       201 ~~~~l~~H~~~~h~~  215 (254)
                      +...-.+|+-..|.-
T Consensus       158 T~r~RkdH~I~~Hk~  172 (253)
T KOG4173|consen  158 TSRDRKDHMIRMHKY  172 (253)
T ss_pred             hhhhhhhHHHHhccC
Confidence            777777777666644


No 61 
>cd00350 rubredoxin_like Rubredoxin_like; nonheme iron binding domain containing a [Fe(SCys)4] center. The family includes rubredoxins, a small electron transfer protein, and a slightly smaller modular rubredoxin domain present in rubrerythrin and nigerythrin and detected either N- or C-terminal to such proteins as flavin reductase, NAD(P)H-nitrite reductase, and ferredoxin-thioredoxin reductase. In rubredoxin, the iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), but iron can also be replaced by cobalt, nickel or zinc and believed to be involved in electron transfer.  Rubrerythrins and nigerythrins are small homodimeric proteins, generally consisting of 2 domains: a rubredoxin domain C-terminal to a non-sulfur, oxo-bridged diiron site in the N-terminal rubrerythrin domain.  Rubrerythrins and nigerythrins have putative peroxide activity.
Probab=93.54  E-value=0.04  Score=27.54  Aligned_cols=9  Identities=22%  Similarity=0.781  Sum_probs=4.0

Q ss_pred             ccCCCcccC
Q psy12195        163 TCRRCPSTF  171 (254)
Q Consensus       163 ~C~~C~~~f  171 (254)
                      .|..||..+
T Consensus         3 ~C~~CGy~y   11 (33)
T cd00350           3 VCPVCGYIY   11 (33)
T ss_pred             ECCCCCCEE
Confidence            444444443


No 62 
>PF12907 zf-met2:  Zinc-binding
Probab=93.30  E-value=0.053  Score=28.31  Aligned_cols=32  Identities=22%  Similarity=0.362  Sum_probs=24.1

Q ss_pred             ccCcchhhcc---CCchHHHHHHHHhcCCCCCCCC
Q psy12195        220 IQCPYCITDF---SEDKNLIQHIVSVHLGKEGTAP  251 (254)
Q Consensus       220 ~~C~~C~~~f---~~~~~l~~H~~~~h~~~~~~~c  251 (254)
                      ++|.+|...|   +....|..|....|++..+-.|
T Consensus         2 i~C~iC~qtF~~t~~~~~L~eH~enKHpK~~~~~C   36 (40)
T PF12907_consen    2 IICKICRQTFMQTTNEPQLKEHAENKHPKNTFEEC   36 (40)
T ss_pred             cCcHHhhHHHHhcCCHHHHHHHHHccCCCCCHHHc
Confidence            6799998544   4556799999889988766555


No 63 
>KOG2785|consensus
Probab=93.14  E-value=0.52  Score=37.75  Aligned_cols=55  Identities=20%  Similarity=0.326  Sum_probs=44.5

Q ss_pred             CcccCCCCcccCCCHHHHHHHHHHhhcCC---------------------CCCccCcchh---hccCCchHHHHHHHHh
Q psy12195        188 KSYQCNECPESFERLNKLKRHKFQAHNDS---------------------VHQIQCPYCI---TDFSEDKNLIQHIVSV  242 (254)
Q Consensus       188 ~~~~C~~C~~~f~~~~~l~~H~~~~h~~~---------------------~~~~~C~~C~---~~f~~~~~l~~H~~~~  242 (254)
                      .|-.|-.|++.+.+.-.-..||...|+-=                     ...|.|-.|.   +.|.+......||...
T Consensus       165 ~Pt~CLfC~~~~k~~e~~~~HM~~~HgffIPdreYL~D~~GLl~YLgeKV~~~~~CL~CN~~~~~f~sleavr~HM~~K  243 (390)
T KOG2785|consen  165 IPTDCLFCDKKSKSLEENLKHMFKEHGFFIPDREYLTDEKGLLKYLGEKVGIGFICLFCNELGRPFSSLEAVRAHMRDK  243 (390)
T ss_pred             CCcceeecCCCcccHHHHHHHHhhccCCcCCchHhhhchhHHHHHHHHHhccCceEEEeccccCcccccHHHHHHHhhc
Confidence            35789999999999999999998777530                     2347788888   8999999999998543


No 64 
>KOG2893|consensus
Probab=92.15  E-value=0.028  Score=41.55  Aligned_cols=48  Identities=25%  Similarity=0.394  Sum_probs=26.4

Q ss_pred             eecCcCCcccCCCCccchhhhhccCCCCCCcccccccccccccHHHHHhHHhhhc
Q psy12195         45 MKCTNCNVLVPRDEILPHLSIQHCQGTTPSIYECNQCKEKTNDMTTMLNHYSVKH   99 (254)
Q Consensus        45 ~~C~~C~~~~~~~~~l~~~~~~h~~~~~~~~~~C~~C~~~~~~~~~l~~h~~~~h   99 (254)
                      -+|.+|++.|..+..|.    +|   ...+.|+|.+|.+.+.+--.|..|-+.+|
T Consensus        11 pwcwycnrefddekili----qh---qkakhfkchichkkl~sgpglsihcmqvh   58 (341)
T KOG2893|consen   11 PWCWYCNREFDDEKILI----QH---QKAKHFKCHICHKKLFSGPGLSIHCMQVH   58 (341)
T ss_pred             ceeeecccccchhhhhh----hh---hhhccceeeeehhhhccCCCceeehhhhh
Confidence            36777777776665433    23   33456677777665554444555543334


No 65 
>COG4049 Uncharacterized protein containing archaeal-type C2H2 Zn-finger [General function prediction only]
Probab=92.12  E-value=0.064  Score=29.78  Aligned_cols=30  Identities=17%  Similarity=0.409  Sum_probs=25.5

Q ss_pred             hcceeeeecccccccCCCHHHHHhhhcccc
Q psy12195         10 EHKVVIIRCETCTRNYESLESLTTHLSFKH   39 (254)
Q Consensus        10 ~~~~~~~~C~~C~~~f~~~~~l~~H~~~~h   39 (254)
                      ..|+.-++||-|+..|+..-+..+|....|
T Consensus        12 RDGE~~lrCPRC~~~FR~~K~Y~RHVNKaH   41 (65)
T COG4049          12 RDGEEFLRCPRCGMVFRRRKDYIRHVNKAH   41 (65)
T ss_pred             cCCceeeeCCchhHHHHHhHHHHHHhhHHh
Confidence            457888999999999999999989987644


No 66 
>PF12013 DUF3505:  Protein of unknown function (DUF3505);  InterPro: IPR022698  This family of proteins is functionally uncharacterised. This protein is found in eukaryotes. Proteins in this family are typically between 247 to 1018 amino acids in length. This region contains two segments that are likely to be C2H2 zinc binding domains. 
Probab=91.27  E-value=0.46  Score=31.35  Aligned_cols=25  Identities=24%  Similarity=0.379  Sum_probs=22.1

Q ss_pred             CccC----cchhhccCCchHHHHHHHHhc
Q psy12195        219 QIQC----PYCITDFSEDKNLIQHIVSVH  243 (254)
Q Consensus       219 ~~~C----~~C~~~f~~~~~l~~H~~~~h  243 (254)
                      .|.|    +.|+..+.+...|..|++..|
T Consensus        80 G~~C~~~~~~C~y~~~~~~~m~~H~~~~H  108 (109)
T PF12013_consen   80 GYRCQCDPPHCGYITRSKKTMRKHWRKEH  108 (109)
T ss_pred             CeeeecCCCCCCcEeccHHHHHHHHHHhc
Confidence            3889    999999999999999997766


No 67 
>KOG2785|consensus
Probab=91.19  E-value=0.47  Score=37.98  Aligned_cols=24  Identities=17%  Similarity=0.483  Sum_probs=18.9

Q ss_pred             eeecccccccCCCHHHHHhhhccc
Q psy12195         15 IIRCETCTRNYESLESLTTHLSFK   38 (254)
Q Consensus        15 ~~~C~~C~~~f~~~~~l~~H~~~~   38 (254)
                      .|.|..|...|.+...-+.|+.+.
T Consensus         3 ~ftC~tC~v~F~~ad~Qr~HyKSd   26 (390)
T KOG2785|consen    3 GFTCNTCNVEFDDADEQRAHYKSD   26 (390)
T ss_pred             cceeeceeeeeccHHHHHHHhhhh
Confidence            478888888888887777787764


No 68 
>KOG2893|consensus
Probab=91.12  E-value=0.07  Score=39.51  Aligned_cols=41  Identities=22%  Similarity=0.480  Sum_probs=20.1

Q ss_pred             CCCCcccCCCHHHHHHHHHHhhcCCCCCccCcchhhccCCchHHHHH
Q psy12195        192 CNECPESFERLNKLKRHKFQAHNDSVHQIQCPYCITDFSEDKNLIQH  238 (254)
Q Consensus       192 C~~C~~~f~~~~~l~~H~~~~h~~~~~~~~C~~C~~~f~~~~~l~~H  238 (254)
                      |=+|++.|.+...|..|++      .+-|+|-.|-|..-+...|.+|
T Consensus        13 cwycnrefddekiliqhqk------akhfkchichkkl~sgpglsih   53 (341)
T KOG2893|consen   13 CWYCNREFDDEKILIQHQK------AKHFKCHICHKKLFSGPGLSIH   53 (341)
T ss_pred             eeecccccchhhhhhhhhh------hccceeeeehhhhccCCCceee
Confidence            4445555555555555544      3345555555444444444444


No 69 
>PF06524 NOA36:  NOA36 protein;  InterPro: IPR010531 This family consists of several NOA36 proteins which contain 29 highly conserved cysteine residues. The function of this protein is unknown.; GO: 0008270 zinc ion binding, 0005634 nucleus
Probab=90.94  E-value=0.19  Score=37.87  Aligned_cols=81  Identities=17%  Similarity=0.326  Sum_probs=45.7

Q ss_pred             hcceeeeecccccccCCCHHHHHhhhccccc-CcceeecCcCCcccCCCCc-----c-c-hhhhhccCCCCCCccccccc
Q psy12195         10 EHKVVIIRCETCTRNYESLESLTTHLSFKHS-NQFLMKCTNCNVLVPRDEI-----L-P-HLSIQHCQGTTPSIYECNQC   81 (254)
Q Consensus        10 ~~~~~~~~C~~C~~~f~~~~~l~~H~~~~h~-~~~~~~C~~C~~~~~~~~~-----l-~-~~~~~h~~~~~~~~~~C~~C   81 (254)
                      .||-++|+|..|+...-....| .|+.+... ....|+|..|++.....-.     + . |.++.-......++++|+.|
T Consensus       137 ~hGGrif~CsfC~~flCEDDQF-EHQAsCQvLe~E~~KC~SCNrlGq~sCLRCK~cfCddHvrrKg~ky~k~k~~PCPKC  215 (314)
T PF06524_consen  137 DHGGRIFKCSFCDNFLCEDDQF-EHQASCQVLESETFKCQSCNRLGQYSCLRCKICFCDDHVRRKGFKYEKGKPIPCPKC  215 (314)
T ss_pred             cCCCeEEEeecCCCeeeccchh-hhhhhhhhhhcccccccccccccchhhhheeeeehhhhhhhcccccccCCCCCCCCC
Confidence            4678899999998777666666 55554222 2346888888765443311     1 1 22222222234466777777


Q ss_pred             ccccccHHHH
Q psy12195         82 KEKTNDMTTM   91 (254)
Q Consensus        82 ~~~~~~~~~l   91 (254)
                      +........|
T Consensus       216 g~et~eTkdL  225 (314)
T PF06524_consen  216 GYETQETKDL  225 (314)
T ss_pred             CCcccccccc
Confidence            7655544444


No 70 
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only]
Probab=90.53  E-value=0.51  Score=37.22  Aligned_cols=124  Identities=21%  Similarity=0.363  Sum_probs=66.7

Q ss_pred             chhhccChHHHHHHHHhhhccCCCcccccccc---ccc------CCHHHHHHHHHhcCC-----cccccCCCcccCCChH
Q psy12195        110 CDVLFHNKATLYKHLYLEHKATSLSIQCNMCS---LVL------DSKESLVTHISQTHT-----LMFTCRRCPSTFLNSA  175 (254)
Q Consensus       110 C~~~f~~~~~l~~H~~~~~~~~~~~~~C~~C~---~~f------~~~~~l~~h~~~~~~-----~~~~C~~C~~~f~~~~  175 (254)
                      |+........|..|.+..|.    .+.|.+|.   +.|      .+...|..|...-.+     ..-.|..|...|-+..
T Consensus       159 c~~~C~~~k~lk~H~K~~H~----~~~C~~C~~nKk~F~~E~~lF~~~~Lr~H~~~G~~e~GFKGHP~C~FC~~~FYdDD  234 (493)
T COG5236         159 CHRRCGSLKELKKHYKAQHG----FVLCSECIGNKKDFWNEIRLFRSSTLRDHKNGGLEEEGFKGHPLCIFCKIYFYDDD  234 (493)
T ss_pred             hhhhhhhHHHHHHHHHhhcC----cEEhHhhhcCcccCccceeeeecccccccccCCccccCcCCCchhhhccceecChH
Confidence            44444445666677665444    34455553   222      223455555431111     2234777777777777


Q ss_pred             HHHHHHhHhhCCCcccCCC----CcccCCCHHHHHHHHHHhhcCCCCCccCcc--hh----hccCCchHHHHHHHHhcC
Q psy12195        176 TLSKHVKMEHNSKSYQCNE----CPESFERLNKLKRHKFQAHNDSVHQIQCPY--CI----TDFSEDKNLIQHIVSVHL  244 (254)
Q Consensus       176 ~l~~H~~~h~~~~~~~C~~----C~~~f~~~~~l~~H~~~~h~~~~~~~~C~~--C~----~~f~~~~~l~~H~~~~h~  244 (254)
                      .|..|++..+ ++-|.|..    =..-|.+...|-+|.+..      -|.|.+  |.    ..|...-.|+.|+-+.|.
T Consensus       235 EL~~HcR~~H-E~ChICD~v~p~~~QYFK~Y~~Le~HF~~~------hy~ct~qtc~~~k~~vf~~~~el~~h~~~~h~  306 (493)
T COG5236         235 ELRRHCRLRH-EACHICDMVGPIRYQYFKSYEDLEAHFRNA------HYCCTFQTCRVGKCYVFPYHTELLEHLTRFHK  306 (493)
T ss_pred             HHHHHHHhhh-hhhhhhhccCccchhhhhCHHHHHHHhhcC------ceEEEEEEEecCcEEEeccHHHHHHHHHHHhh
Confidence            7777777533 22233321    123466667777776522      354533  32    357777778888766664


No 71 
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only]
Probab=90.30  E-value=0.32  Score=38.30  Aligned_cols=103  Identities=26%  Similarity=0.431  Sum_probs=69.6

Q ss_pred             cccccc--cccccCCHHHHHHHHHhcCCcccccCCC---cccCC------ChHHHHHHHhHhhCC----CcccCCCCccc
Q psy12195        134 SIQCNM--CSLVLDSKESLVTHISQTHTLMFTCRRC---PSTFL------NSATLSKHVKMEHNS----KSYQCNECPES  198 (254)
Q Consensus       134 ~~~C~~--C~~~f~~~~~l~~h~~~~~~~~~~C~~C---~~~f~------~~~~l~~H~~~h~~~----~~~~C~~C~~~  198 (254)
                      .|.|+.  |..+......|..|....|.+ +.|.+|   .+.|.      +...|..|...-..+    .--.|..|...
T Consensus       151 ~F~CP~skc~~~C~~~k~lk~H~K~~H~~-~~C~~C~~nKk~F~~E~~lF~~~~Lr~H~~~G~~e~GFKGHP~C~FC~~~  229 (493)
T COG5236         151 SFKCPKSKCHRRCGSLKELKKHYKAQHGF-VLCSECIGNKKDFWNEIRLFRSSTLRDHKNGGLEEEGFKGHPLCIFCKIY  229 (493)
T ss_pred             HhcCCchhhhhhhhhHHHHHHHHHhhcCc-EEhHhhhcCcccCccceeeeecccccccccCCccccCcCCCchhhhccce
Confidence            577875  666666677888898755553 445554   34444      345566665543222    12478999999


Q ss_pred             CCCHHHHHHHHHHhhcCCCCCccCcchhhc-------cCCchHHHHHHHHhc
Q psy12195        199 FERLNKLKRHKFQAHNDSVHQIQCPYCITD-------FSEDKNLIQHIVSVH  243 (254)
Q Consensus       199 f~~~~~l~~H~~~~h~~~~~~~~C~~C~~~-------f~~~~~l~~H~~~~h  243 (254)
                      |-+...|.+|.+..|..      |-.|++.       |.+-..|..|.+..|
T Consensus       230 FYdDDEL~~HcR~~HE~------ChICD~v~p~~~QYFK~Y~~Le~HF~~~h  275 (493)
T COG5236         230 FYDDDELRRHCRLRHEA------CHICDMVGPIRYQYFKSYEDLEAHFRNAH  275 (493)
T ss_pred             ecChHHHHHHHHhhhhh------hhhhhccCccchhhhhCHHHHHHHhhcCc
Confidence            99999999999977754      6666654       777888888875554


No 72 
>TIGR00373 conserved hypothetical protein TIGR00373. This family of proteins is, so far, restricted to archaeal genomes. The family appears to be distantly related to the N-terminal region of the eukaryotic transcription initiation factor IIE alpha chain.
Probab=89.80  E-value=0.36  Score=34.24  Aligned_cols=33  Identities=18%  Similarity=0.362  Sum_probs=23.0

Q ss_pred             hCCCcccCCCCcccCCCHHHHHHHHHHhhcCCCCCccCcchhhc
Q psy12195        185 HNSKSYQCNECPESFERLNKLKRHKFQAHNDSVHQIQCPYCITD  228 (254)
Q Consensus       185 ~~~~~~~C~~C~~~f~~~~~l~~H~~~~h~~~~~~~~C~~C~~~  228 (254)
                      .+...|.||.|+..|+..-.+.           ..|.||.||..
T Consensus       105 ~~~~~Y~Cp~c~~r~tf~eA~~-----------~~F~Cp~Cg~~  137 (158)
T TIGR00373       105 TNNMFFICPNMCVRFTFNEAME-----------LNFTCPRCGAM  137 (158)
T ss_pred             cCCCeEECCCCCcEeeHHHHHH-----------cCCcCCCCCCE
Confidence            4556788888888877666653           25888888754


No 73 
>cd00729 rubredoxin_SM Rubredoxin, Small Modular nonheme iron binding domain containing a [Fe(SCys)4] center, present in rubrerythrin and nigerythrin and detected either N- or C-terminal to such proteins as flavin reductase, NAD(P)H-nitrite reductase, and ferredoxin-thioredoxin reductase. In rubredoxin, the iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), and  believed to be involved in electron transfer. Rubrerythrins and nigerythrins are small homodimeric proteins, generally consisting of 2 domains: a rubredoxin domain C-terminal to a non-sulfur, oxo-bridged diiron site in the N-terminal rubrerythrin domain. Rubrerythrins and nigerythrins have putative peroxide activity.
Probab=89.77  E-value=0.19  Score=25.26  Aligned_cols=25  Identities=24%  Similarity=0.538  Sum_probs=15.9

Q ss_pred             cccCCCCcccCCCHHHHHHHHHHhhcCCCCCccCcchhh
Q psy12195        189 SYQCNECPESFERLNKLKRHKFQAHNDSVHQIQCPYCIT  227 (254)
Q Consensus       189 ~~~C~~C~~~f~~~~~l~~H~~~~h~~~~~~~~C~~C~~  227 (254)
                      .|.|..||..+..              ...+-.||+|+.
T Consensus         2 ~~~C~~CG~i~~g--------------~~~p~~CP~Cg~   26 (34)
T cd00729           2 VWVCPVCGYIHEG--------------EEAPEKCPICGA   26 (34)
T ss_pred             eEECCCCCCEeEC--------------CcCCCcCcCCCC
Confidence            4678888864422              234567888875


No 74 
>PF09538 FYDLN_acid:  Protein of unknown function (FYDLN_acid);  InterPro: IPR012644 Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues. The function of members of this family is unknown.
Probab=89.58  E-value=0.23  Score=32.60  Aligned_cols=14  Identities=43%  Similarity=0.978  Sum_probs=7.0

Q ss_pred             CccCcchhhccCCc
Q psy12195        219 QIQCPYCITDFSED  232 (254)
Q Consensus       219 ~~~C~~C~~~f~~~  232 (254)
                      |..||.||..|.-.
T Consensus        26 PivCP~CG~~~~~~   39 (108)
T PF09538_consen   26 PIVCPKCGTEFPPE   39 (108)
T ss_pred             CccCCCCCCccCcc
Confidence            44455555555443


No 75 
>PF12013 DUF3505:  Protein of unknown function (DUF3505);  InterPro: IPR022698  This family of proteins is functionally uncharacterised. This protein is found in eukaryotes. Proteins in this family are typically between 247 to 1018 amino acids in length. This region contains two segments that are likely to be C2H2 zinc binding domains. 
Probab=89.41  E-value=0.95  Score=29.83  Aligned_cols=25  Identities=20%  Similarity=0.506  Sum_probs=23.1

Q ss_pred             ccC----CCCcccCCCHHHHHHHHHHhhc
Q psy12195        190 YQC----NECPESFERLNKLKRHKFQAHN  214 (254)
Q Consensus       190 ~~C----~~C~~~f~~~~~l~~H~~~~h~  214 (254)
                      |.|    +.|+....+..++.+|++..|+
T Consensus        81 ~~C~~~~~~C~y~~~~~~~m~~H~~~~Hg  109 (109)
T PF12013_consen   81 YRCQCDPPHCGYITRSKKTMRKHWRKEHG  109 (109)
T ss_pred             eeeecCCCCCCcEeccHHHHHHHHHHhcC
Confidence            899    9999999999999999998774


No 76 
>PF13719 zinc_ribbon_5:  zinc-ribbon domain
Probab=89.02  E-value=0.42  Score=24.53  Aligned_cols=34  Identities=15%  Similarity=0.497  Sum_probs=18.1

Q ss_pred             eecccccccCCCHHHHHhhhcccccCcceeecCcCCcccC
Q psy12195         16 IRCETCTRNYESLESLTTHLSFKHSNQFLMKCTNCNVLVP   55 (254)
Q Consensus        16 ~~C~~C~~~f~~~~~l~~H~~~~h~~~~~~~C~~C~~~~~   55 (254)
                      ..||.|+..|.-.++..      ..+...++|..|+..|.
T Consensus         3 i~CP~C~~~f~v~~~~l------~~~~~~vrC~~C~~~f~   36 (37)
T PF13719_consen    3 ITCPNCQTRFRVPDDKL------PAGGRKVRCPKCGHVFR   36 (37)
T ss_pred             EECCCCCceEEcCHHHc------ccCCcEEECCCCCcEee
Confidence            45777777776544321      11122466777765553


No 77 
>TIGR02098 MJ0042_CXXC MJ0042 family finger-like domain. This domain contains a CXXCX(19)CXXC motif suggestive of both zinc fingers and thioredoxin, usually found at the N-terminus of prokaryotic proteins. One partially characterized gene, agmX, is among a large set in Myxococcus whose interruption affects adventurous gliding motility.
Probab=89.00  E-value=0.32  Score=25.04  Aligned_cols=34  Identities=21%  Similarity=0.536  Sum_probs=18.7

Q ss_pred             eecccccccCCCHHHHHhhhcccccCcceeecCcCCcccC
Q psy12195         16 IRCETCTRNYESLESLTTHLSFKHSNQFLMKCTNCNVLVP   55 (254)
Q Consensus        16 ~~C~~C~~~f~~~~~l~~H~~~~h~~~~~~~C~~C~~~~~   55 (254)
                      +.||.|+..|.-..+...      .....+.|+.|+..|.
T Consensus         3 ~~CP~C~~~~~v~~~~~~------~~~~~v~C~~C~~~~~   36 (38)
T TIGR02098         3 IQCPNCKTSFRVVDSQLG------ANGGKVRCGKCGHVWY   36 (38)
T ss_pred             EECCCCCCEEEeCHHHcC------CCCCEEECCCCCCEEE
Confidence            567777777765544311      1112466777766553


No 78 
>COG5048 FOG: Zn-finger [General function prediction only]
Probab=88.82  E-value=0.076  Score=44.26  Aligned_cols=48  Identities=25%  Similarity=0.391  Sum_probs=37.4

Q ss_pred             eeeeecccccccCCCHHHHHhhhcccccCcceeecCcCC--cccCCCCccc
Q psy12195         13 VVIIRCETCTRNYESLESLTTHLSFKHSNQFLMKCTNCN--VLVPRDEILP   61 (254)
Q Consensus        13 ~~~~~C~~C~~~f~~~~~l~~H~~~~h~~~~~~~C~~C~--~~~~~~~~l~   61 (254)
                      ...+.|+.|...|........|.+. +..+++..|...+  ..+.....+.
T Consensus        31 ~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~   80 (467)
T COG5048          31 PRPDSCPNCTDSFSRLEHLTRHIRS-HTGEKPSQCSYSGCDKSFSRPLELS   80 (467)
T ss_pred             Cchhhcccccccccccchhhhhccc-ccccCCccccccccccccCCcchhh
Confidence            5677899999999999999999998 9998888887754  3444444444


No 79 
>PF13717 zinc_ribbon_4:  zinc-ribbon domain
Probab=88.78  E-value=0.44  Score=24.29  Aligned_cols=33  Identities=21%  Similarity=0.583  Sum_probs=16.8

Q ss_pred             eecccccccCCCHHHHHhhhcccccCcceeecCcCCccc
Q psy12195         16 IRCETCTRNYESLESLTTHLSFKHSNQFLMKCTNCNVLV   54 (254)
Q Consensus        16 ~~C~~C~~~f~~~~~l~~H~~~~h~~~~~~~C~~C~~~~   54 (254)
                      ..|+.|+..|.-.++...      ..-..++|..|+..|
T Consensus         3 i~Cp~C~~~y~i~d~~ip------~~g~~v~C~~C~~~f   35 (36)
T PF13717_consen    3 ITCPNCQAKYEIDDEKIP------PKGRKVRCSKCGHVF   35 (36)
T ss_pred             EECCCCCCEEeCCHHHCC------CCCcEEECCCCCCEe
Confidence            456666666665544311      111245666666544


No 80 
>PF02892 zf-BED:  BED zinc finger;  InterPro: IPR003656 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents predicted BED-type zinc finger domains. The BED finger which was named after the Drosophila proteins BEAF and DREF, is found in one or more copies in cellular regulatory factors and transposases from plants, animals and fungi. The BED finger is an about 50 to 60 amino acid residues domain that contains a characteristic motif with two highly conserved aromatic positions, as well as a shared pattern of cysteines and histidines that is predicted to form a zinc finger. As diverse BED fingers are able to bind DNA, it has been suggested that DNA-binding is the general function of this domain []. Some proteins known to contain a BED domain include animal, plant and fungi AC1 and Hobo-like transposases; Caenorhabditis elegans Dpy-20 protein, a predicted cuticular gene transcriptional regulator; Drosophila BEAF (boundary element-associated factor), thought to be involved in chromatin insulation; Drosophila DREF, a transcriptional regulator for S-phase genes; and tobacco 3AF1 and tomato E4/E8-BP1, light- and ethylene-regulated DNA binding proteins that contain two BED fingers. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003677 DNA binding; PDB: 2DJR_A 2CT5_A.
Probab=88.52  E-value=0.27  Score=26.40  Aligned_cols=26  Identities=27%  Similarity=0.551  Sum_probs=13.3

Q ss_pred             CCccCcchhhccCC----chHHHHHHHHhc
Q psy12195        218 HQIQCPYCITDFSE----DKNLIQHIVSVH  243 (254)
Q Consensus       218 ~~~~C~~C~~~f~~----~~~l~~H~~~~h  243 (254)
                      ...+|..|++.+..    .++|..|++..|
T Consensus        15 ~~a~C~~C~~~~~~~~~~ts~l~~HL~~~h   44 (45)
T PF02892_consen   15 KKAKCKYCGKVIKYSSGGTSNLKRHLKKKH   44 (45)
T ss_dssp             S-EEETTTTEE-----SSTHHHHHHHHHTT
T ss_pred             CeEEeCCCCeEEeeCCCcHHHHHHhhhhhC
Confidence            34556666665544    366677765544


No 81 
>smart00614 ZnF_BED BED zinc finger. DNA-binding domain in chromatin-boundary-element-binding proteins and transposases
Probab=88.40  E-value=0.35  Score=26.75  Aligned_cols=25  Identities=32%  Similarity=0.636  Sum_probs=15.5

Q ss_pred             ccCcchhhccCCc-----hHHHHHHHHhcC
Q psy12195        220 IQCPYCITDFSED-----KNLIQHIVSVHL  244 (254)
Q Consensus       220 ~~C~~C~~~f~~~-----~~l~~H~~~~h~  244 (254)
                      -.|..|++.++..     ++|.+|++..|.
T Consensus        19 a~C~~C~~~l~~~~~~gTs~L~rHl~~~h~   48 (50)
T smart00614       19 AKCKYCGKKLSRSSKGGTSNLRRHLRRKHP   48 (50)
T ss_pred             EEecCCCCEeeeCCCCCcHHHHHHHHhHCc
Confidence            3577777665443     577777755554


No 82 
>TIGR00622 ssl1 transcription factor ssl1. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=88.10  E-value=0.77  Score=30.17  Aligned_cols=89  Identities=25%  Similarity=0.398  Sum_probs=44.6

Q ss_pred             CcccccccccccCCHHHHHHHHHhcCC---cccccCCCcccCCChHHHHHHHhHhhCCCcccCCCCcccCCCHHHHHHHH
Q psy12195        133 LSIQCNMCSLVLDSKESLVTHISQTHT---LMFTCRRCPSTFLNSATLSKHVKMEHNSKSYQCNECPESFERLNKLKRHK  209 (254)
Q Consensus       133 ~~~~C~~C~~~f~~~~~l~~h~~~~~~---~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~  209 (254)
                      .|..|+.||.+..++..|.+.-  .|-   .+|.         .- .+      -.......|--|...|........  
T Consensus        14 LP~~CpiCgLtLVss~HLARSy--HHLfPl~~f~---------ev-~~------~~~~~~~~C~~C~~~f~~~~~~~~--   73 (112)
T TIGR00622        14 LPVECPICGLTLILSTHLARSY--HHLFPLKAFQ---------EI-PL------EEYNGSRFCFGCQGPFPKPPVSPF--   73 (112)
T ss_pred             CCCcCCcCCCEEeccchHHHhh--hccCCCcccc---------cc-cc------cccCCCCcccCcCCCCCCcccccc--
Confidence            4678888888887777666442  221   1121         00 00      001112236666666654321110  


Q ss_pred             HHhhcCCCCCccCcchhhccCCchHHHHHHHHhcC
Q psy12195        210 FQAHNDSVHQIQCPYCITDFSEDKNLIQHIVSVHL  244 (254)
Q Consensus       210 ~~~h~~~~~~~~C~~C~~~f~~~~~l~~H~~~~h~  244 (254)
                      . . ......|+|+.|...|-..-++-.|- ..|.
T Consensus        74 ~-~-~~~~~~y~C~~C~~~FC~dCD~fiHe-~Lh~  105 (112)
T TIGR00622        74 D-E-LKDSHRYVCAVCKNVFCVDCDVFVHE-SLHC  105 (112)
T ss_pred             c-c-cccccceeCCCCCCccccccchhhhh-hccC
Confidence            0 0 01123577888887777777777775 4443


No 83 
>PF10571 UPF0547:  Uncharacterised protein family UPF0547;  InterPro: IPR018886  This domain may well be a type of zinc-finger as it carries two pairs of highly conserved cysteine residues though with no accompanying histidines. Several members are annotated as putative helicases. 
Probab=87.83  E-value=0.35  Score=22.64  Aligned_cols=8  Identities=38%  Similarity=1.070  Sum_probs=3.2

Q ss_pred             CCCCcccC
Q psy12195        192 CNECPESF  199 (254)
Q Consensus       192 C~~C~~~f  199 (254)
                      |+.||..|
T Consensus        17 Cp~CG~~F   24 (26)
T PF10571_consen   17 CPHCGYDF   24 (26)
T ss_pred             CCCCCCCC
Confidence            44444333


No 84 
>PRK06266 transcription initiation factor E subunit alpha; Validated
Probab=87.72  E-value=0.48  Score=34.32  Aligned_cols=32  Identities=22%  Similarity=0.456  Sum_probs=20.1

Q ss_pred             CCCcccCCCCcccCCCHHHHHHHHHHhhcCCCCCccCcchhhc
Q psy12195        186 NSKSYQCNECPESFERLNKLKRHKFQAHNDSVHQIQCPYCITD  228 (254)
Q Consensus       186 ~~~~~~C~~C~~~f~~~~~l~~H~~~~h~~~~~~~~C~~C~~~  228 (254)
                      ....|.||.|+..|+..-.+           ...|.||.||..
T Consensus       114 ~~~~Y~Cp~C~~rytf~eA~-----------~~~F~Cp~Cg~~  145 (178)
T PRK06266        114 NNMFFFCPNCHIRFTFDEAM-----------EYGFRCPQCGEM  145 (178)
T ss_pred             CCCEEECCCCCcEEeHHHHh-----------hcCCcCCCCCCC
Confidence            34567777777777655443           125778887754


No 85 
>COG2888 Predicted Zn-ribbon RNA-binding protein with a function in translation [Translation, ribosomal structure and biogenesis]
Probab=87.18  E-value=0.92  Score=25.81  Aligned_cols=10  Identities=30%  Similarity=0.836  Sum_probs=5.6

Q ss_pred             Cccccccccc
Q psy12195         74 SIYECNQCKE   83 (254)
Q Consensus        74 ~~~~C~~C~~   83 (254)
                      .+|.|+.||.
T Consensus        49 ~~Y~Cp~CGF   58 (61)
T COG2888          49 NPYRCPKCGF   58 (61)
T ss_pred             CceECCCcCc
Confidence            4556666654


No 86 
>PF09538 FYDLN_acid:  Protein of unknown function (FYDLN_acid);  InterPro: IPR012644 Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues. The function of members of this family is unknown.
Probab=86.52  E-value=0.48  Score=31.08  Aligned_cols=15  Identities=20%  Similarity=0.519  Sum_probs=7.7

Q ss_pred             CcccCCCCcccCCCH
Q psy12195        188 KSYQCNECPESFERL  202 (254)
Q Consensus       188 ~~~~C~~C~~~f~~~  202 (254)
                      .|..||.||..|.-.
T Consensus        25 ~PivCP~CG~~~~~~   39 (108)
T PF09538_consen   25 DPIVCPKCGTEFPPE   39 (108)
T ss_pred             CCccCCCCCCccCcc
Confidence            455555555555433


No 87 
>COG5048 FOG: Zn-finger [General function prediction only]
Probab=86.12  E-value=0.4  Score=39.90  Aligned_cols=53  Identities=26%  Similarity=0.501  Sum_probs=36.7

Q ss_pred             eeecccccccCCCHHHHHhhhcc-cccCc--ceeecC--cCCcccCCCCccchhhhhc
Q psy12195         15 IIRCETCTRNYESLESLTTHLSF-KHSNQ--FLMKCT--NCNVLVPRDEILPHLSIQH   67 (254)
Q Consensus        15 ~~~C~~C~~~f~~~~~l~~H~~~-~h~~~--~~~~C~--~C~~~~~~~~~l~~~~~~h   67 (254)
                      ++.|..|...|.....+..|.+. .|..+  .++.|.  .|++.|.....+..+...|
T Consensus       289 ~~~~~~~~~~~s~~~~l~~~~~~~~h~~~~~~~~~~p~~~~~~~~~~~~~~~~~~~~~  346 (467)
T COG5048         289 PIKSKQCNISFSRSSPLTRHLRSVNHSGESLKPFSCPYSLCGKLFSRNDALKRHILLH  346 (467)
T ss_pred             CCCCccccCCccccccccccccccccccccCCceeeeccCCCccccccccccCCcccc
Confidence            56677777777777777777772 26666  677777  6777777777766554445


No 88 
>smart00531 TFIIE Transcription initiation factor IIE.
Probab=86.08  E-value=0.83  Score=31.98  Aligned_cols=16  Identities=25%  Similarity=0.762  Sum_probs=9.7

Q ss_pred             CCCcccCCCCcccCCC
Q psy12195        186 NSKSYQCNECPESFER  201 (254)
Q Consensus       186 ~~~~~~C~~C~~~f~~  201 (254)
                      +...|.||.|+..|..
T Consensus        96 ~~~~Y~Cp~C~~~y~~  111 (147)
T smart00531       96 NNAYYKCPNCQSKYTF  111 (147)
T ss_pred             CCcEEECcCCCCEeeH
Confidence            3445677777766653


No 89 
>COG1592 Rubrerythrin [Energy production and conversion]
Probab=85.83  E-value=0.46  Score=33.72  Aligned_cols=24  Identities=29%  Similarity=0.648  Sum_probs=18.2

Q ss_pred             CcccCCCCcccCCCHHHHHHHHHHhhcCCCCCccCcchh
Q psy12195        188 KSYQCNECPESFERLNKLKRHKFQAHNDSVHQIQCPYCI  226 (254)
Q Consensus       188 ~~~~C~~C~~~f~~~~~l~~H~~~~h~~~~~~~~C~~C~  226 (254)
                      +.|.|++||.              .+.+ +.|-+||+|+
T Consensus       133 ~~~vC~vCGy--------------~~~g-e~P~~CPiCg  156 (166)
T COG1592         133 KVWVCPVCGY--------------THEG-EAPEVCPICG  156 (166)
T ss_pred             CEEEcCCCCC--------------cccC-CCCCcCCCCC
Confidence            4689999985              3455 6788899998


No 90 
>smart00659 RPOLCX RNA polymerase subunit CX. present in RNA polymerase I, II and III
Probab=84.87  E-value=0.58  Score=25.11  Aligned_cols=10  Identities=20%  Similarity=0.730  Sum_probs=4.0

Q ss_pred             cccCCCcccC
Q psy12195        162 FTCRRCPSTF  171 (254)
Q Consensus       162 ~~C~~C~~~f  171 (254)
                      |.|..||..|
T Consensus         3 Y~C~~Cg~~~   12 (44)
T smart00659        3 YICGECGREN   12 (44)
T ss_pred             EECCCCCCEe
Confidence            3344444433


No 91 
>TIGR00622 ssl1 transcription factor ssl1. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=84.76  E-value=1.7  Score=28.58  Aligned_cols=47  Identities=15%  Similarity=0.204  Sum_probs=27.3

Q ss_pred             cccccccccccHHHHHhHHhhhccCCCCcccccchhhccChHHHHHHHHh
Q psy12195         77 ECNQCKEKTNDMTTMLNHYSVKHYMDINMSCVPCDVLFHNKATLYKHLYL  126 (254)
Q Consensus        77 ~C~~C~~~~~~~~~l~~h~~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~  126 (254)
                      .|-.|...|........   ..-.....|.|+.|...|-..-++-.|...
T Consensus        57 ~C~~C~~~f~~~~~~~~---~~~~~~~~y~C~~C~~~FC~dCD~fiHe~L  103 (112)
T TIGR00622        57 FCFGCQGPFPKPPVSPF---DELKDSHRYVCAVCKNVFCVDCDVFVHESL  103 (112)
T ss_pred             cccCcCCCCCCcccccc---cccccccceeCCCCCCccccccchhhhhhc
Confidence            36777766654321100   001234467788888888777777777654


No 92 
>PF09986 DUF2225:  Uncharacterized protein conserved in bacteria (DUF2225);  InterPro: IPR018708 This conserved bacterial family has no known function.
Probab=84.50  E-value=0.098  Score=39.15  Aligned_cols=45  Identities=22%  Similarity=0.356  Sum_probs=23.9

Q ss_pred             CcccCCCCcccCCCHHHHHHHHHHh--hcC------CCCC-----ccCcchhhccCCc
Q psy12195        188 KSYQCNECPESFERLNKLKRHKFQA--HND------SVHQ-----IQCPYCITDFSED  232 (254)
Q Consensus       188 ~~~~C~~C~~~f~~~~~l~~H~~~~--h~~------~~~~-----~~C~~C~~~f~~~  232 (254)
                      +.+.||+|++.|....-+....+..  ..+      +..|     ..||.||..|...
T Consensus         4 k~~~CPvC~~~F~~~~vrs~~~r~~~~d~D~~~~Y~~vnP~~Y~V~vCP~CgyA~~~~   61 (214)
T PF09986_consen    4 KKITCPVCGKEFKTKKVRSGKIRVIRRDSDFCPRYKGVNPLFYEVWVCPHCGYAAFEE   61 (214)
T ss_pred             CceECCCCCCeeeeeEEEcCCceEeeecCCCccccCCCCCeeeeEEECCCCCCccccc
Confidence            4567777777776653332222211  111      1222     4699999876644


No 93 
>PHA00626 hypothetical protein
Probab=84.46  E-value=0.25  Score=27.59  Aligned_cols=12  Identities=25%  Similarity=0.260  Sum_probs=5.6

Q ss_pred             CccCcchhhccC
Q psy12195        219 QIQCPYCITDFS  230 (254)
Q Consensus       219 ~~~C~~C~~~f~  230 (254)
                      .|+|+.|+..|+
T Consensus        23 rYkCkdCGY~ft   34 (59)
T PHA00626         23 DYVCCDCGYNDS   34 (59)
T ss_pred             ceEcCCCCCeec
Confidence            344555544444


No 94 
>smart00734 ZnF_Rad18 Rad18-like CCHC zinc finger. Yeast Rad18p functions with Rad5p in error-free post-replicative DNA repair. This zinc finger is likely to bind nucleic-acids.
Probab=84.01  E-value=1.2  Score=20.79  Aligned_cols=19  Identities=26%  Similarity=0.363  Sum_probs=10.8

Q ss_pred             cCCCCcccCCCHHHHHHHHH
Q psy12195        191 QCNECPESFERLNKLKRHKF  210 (254)
Q Consensus       191 ~C~~C~~~f~~~~~l~~H~~  210 (254)
                      .||+|++.+ ....+.+|+.
T Consensus         3 ~CPiC~~~v-~~~~in~HLD   21 (26)
T smart00734        3 QCPVCFREV-PENLINSHLD   21 (26)
T ss_pred             cCCCCcCcc-cHHHHHHHHH
Confidence            466666666 4455555553


No 95 
>PRK00398 rpoP DNA-directed RNA polymerase subunit P; Provisional
Probab=83.72  E-value=0.91  Score=24.56  Aligned_cols=12  Identities=33%  Similarity=0.808  Sum_probs=5.5

Q ss_pred             eeecccccccCC
Q psy12195         15 IIRCETCTRNYE   26 (254)
Q Consensus        15 ~~~C~~C~~~f~   26 (254)
                      +|+|+.||..|.
T Consensus         3 ~y~C~~CG~~~~   14 (46)
T PRK00398          3 EYKCARCGREVE   14 (46)
T ss_pred             EEECCCCCCEEE
Confidence            344444444443


No 96 
>PF09986 DUF2225:  Uncharacterized protein conserved in bacteria (DUF2225);  InterPro: IPR018708 This conserved bacterial family has no known function.
Probab=83.72  E-value=0.35  Score=36.23  Aligned_cols=19  Identities=16%  Similarity=0.454  Sum_probs=12.1

Q ss_pred             eeeeecccccccCCCHHHH
Q psy12195         13 VVIIRCETCTRNYESLESL   31 (254)
Q Consensus        13 ~~~~~C~~C~~~f~~~~~l   31 (254)
                      ++.+.||+|+..|.++.-.
T Consensus         3 ~k~~~CPvC~~~F~~~~vr   21 (214)
T PF09986_consen    3 DKKITCPVCGKEFKTKKVR   21 (214)
T ss_pred             CCceECCCCCCeeeeeEEE
Confidence            3556777777777765433


No 97 
>COG1997 RPL43A Ribosomal protein L37AE/L43A [Translation, ribosomal structure and biogenesis]
Probab=82.75  E-value=0.63  Score=28.80  Aligned_cols=35  Identities=17%  Similarity=0.291  Sum_probs=22.8

Q ss_pred             CCcccCCCCcccCCCHHHHHHHHHHhhcCCCCCccCcchhhccCCch
Q psy12195        187 SKSYQCNECPESFERLNKLKRHKFQAHNDSVHQIQCPYCITDFSEDK  233 (254)
Q Consensus       187 ~~~~~C~~C~~~f~~~~~l~~H~~~~h~~~~~~~~C~~C~~~f~~~~  233 (254)
                      ..+|.||.|++.-        +.+ .   +...+.|..|+..|+-.+
T Consensus        33 ~~~~~Cp~C~~~~--------VkR-~---a~GIW~C~kCg~~fAGga   67 (89)
T COG1997          33 RAKHVCPFCGRTT--------VKR-I---ATGIWKCRKCGAKFAGGA   67 (89)
T ss_pred             hcCCcCCCCCCcc--------eee-e---ccCeEEcCCCCCeecccc
Confidence            4578888888641        111 1   244788999998887543


No 98 
>smart00531 TFIIE Transcription initiation factor IIE.
Probab=81.25  E-value=1.4  Score=30.84  Aligned_cols=17  Identities=29%  Similarity=0.692  Sum_probs=9.4

Q ss_pred             eeeeecccccccCCCHH
Q psy12195         13 VVIIRCETCTRNYESLE   29 (254)
Q Consensus        13 ~~~~~C~~C~~~f~~~~   29 (254)
                      ...|.||.|+..|....
T Consensus        97 ~~~Y~Cp~C~~~y~~~e  113 (147)
T smart00531       97 NAYYKCPNCQSKYTFLE  113 (147)
T ss_pred             CcEEECcCCCCEeeHHH
Confidence            44566666666665433


No 99 
>PRK00464 nrdR transcriptional regulator NrdR; Validated
Probab=80.26  E-value=0.32  Score=34.21  Aligned_cols=13  Identities=23%  Similarity=0.478  Sum_probs=8.1

Q ss_pred             cccCCCcccCCCh
Q psy12195        162 FTCRRCPSTFLNS  174 (254)
Q Consensus       162 ~~C~~C~~~f~~~  174 (254)
                      ++|+.||..|...
T Consensus        29 ~~c~~c~~~f~~~   41 (154)
T PRK00464         29 RECLACGKRFTTF   41 (154)
T ss_pred             eeccccCCcceEe
Confidence            6666666666543


No 100
>KOG2186|consensus
Probab=80.06  E-value=1  Score=33.98  Aligned_cols=56  Identities=23%  Similarity=0.532  Sum_probs=41.1

Q ss_pred             ccccccccccCCHHHHHHHHHhcCCcccccCCCcccCCChHHHHHHHhHhhCCCcccC
Q psy12195        135 IQCNMCSLVLDSKESLVTHISQTHTLMFTCRRCPSTFLNSATLSKHVKMEHNSKSYQC  192 (254)
Q Consensus       135 ~~C~~C~~~f~~~~~l~~h~~~~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C  192 (254)
                      |.|..||.+..- ..+..|+..-+...|.|--|+..|.. ..+..|..--++...|.=
T Consensus         4 FtCnvCgEsvKK-p~vekH~srCrn~~fSCIDC~k~F~~-~sYknH~kCITEaQKYg~   59 (276)
T KOG2186|consen    4 FTCNVCGESVKK-PQVEKHMSRCRNAYFSCIDCGKTFER-VSYKNHTKCITEAQKYGK   59 (276)
T ss_pred             Eehhhhhhhccc-cchHHHHHhccCCeeEEeeccccccc-chhhhhhhhcchHHHhhh
Confidence            678888887654 45667877666678889999999887 677888776666555543


No 101
>PRK14890 putative Zn-ribbon RNA-binding protein; Provisional
Probab=79.97  E-value=1.9  Score=24.66  Aligned_cols=10  Identities=30%  Similarity=0.820  Sum_probs=6.2

Q ss_pred             Cccccccccc
Q psy12195         74 SIYECNQCKE   83 (254)
Q Consensus        74 ~~~~C~~C~~   83 (254)
                      .+|.|+.||.
T Consensus        47 ~~Y~CP~CGF   56 (59)
T PRK14890         47 NPYTCPKCGF   56 (59)
T ss_pred             CceECCCCCC
Confidence            4666666664


No 102
>PF09723 Zn-ribbon_8:  Zinc ribbon domain;  InterPro: IPR013429  This entry represents a region of about 41 amino acids found in a number of small proteins in a wide range of bacteria. The region usually begins with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One protein in this entry has been noted as a putative regulatory protein, designated FmdB []. Most proteins in this entry have a C-terminal region containing highly degenerate sequence.
Probab=79.87  E-value=1.1  Score=23.69  Aligned_cols=14  Identities=14%  Similarity=0.304  Sum_probs=7.0

Q ss_pred             eeecCcCCcccCCC
Q psy12195         44 LMKCTNCNVLVPRD   57 (254)
Q Consensus        44 ~~~C~~C~~~~~~~   57 (254)
                      .|+|..||..|...
T Consensus         5 ey~C~~Cg~~fe~~   18 (42)
T PF09723_consen    5 EYRCEECGHEFEVL   18 (42)
T ss_pred             EEEeCCCCCEEEEE
Confidence            35555555544433


No 103
>KOG2186|consensus
Probab=79.63  E-value=0.83  Score=34.45  Aligned_cols=47  Identities=17%  Similarity=0.330  Sum_probs=31.9

Q ss_pred             CcccccchhhccChHHHHHHHHhhhccCCCcccccccccccCCHHHHHHHHH
Q psy12195        104 NMSCVPCDVLFHNKATLYKHLYLEHKATSLSIQCNMCSLVLDSKESLVTHIS  155 (254)
Q Consensus       104 ~~~C~~C~~~f~~~~~l~~H~~~~~~~~~~~~~C~~C~~~f~~~~~l~~h~~  155 (254)
                      .|.|..||....-. .+..|+-..+.  . .|.|-.|+.+|.. .++..|..
T Consensus         3 ~FtCnvCgEsvKKp-~vekH~srCrn--~-~fSCIDC~k~F~~-~sYknH~k   49 (276)
T KOG2186|consen    3 FFTCNVCGESVKKP-QVEKHMSRCRN--A-YFSCIDCGKTFER-VSYKNHTK   49 (276)
T ss_pred             EEehhhhhhhcccc-chHHHHHhccC--C-eeEEeeccccccc-chhhhhhh
Confidence            36788888765443 45668766333  3 5889999999987 55666754


No 104
>COG1592 Rubrerythrin [Energy production and conversion]
Probab=78.74  E-value=1.5  Score=31.14  Aligned_cols=23  Identities=22%  Similarity=0.563  Sum_probs=17.9

Q ss_pred             ccccCCCcccCCChHHHHHHHhHhhCCCcccCCCCc
Q psy12195        161 MFTCRRCPSTFLNSATLSKHVKMEHNSKSYQCNECP  196 (254)
Q Consensus       161 ~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~  196 (254)
                      .|.|++||..+             .++-|-+||+||
T Consensus       134 ~~vC~vCGy~~-------------~ge~P~~CPiCg  156 (166)
T COG1592         134 VWVCPVCGYTH-------------EGEAPEVCPICG  156 (166)
T ss_pred             EEEcCCCCCcc-------------cCCCCCcCCCCC
Confidence            58888888764             357788899888


No 105
>KOG1280|consensus
Probab=78.38  E-value=1.9  Score=34.17  Aligned_cols=40  Identities=20%  Similarity=0.487  Sum_probs=30.3

Q ss_pred             CCcccCCCCcccCCCHHHHHHHHHHhhcCCCCCccCcchh
Q psy12195        187 SKSYQCNECPESFERLNKLKRHKFQAHNDSVHQIQCPYCI  226 (254)
Q Consensus       187 ~~~~~C~~C~~~f~~~~~l~~H~~~~h~~~~~~~~C~~C~  226 (254)
                      ...|.||+|+..=.+...|..|+...|.+....-.|++|.
T Consensus        77 ~qSftCPyC~~~Gfte~~f~~Hv~s~Hpda~~~~icp~c~  116 (381)
T KOG1280|consen   77 PQSFTCPYCGIMGFTERQFGTHVLSQHPEASTSVICPLCA  116 (381)
T ss_pred             cccccCCcccccccchhHHHHHhhhcCcccCcceeeeccc
Confidence            3478888888877788888889888887755445677775


No 106
>PF03604 DNA_RNApol_7kD:  DNA directed RNA polymerase, 7 kDa subunit;  InterPro: IPR006591 DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Each class of RNA polymerase is assembled from 9 to 15 different polypeptides. Rbp10 (RNA polymerase CX) is a domain found in RNA polymerase subunit 10; present in RNA polymerase I, II and III.; GO: 0003677 DNA binding, 0003899 DNA-directed RNA polymerase activity, 0006351 transcription, DNA-dependent; PDB: 2PMZ_Z 3HKZ_X 2NVX_L 3S1Q_L 2JA6_L 3S17_L 3HOW_L 3HOV_L 3PO2_L 3HOZ_L ....
Probab=77.93  E-value=1.6  Score=21.54  Aligned_cols=8  Identities=38%  Similarity=1.053  Sum_probs=3.6

Q ss_pred             cccCCCCc
Q psy12195        189 SYQCNECP  196 (254)
Q Consensus       189 ~~~C~~C~  196 (254)
                      +..|+.||
T Consensus        17 ~irC~~CG   24 (32)
T PF03604_consen   17 PIRCPECG   24 (32)
T ss_dssp             TSSBSSSS
T ss_pred             cEECCcCC
Confidence            33444444


No 107
>PF08274 PhnA_Zn_Ribbon:  PhnA Zinc-Ribbon ;  InterPro: IPR013987 The PhnA protein family includes the uncharacterised Escherichia coli protein PhnA and its homologues. The E. coli phnA gene is part of a large operon associated with alkylphosphonate uptake and carbon-phosphorus bond cleavage []. The protein is not related to the characterised phosphonoacetate hydrolase designated PhnA []. This entry represents the N-terminal domain of PhnA, which is predicted to form a zinc-ribbon.; PDB: 2AKL_A.
Probab=77.35  E-value=0.66  Score=22.56  Aligned_cols=11  Identities=27%  Similarity=0.785  Sum_probs=6.5

Q ss_pred             CCccCcchhhc
Q psy12195        218 HQIQCPYCITD  228 (254)
Q Consensus       218 ~~~~C~~C~~~  228 (254)
                      ..|.|+.|+..
T Consensus        18 ~~~vCp~C~~e   28 (30)
T PF08274_consen   18 ELLVCPECGHE   28 (30)
T ss_dssp             SSEEETTTTEE
T ss_pred             CEEeCCccccc
Confidence            35667666643


No 108
>COG1996 RPC10 DNA-directed RNA polymerase, subunit RPC10 (contains C4-type Zn-finger) [Transcription]
Probab=77.11  E-value=1.3  Score=24.25  Aligned_cols=10  Identities=30%  Similarity=1.016  Sum_probs=3.9

Q ss_pred             cccCCCcccC
Q psy12195        162 FTCRRCPSTF  171 (254)
Q Consensus       162 ~~C~~C~~~f  171 (254)
                      |.|..||+.|
T Consensus         7 Y~C~~Cg~~~   16 (49)
T COG1996           7 YKCARCGREV   16 (49)
T ss_pred             EEhhhcCCee
Confidence            3344444333


No 109
>TIGR00373 conserved hypothetical protein TIGR00373. This family of proteins is, so far, restricted to archaeal genomes. The family appears to be distantly related to the N-terminal region of the eukaryotic transcription initiation factor IIE alpha chain.
Probab=76.16  E-value=1.6  Score=31.00  Aligned_cols=29  Identities=17%  Similarity=0.509  Sum_probs=14.9

Q ss_pred             ccccCCCcccCCChHHHHHHHhHhhCCCcccCCCCccc
Q psy12195        161 MFTCRRCPSTFLNSATLSKHVKMEHNSKSYQCNECPES  198 (254)
Q Consensus       161 ~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~  198 (254)
                      -|.|+.|+..|+....+.         .-|.||.||..
T Consensus       109 ~Y~Cp~c~~r~tf~eA~~---------~~F~Cp~Cg~~  137 (158)
T TIGR00373       109 FFICPNMCVRFTFNEAME---------LNFTCPRCGAM  137 (158)
T ss_pred             eEECCCCCcEeeHHHHHH---------cCCcCCCCCCE
Confidence            355655655555444432         24566666643


No 110
>PF07754 DUF1610:  Domain of unknown function (DUF1610);  InterPro: IPR011668 This domain is found in archaeal species. It is likely to bind zinc via its four well-conserved cysteine residues.
Probab=76.14  E-value=1.6  Score=19.95  Aligned_cols=11  Identities=27%  Similarity=0.597  Sum_probs=9.1

Q ss_pred             eeeeecccccc
Q psy12195         13 VVIIRCETCTR   23 (254)
Q Consensus        13 ~~~~~C~~C~~   23 (254)
                      -..|.||.||.
T Consensus        14 ~v~f~CPnCG~   24 (24)
T PF07754_consen   14 AVPFPCPNCGF   24 (24)
T ss_pred             CceEeCCCCCC
Confidence            57899999984


No 111
>TIGR02300 FYDLN_acid conserved hypothetical protein TIGR02300. Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues. The function of members of this family is unknown.
Probab=75.74  E-value=2.1  Score=28.70  Aligned_cols=12  Identities=17%  Similarity=0.130  Sum_probs=5.2

Q ss_pred             CcccCCCCcccC
Q psy12195        188 KSYQCNECPESF  199 (254)
Q Consensus       188 ~~~~C~~C~~~f  199 (254)
                      .|..||.||..|
T Consensus        25 ~p~vcP~cg~~~   36 (129)
T TIGR02300        25 RPAVSPYTGEQF   36 (129)
T ss_pred             CCccCCCcCCcc
Confidence            344444444444


No 112
>PF14353 CpXC:  CpXC protein
Probab=75.33  E-value=2.3  Score=28.90  Aligned_cols=19  Identities=26%  Similarity=0.509  Sum_probs=9.1

Q ss_pred             cccCCCCcccCCCHHHHHH
Q psy12195        189 SYQCNECPESFERLNKLKR  207 (254)
Q Consensus       189 ~~~C~~C~~~f~~~~~l~~  207 (254)
                      .|.||.||..|.-...+..
T Consensus        38 ~~~CP~Cg~~~~~~~p~lY   56 (128)
T PF14353_consen   38 SFTCPSCGHKFRLEYPLLY   56 (128)
T ss_pred             EEECCCCCCceecCCCEEE
Confidence            3555555555544443333


No 113
>PRK06266 transcription initiation factor E subunit alpha; Validated
Probab=74.97  E-value=1.6  Score=31.63  Aligned_cols=31  Identities=23%  Similarity=0.715  Sum_probs=17.7

Q ss_pred             cccccCCCcccCCChHHHHHHHhHhhCCCcccCCCCcccC
Q psy12195        160 LMFTCRRCPSTFLNSATLSKHVKMEHNSKSYQCNECPESF  199 (254)
Q Consensus       160 ~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f  199 (254)
                      .-|.|+.|+..|+....+.         .-|.||.||...
T Consensus       116 ~~Y~Cp~C~~rytf~eA~~---------~~F~Cp~Cg~~L  146 (178)
T PRK06266        116 MFFFCPNCHIRFTFDEAME---------YGFRCPQCGEML  146 (178)
T ss_pred             CEEECCCCCcEEeHHHHhh---------cCCcCCCCCCCC
Confidence            3466666666666554431         356677776544


No 114
>PF04780 DUF629:  Protein of unknown function (DUF629);  InterPro: IPR006865 This domain represents a region of several plant proteins of unknown function. A C2H2 zinc finger is predicted in this region in some family members, but the spacing between the cysteine residues is not conserved throughout the family.
Probab=74.86  E-value=1.9  Score=36.12  Aligned_cols=30  Identities=23%  Similarity=0.473  Sum_probs=24.3

Q ss_pred             CCCccCcchhhccCCchHHHHHHHHhcCCC
Q psy12195        217 VHQIQCPYCITDFSEDKNLIQHIVSVHLGK  246 (254)
Q Consensus       217 ~~~~~C~~C~~~f~~~~~l~~H~~~~h~~~  246 (254)
                      .+=+.||.|.+.|.....+..|+...|.+.
T Consensus        55 WrFWiCp~CskkF~d~~~~~~H~~~eH~~~   84 (466)
T PF04780_consen   55 WRFWICPRCSKKFSDAESCLSHMEQEHPAG   84 (466)
T ss_pred             eeEeeCCcccceeCCHHHHHHHHHHhhhhh
Confidence            445678999988999999999988888764


No 115
>smart00834 CxxC_CXXC_SSSS Putative regulatory protein. CxxC_CXXC_SSSS represents a region of about 41 amino acids found in a number of small proteins in a wide range of bacteria. The region usually begins with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One protein in this entry has been noted as a putative regulatory protein, designated FmdB. Most proteins in this entry have a C-terminal region containing highly degenerate sequence.
Probab=74.54  E-value=2  Score=22.31  Aligned_cols=10  Identities=20%  Similarity=0.826  Sum_probs=4.5

Q ss_pred             eecCcCCccc
Q psy12195         45 MKCTNCNVLV   54 (254)
Q Consensus        45 ~~C~~C~~~~   54 (254)
                      |+|..|+..|
T Consensus         6 y~C~~Cg~~f   15 (41)
T smart00834        6 YRCEDCGHTF   15 (41)
T ss_pred             EEcCCCCCEE
Confidence            4444444443


No 116
>PF04959 ARS2:  Arsenite-resistance protein 2;  InterPro: IPR007042 This entry represents Arsenite-resistance protein 2 (also known as Serrate RNA effector molecule homolog) which is thought to play a role in arsenite resistance [], although does not directly confer arsenite resistance but rather modulates arsenic sensitivity []. Arsenite is a carcinogenic compound which can act as a comutagen by inhibiting DNA repair. It is also involved in cell cycle progression at S phase. ; PDB: 3AX1_A.
Probab=74.32  E-value=1.7  Score=32.49  Aligned_cols=26  Identities=27%  Similarity=0.526  Sum_probs=14.4

Q ss_pred             CccCcchhhccCCchHHHHHHHHhcC
Q psy12195        219 QIQCPYCITDFSEDKNLIQHIVSVHL  244 (254)
Q Consensus       219 ~~~C~~C~~~f~~~~~l~~H~~~~h~  244 (254)
                      .|.|++|+|.|.-......|+...|.
T Consensus        77 K~~C~lc~KlFkg~eFV~KHI~nKH~  102 (214)
T PF04959_consen   77 KWRCPLCGKLFKGPEFVRKHIFNKHP  102 (214)
T ss_dssp             EEEE-SSS-EESSHHHHHHHHHHH-H
T ss_pred             EECCCCCCcccCChHHHHHHHhhcCH
Confidence            36666666666666666666655553


No 117
>TIGR02605 CxxC_CxxC_SSSS putative regulatory protein, FmdB family. This model represents a region of about 50 amino acids found in a number of small proteins in a wide range of bacteria. The region begins usually with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One member of this family is has been noted as a putative regulatory protein, designated FmdB (PubMed:8841393). Most members of this family have a C-terminal region containing highly degenerate sequence, such as SSTSESTKSSGSSGSSGSSESKASGSTEKSTSSTTAAAAV in Mycobacterium tuberculosis and VAVGGSAPAPSPAPRAGGGGGGCCGGGCCG in Streptomyces avermitilis. These low complexity regions, which are not included in the model, resemble low-complexity C-terminal regions of some heterocycle-containing bacteriocin precursors.
Probab=73.50  E-value=2.3  Score=23.63  Aligned_cols=11  Identities=27%  Similarity=0.712  Sum_probs=4.6

Q ss_pred             eecCcCCcccC
Q psy12195         45 MKCTNCNVLVP   55 (254)
Q Consensus        45 ~~C~~C~~~~~   55 (254)
                      |+|..|+..|.
T Consensus         6 y~C~~Cg~~fe   16 (52)
T TIGR02605         6 YRCTACGHRFE   16 (52)
T ss_pred             EEeCCCCCEeE
Confidence            44444444333


No 118
>PF05290 Baculo_IE-1:  Baculovirus immediate-early protein (IE-0);  InterPro: IPR007954 This entry contains the Baculovirus immediate-early protein IE-0.
Probab=70.81  E-value=2.4  Score=28.65  Aligned_cols=55  Identities=24%  Similarity=0.561  Sum_probs=30.4

Q ss_pred             cccccCCCcccCCChHHHHHHHhHhhCCCcccC---CCCcccCCCHHHHHHHHHHhhcCCCCCccCcchhhccCCchH
Q psy12195        160 LMFTCRRCPSTFLNSATLSKHVKMEHNSKSYQC---NECPESFERLNKLKRHKFQAHNDSVHQIQCPYCITDFSEDKN  234 (254)
Q Consensus       160 ~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C---~~C~~~f~~~~~l~~H~~~~h~~~~~~~~C~~C~~~f~~~~~  234 (254)
                      .-|+|++|.++...+.-|          +|=.|   .+|+.-+   .+|=     .+.. . --+||+|..+|.+.+.
T Consensus        79 ~lYeCnIC~etS~ee~FL----------KPneCCgY~iCn~Cy---a~LW-----K~~~-~-ypvCPvCkTSFKss~~  136 (140)
T PF05290_consen   79 KLYECNICKETSAEERFL----------KPNECCGYSICNACY---ANLW-----KFCN-L-YPVCPVCKTSFKSSSS  136 (140)
T ss_pred             CceeccCcccccchhhcC----------CcccccchHHHHHHH---HHHH-----HHcc-c-CCCCCccccccccccc
Confidence            678999998887655322          33333   1232222   1221     2222 2 2259999999988654


No 119
>KOG2593|consensus
Probab=70.16  E-value=3.1  Score=34.19  Aligned_cols=42  Identities=29%  Similarity=0.521  Sum_probs=31.0

Q ss_pred             ceeeeecccccccCCCHHHHHhhhcccccCcceeecCcCCcccCCC
Q psy12195         12 KVVIIRCETCTRNYESLESLTTHLSFKHSNQFLMKCTNCNVLVPRD   57 (254)
Q Consensus        12 ~~~~~~C~~C~~~f~~~~~l~~H~~~~h~~~~~~~C~~C~~~~~~~   57 (254)
                      ...-|.||.|++.|.....+..-    -...-.|.|..|+......
T Consensus       125 ~~~~Y~Cp~C~kkyt~Lea~~L~----~~~~~~F~C~~C~gelveD  166 (436)
T KOG2593|consen  125 NVAGYVCPNCQKKYTSLEALQLL----DNETGEFHCENCGGELVED  166 (436)
T ss_pred             ccccccCCccccchhhhHHHHhh----cccCceEEEecCCCchhcc
Confidence            47789999999999988777432    3334468999998766544


No 120
>PRK09678 DNA-binding transcriptional regulator; Provisional
Probab=68.27  E-value=1.4  Score=26.54  Aligned_cols=8  Identities=25%  Similarity=0.584  Sum_probs=3.4

Q ss_pred             chhhccCC
Q psy12195        224 YCITDFSE  231 (254)
Q Consensus       224 ~C~~~f~~  231 (254)
                      .||..|.+
T Consensus        34 eCg~tF~t   41 (72)
T PRK09678         34 NCSATFIT   41 (72)
T ss_pred             CCCCEEEE
Confidence            44444443


No 121
>PF13451 zf-trcl:  Probable zinc-binding domain
Probab=66.88  E-value=2.3  Score=23.40  Aligned_cols=14  Identities=14%  Similarity=0.572  Sum_probs=7.8

Q ss_pred             eeeeecccccccCC
Q psy12195         13 VVIIRCETCTRNYE   26 (254)
Q Consensus        13 ~~~~~C~~C~~~f~   26 (254)
                      ++++.|..||..|.
T Consensus         2 Dk~l~C~dCg~~Fv   15 (49)
T PF13451_consen    2 DKTLTCKDCGAEFV   15 (49)
T ss_pred             CeeEEcccCCCeEE
Confidence            45555666665554


No 122
>PF00301 Rubredoxin:  Rubredoxin;  InterPro: IPR004039 Rubredoxin is a low molecular weight iron-containing bacterial protein involved in electron transfer [, ], sometimes replacing ferredoxin as an electron carrier []. The 3-D structures of a number of rubredoxins have been solved [, ]. The fold belongs to the alpha+beta class, with 2 alpha-helices and 2-3 beta-strands. Its active site contains an iron ion which is co-ordinated by the sulphurs of four conserved cysteine residues forming an almost regular tetrahedron. The conserved cysteines reside on two loops, which are the most conserved regions of the protein. In addition, a ring of acidic residues in the proximity of the [Fe(Cys)4] centre is also well-conserved []. ; GO: 0009055 electron carrier activity, 0046872 metal ion binding; PDB: 2RDV_C 1RDV_A 1S24_A 1T9O_B 1B2J_A 1SMW_A 2PVE_B 1BFY_A 1T9P_C 1C09_C ....
Probab=65.21  E-value=6.1  Score=21.55  Aligned_cols=13  Identities=15%  Similarity=0.598  Sum_probs=7.6

Q ss_pred             eecCcCCcccCCC
Q psy12195         45 MKCTNCNVLVPRD   57 (254)
Q Consensus        45 ~~C~~C~~~~~~~   57 (254)
                      |.|..|+..+...
T Consensus         2 y~C~~CgyvYd~~   14 (47)
T PF00301_consen    2 YQCPVCGYVYDPE   14 (47)
T ss_dssp             EEETTTSBEEETT
T ss_pred             cCCCCCCEEEcCC
Confidence            5566666655544


No 123
>PF02176 zf-TRAF:  TRAF-type zinc finger; PDB: 2EOD_A 2YUC_A 3HCU_A 3HCS_B 3HCT_A.
Probab=64.88  E-value=1.1  Score=25.67  Aligned_cols=43  Identities=21%  Similarity=0.409  Sum_probs=20.4

Q ss_pred             cceeeeeccc--ccccCCCHHHHHhhhcccccCcceeecCc----CCcccC
Q psy12195         11 HKVVIIRCET--CTRNYESLESLTTHLSFKHSNQFLMKCTN----CNVLVP   55 (254)
Q Consensus        11 ~~~~~~~C~~--C~~~f~~~~~l~~H~~~~h~~~~~~~C~~----C~~~~~   55 (254)
                      -...+..|+.  |...+. +..|..|... .-...+..|..    |+..+.
T Consensus         5 C~~~~v~C~~~cc~~~i~-r~~l~~H~~~-~C~~~~v~C~~~~~GC~~~~~   53 (60)
T PF02176_consen    5 CPFRPVPCPNGCCNEMIP-RKELDDHLEN-ECPKRPVPCPYSPYGCKERVP   53 (60)
T ss_dssp             STTSEEE-TT--S-BEEE-CCCHHHHHHT-TSTTSEEE-SS----S--EEE
T ss_pred             CCCCEeeCCCCCccccee-HHHHHHHHHc-cCCCCcEECCCCCCCCCCccc
Confidence            3445566766  444344 4566667664 33444566666    655443


No 124
>COG3364 Zn-ribbon containing protein [General function prediction only]
Probab=64.64  E-value=4.5  Score=25.88  Aligned_cols=14  Identities=36%  Similarity=0.710  Sum_probs=9.0

Q ss_pred             cccccccccccCCH
Q psy12195        134 SIQCNMCSLVLDSK  147 (254)
Q Consensus       134 ~~~C~~C~~~f~~~  147 (254)
                      |++|..||..|.+-
T Consensus         2 pH~CtrCG~vf~~g   15 (112)
T COG3364           2 PHQCTRCGEVFDDG   15 (112)
T ss_pred             Cceecccccccccc
Confidence            45677777777654


No 125
>COG5216 Uncharacterized conserved protein [Function unknown]
Probab=64.10  E-value=6.5  Score=22.29  Aligned_cols=29  Identities=31%  Similarity=0.857  Sum_probs=16.5

Q ss_pred             eeecccccccCC-CHHHHHhhhcccccCcceeecCcCC
Q psy12195         15 IIRCETCTRNYE-SLESLTTHLSFKHSNQFLMKCTNCN   51 (254)
Q Consensus        15 ~~~C~~C~~~f~-~~~~l~~H~~~~h~~~~~~~C~~C~   51 (254)
                      .|.|| ||..|. +..+|       ..++...+|+.|.
T Consensus        22 tyPCP-CGDRFeIsLeDl-------~~GE~VArCPSCS   51 (67)
T COG5216          22 TYPCP-CGDRFEISLEDL-------RNGEVVARCPSCS   51 (67)
T ss_pred             EecCC-CCCEeEEEHHHh-------hCCceEEEcCCce
Confidence            45566 777775 33444       3455566677665


No 126
>PF15269 zf-C2H2_7:  Zinc-finger
Probab=62.13  E-value=6.5  Score=20.88  Aligned_cols=21  Identities=29%  Similarity=0.608  Sum_probs=17.8

Q ss_pred             ccCCCCcccCCCHHHHHHHHH
Q psy12195        190 YQCNECPESFERLNKLKRHKF  210 (254)
Q Consensus       190 ~~C~~C~~~f~~~~~l~~H~~  210 (254)
                      |+|-+|..+..-++.|-.|++
T Consensus        21 ykcfqcpftc~~kshl~nhmk   41 (54)
T PF15269_consen   21 YKCFQCPFTCNEKSHLFNHMK   41 (54)
T ss_pred             ceeecCCcccchHHHHHHHHH
Confidence            788888888888888888876


No 127
>COG0068 HypF Hydrogenase maturation factor [Posttranslational modification, protein turnover, chaperones]
Probab=61.38  E-value=2.9  Score=36.79  Aligned_cols=66  Identities=12%  Similarity=0.235  Sum_probs=38.8

Q ss_pred             hhhhcceeeee-----cccccccCCCHHHHHhhhcccccCc-ceeecCcCCcccCCCCccchhhhhccCCCCCCcccccc
Q psy12195          7 HLEEHKVVIIR-----CETCTRNYESLESLTTHLSFKHSNQ-FLMKCTNCNVLVPRDEILPHLSIQHCQGTTPSIYECNQ   80 (254)
Q Consensus         7 ~~~~~~~~~~~-----C~~C~~~f~~~~~l~~H~~~~h~~~-~~~~C~~C~~~~~~~~~l~~~~~~h~~~~~~~~~~C~~   80 (254)
                      .+...+++.|.     |..||..|.....|---..  .+.. ..--|+.|.+.+.++..-+.|.         .+..|+.
T Consensus       110 Ei~dp~~rrY~YPF~~CT~CGPRfTIi~alPYDR~--nTsM~~F~lC~~C~~EY~dP~nRRfHA---------Qp~aCp~  178 (750)
T COG0068         110 EIFDPNSRRYLYPFINCTNCGPRFTIIEALPYDRE--NTSMADFPLCPFCDKEYKDPLNRRFHA---------QPIACPK  178 (750)
T ss_pred             HhcCCCCcceeccccccCCCCcceeeeccCCCCcc--cCccccCcCCHHHHHHhcCcccccccc---------ccccCcc
Confidence            34455566665     8888888877766633221  2222 2235888877777775443222         3677888


Q ss_pred             ccc
Q psy12195         81 CKE   83 (254)
Q Consensus        81 C~~   83 (254)
                      ||-
T Consensus       179 CGP  181 (750)
T COG0068         179 CGP  181 (750)
T ss_pred             cCC
Confidence            885


No 128
>KOG4124|consensus
Probab=61.03  E-value=1.1  Score=35.45  Aligned_cols=52  Identities=27%  Similarity=0.603  Sum_probs=38.3

Q ss_pred             CCcccCCC--CcccCCCHHHHHHHHHHhhcC-----------------CCCCccCcchhhccCCchHHHHH
Q psy12195        187 SKSYQCNE--CPESFERLNKLKRHKFQAHND-----------------SVHQIQCPYCITDFSEDKNLIQH  238 (254)
Q Consensus       187 ~~~~~C~~--C~~~f~~~~~l~~H~~~~h~~-----------------~~~~~~C~~C~~~f~~~~~l~~H  238 (254)
                      .++|.|++  |++.+.....|..|....|..                 ..++|+|++|.+.+.....|.-|
T Consensus       347 ~~~~~~~vp~~~~~~~n~ng~~~~~~~~h~s~i~~~s~~~~ph~~~~~~nk~~r~~i~~~~~k~~~~l~~~  417 (442)
T KOG4124|consen  347 DKPYKCPVPNCDKAYKNQNGLKYHKLHGHCSPITTPTPAPIPHQGFVVENKPYRCEVCSKRYKNLNGLKYH  417 (442)
T ss_pred             cCCCCCCCCcchhhcccCcceeeccccCcCCCCCCCCCCCCCcceeeeccCcccChhhhhhhccCCCCCce
Confidence            36888865  999999888888886533322                 25789999999988877666444


No 129
>PF05495 zf-CHY:  CHY zinc finger;  InterPro: IPR008913 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  Pirh2 is an eukaryotic ubiquitin protein ligase, which has been shown to promote p53 degradation in mammals. Pirh2 physically interacts with p53 and promotes ubiquitination of p53 independently of MDM2. Like MDM2, Pirh2 is thought to participate in an autoregulatory feedback loop that controls p53 function. Pirh2 proteins contain three distinct zinc fingers, the CHY-type, the CTCHY-type which is C-terminal to the CHY-type zinc finger and a RING finger. The CHY-type zinc finger has no currently known function []. As well as Pirh2, the CHY-type zinc finger is also found in the following proteins:   Yeast helper of Tim protein 13. Hot13 may have a role in the assembly and recycling of the small Tims, a complex of the mitochondrial intermembrane space that participates in the TIM22 import pathway for assembly of the inner membrane [] Several plant hypothetical proteins that also contain haemerythrin cation binding domains Several protozoan hypothetical proteins that also contain a Myb domain   The solution structure of this zinc finger has been solved and binds 3 zinc atoms as shown in the following schematic representation:   ++---------+-----+ || | | CXHYxxxxxxxxxCCxxxxxCxxCHxxxxxHxxxxxxxxxxxCxxCxxxxxxxxxCxxC | | | | | | | | +-+-----------------+--+ +--+---------+--+ 'C': conserved cysteine involved in the binding of one zinc atom. 'H': conserved histidine involved in the binding of one zinc atom.  More information about these proteins can be found at Protein of the Month: Zinc Fingers []; GO: 0008270 zinc ion binding; PDB: 2DKT_A 2K2C_A.
Probab=60.60  E-value=5.9  Score=23.79  Aligned_cols=58  Identities=24%  Similarity=0.311  Sum_probs=30.3

Q ss_pred             eeeecccccccCCCHH---HHHhhhcccccCcceeecCcCCcccCCCCccchhhhhccCCCCCCccccccccc
Q psy12195         14 VIIRCETCTRNYESLE---SLTTHLSFKHSNQFLMKCTNCNVLVPRDEILPHLSIQHCQGTTPSIYECNQCKE   83 (254)
Q Consensus        14 ~~~~C~~C~~~f~~~~---~l~~H~~~~h~~~~~~~C~~C~~~~~~~~~l~~~~~~h~~~~~~~~~~C~~C~~   83 (254)
                      ..++++-|++.|+-..   .+..|... ......+.|..|+..++.....          -+ ..+.|+.|+.
T Consensus         9 ~~~~~~cC~~~y~C~~CHde~~~H~~~-~~~~~~v~Cg~C~~~~~~~~~~----------c~-~~~~C~~C~~   69 (71)
T PF05495_consen    9 CAIRFPCCGKYYPCRFCHDELEDHPFD-RWPVKRVICGKCRTEQPIDEYS----------CG-ADYFCPICGL   69 (71)
T ss_dssp             EEEEETTTTEEESSHHHHHHCSSS----TTT--EEEETTT--EEES-SBT----------T---SEEETTTTE
T ss_pred             EEEECCcccCeecHHHHHHHhccCccc-cccccCeECCCCCCccChhhhh----------cC-CCccCcCcCC
Confidence            5677888888887653   33344433 3333467888888776665430          11 4567777764


No 130
>COG4530 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=59.83  E-value=9.3  Score=24.86  Aligned_cols=12  Identities=8%  Similarity=0.047  Sum_probs=6.0

Q ss_pred             CcccCCCCcccC
Q psy12195        188 KSYQCNECPESF  199 (254)
Q Consensus       188 ~~~~C~~C~~~f  199 (254)
                      .|..||+||++|
T Consensus        25 dPiVsPytG~s~   36 (129)
T COG4530          25 DPIVSPYTGKSY   36 (129)
T ss_pred             CccccCcccccc
Confidence            444555555554


No 131
>PF04959 ARS2:  Arsenite-resistance protein 2;  InterPro: IPR007042 This entry represents Arsenite-resistance protein 2 (also known as Serrate RNA effector molecule homolog) which is thought to play a role in arsenite resistance [], although does not directly confer arsenite resistance but rather modulates arsenic sensitivity []. Arsenite is a carcinogenic compound which can act as a comutagen by inhibiting DNA repair. It is also involved in cell cycle progression at S phase. ; PDB: 3AX1_A.
Probab=59.01  E-value=6.8  Score=29.33  Aligned_cols=27  Identities=22%  Similarity=0.464  Sum_probs=11.6

Q ss_pred             ccccCCCcccCCChHHHHHHHhHhhCC
Q psy12195        161 MFTCRRCPSTFLNSATLSKHVKMEHNS  187 (254)
Q Consensus       161 ~~~C~~C~~~f~~~~~l~~H~~~h~~~  187 (254)
                      .|.|++|++.|.-..-+.+|+...+.+
T Consensus        77 K~~C~lc~KlFkg~eFV~KHI~nKH~e  103 (214)
T PF04959_consen   77 KWRCPLCGKLFKGPEFVRKHIFNKHPE  103 (214)
T ss_dssp             EEEE-SSS-EESSHHHHHHHHHHH-HH
T ss_pred             EECCCCCCcccCChHHHHHHHhhcCHH
Confidence            344555555555544455555444443


No 132
>COG4306 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=58.98  E-value=4.1  Score=27.13  Aligned_cols=18  Identities=11%  Similarity=0.169  Sum_probs=10.2

Q ss_pred             CCcccccccccccccHHH
Q psy12195         73 PSIYECNQCKEKTNDMTT   90 (254)
Q Consensus        73 ~~~~~C~~C~~~~~~~~~   90 (254)
                      +.|.-|..||..|.....
T Consensus        66 e~psfchncgs~fpwter   83 (160)
T COG4306          66 EPPSFCHNCGSRFPWTER   83 (160)
T ss_pred             CCcchhhcCCCCCCcHHH
Confidence            345556667766655433


No 133
>COG3357 Predicted transcriptional regulator containing an HTH domain fused to a Zn-ribbon [Transcription]
Probab=58.44  E-value=6.6  Score=24.61  Aligned_cols=14  Identities=14%  Similarity=0.406  Sum_probs=9.2

Q ss_pred             ceeecCcCCcccCC
Q psy12195         43 FLMKCTNCNVLVPR   56 (254)
Q Consensus        43 ~~~~C~~C~~~~~~   56 (254)
                      .|-.|..||..|..
T Consensus        57 ~Pa~CkkCGfef~~   70 (97)
T COG3357          57 RPARCKKCGFEFRD   70 (97)
T ss_pred             cChhhcccCccccc
Confidence            34567777777765


No 134
>KOG1280|consensus
Probab=57.46  E-value=9.6  Score=30.48  Aligned_cols=38  Identities=21%  Similarity=0.577  Sum_probs=18.6

Q ss_pred             CcccccchhhccChHHHHHHHHhhhccCCCcccccccc
Q psy12195        104 NMSCVPCDVLFHNKATLYKHLYLEHKATSLSIQCNMCS  141 (254)
Q Consensus       104 ~~~C~~C~~~f~~~~~l~~H~~~~~~~~~~~~~C~~C~  141 (254)
                      .|.|++|+..=-+...+..|+...|.+......|+.|+
T Consensus        79 SftCPyC~~~Gfte~~f~~Hv~s~Hpda~~~~icp~c~  116 (381)
T KOG1280|consen   79 SFTCPYCGIMGFTERQFGTHVLSQHPEASTSVICPLCA  116 (381)
T ss_pred             cccCCcccccccchhHHHHHhhhcCcccCcceeeeccc
Confidence            45555555554445555555555454443333444443


No 135
>PF09845 DUF2072:  Zn-ribbon containing protein (DUF2072);  InterPro: IPR018645  This archaeal Zinc-ribbon containing proteins have no known function. 
Probab=57.32  E-value=6.7  Score=26.62  Aligned_cols=14  Identities=29%  Similarity=0.679  Sum_probs=7.9

Q ss_pred             ccccccccccCCHH
Q psy12195        135 IQCNMCSLVLDSKE  148 (254)
Q Consensus       135 ~~C~~C~~~f~~~~  148 (254)
                      ++|..||+.|.+-+
T Consensus         2 H~Ct~Cg~~f~dgs   15 (131)
T PF09845_consen    2 HQCTKCGRVFEDGS   15 (131)
T ss_pred             cccCcCCCCcCCCc
Confidence            45666666665443


No 136
>PF06524 NOA36:  NOA36 protein;  InterPro: IPR010531 This family consists of several NOA36 proteins which contain 29 highly conserved cysteine residues. The function of this protein is unknown.; GO: 0008270 zinc ion binding, 0005634 nucleus
Probab=57.19  E-value=5.2  Score=30.52  Aligned_cols=40  Identities=20%  Similarity=0.373  Sum_probs=19.4

Q ss_pred             CCCCcccccchhhccChHHHHHHHHhhhccCCCcccccccc
Q psy12195        101 MDINMSCVPCDVLFHNKATLYKHLYLEHKATSLSIQCNMCS  141 (254)
Q Consensus       101 ~~~~~~C~~C~~~f~~~~~l~~H~~~~~~~~~~~~~C~~C~  141 (254)
                      +.+.|.|..|.. |....+-..|+..--..+...|+|.-|.
T Consensus       139 GGrif~CsfC~~-flCEDDQFEHQAsCQvLe~E~~KC~SCN  178 (314)
T PF06524_consen  139 GGRIFKCSFCDN-FLCEDDQFEHQASCQVLESETFKCQSCN  178 (314)
T ss_pred             CCeEEEeecCCC-eeeccchhhhhhhhhhhhcccccccccc
Confidence            345567777653 3344444455544333333345555554


No 137
>PF14205 Cys_rich_KTR:  Cysteine-rich KTR
Probab=57.06  E-value=5.2  Score=22.41  Aligned_cols=36  Identities=17%  Similarity=0.271  Sum_probs=18.4

Q ss_pred             eeeeecccccccCCCHHHHHhhhcccccCcceeecCcCCcc
Q psy12195         13 VVIIRCETCTRNYESLESLTTHLSFKHSNQFLMKCTNCNVL   53 (254)
Q Consensus        13 ~~~~~C~~C~~~f~~~~~l~~H~~~~h~~~~~~~C~~C~~~   53 (254)
                      +.++.||.||...+.+..-    -+ --...++.|+.|.+.
T Consensus         2 ~~Wi~CP~CgnKTR~kir~----DT-~LkNfPlyCpKCK~E   37 (55)
T PF14205_consen    2 SEWILCPICGNKTRLKIRE----DT-VLKNFPLYCPKCKQE   37 (55)
T ss_pred             CeEEECCCCCCccceeeec----Cc-eeccccccCCCCCce
Confidence            4567788887655432111    00 122345667777543


No 138
>cd00730 rubredoxin Rubredoxin; nonheme iron binding domains containing a [Fe(SCys)4] center. Rubredoxins are small nonheme iron proteins. The iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), but iron can also be replaced by cobalt, nickel or zinc. They are believed to be involved in electron transfer.
Probab=56.97  E-value=2.9  Score=23.17  Aligned_cols=7  Identities=29%  Similarity=1.008  Sum_probs=3.0

Q ss_pred             ccCCCCc
Q psy12195        190 YQCNECP  196 (254)
Q Consensus       190 ~~C~~C~  196 (254)
                      +.||+|+
T Consensus        35 w~CP~C~   41 (50)
T cd00730          35 WVCPVCG   41 (50)
T ss_pred             CCCCCCC
Confidence            3444444


No 139
>COG1675 TFA1 Transcription initiation factor IIE, alpha subunit [Transcription]
Probab=56.81  E-value=13  Score=26.85  Aligned_cols=32  Identities=19%  Similarity=0.504  Sum_probs=17.3

Q ss_pred             hCCCcccCCCCcccCCCHHHHHHHHHHhhcCCCCCccCcchhh
Q psy12195        185 HNSKSYQCNECPESFERLNKLKRHKFQAHNDSVHQIQCPYCIT  227 (254)
Q Consensus       185 ~~~~~~~C~~C~~~f~~~~~l~~H~~~~h~~~~~~~~C~~C~~  227 (254)
                      +++..|.||.|...|+...+.           ...|.||.||-
T Consensus       109 ~~~~~y~C~~~~~r~sfdeA~-----------~~~F~Cp~Cg~  140 (176)
T COG1675         109 TENNYYVCPNCHVKYSFDEAM-----------ELGFTCPKCGE  140 (176)
T ss_pred             ccCCceeCCCCCCcccHHHHH-----------HhCCCCCCCCc
Confidence            455567777666555433222           12267777764


No 140
>PTZ00255 60S ribosomal protein L37a; Provisional
Probab=56.22  E-value=4.3  Score=25.59  Aligned_cols=33  Identities=24%  Similarity=0.458  Sum_probs=18.5

Q ss_pred             CCcccCCCCcccCCCHHHHHHHHHHhhcCCCCCccCcchhhccCC
Q psy12195        187 SKSYQCNECPESFERLNKLKRHKFQAHNDSVHQIQCPYCITDFSE  231 (254)
Q Consensus       187 ~~~~~C~~C~~~f~~~~~l~~H~~~~h~~~~~~~~C~~C~~~f~~  231 (254)
                      ...|.||.||+.-     +.+    ..   .-++.|..|++.|+-
T Consensus        34 ~a~y~CpfCgk~~-----vkR----~a---~GIW~C~~C~~~~AG   66 (90)
T PTZ00255         34 HAKYFCPFCGKHA-----VKR----QA---VGIWRCKGCKKTVAG   66 (90)
T ss_pred             hCCccCCCCCCCc-----eee----ee---eEEEEcCCCCCEEeC
Confidence            4567777777421     111    11   236777777777654


No 141
>PRK03824 hypA hydrogenase nickel incorporation protein; Provisional
Probab=55.39  E-value=5.6  Score=27.40  Aligned_cols=14  Identities=14%  Similarity=0.831  Sum_probs=8.3

Q ss_pred             eeeecccccccCCC
Q psy12195         14 VIIRCETCTRNYES   27 (254)
Q Consensus        14 ~~~~C~~C~~~f~~   27 (254)
                      ..+.|+.||..|..
T Consensus        69 ~~~~C~~CG~~~~~   82 (135)
T PRK03824         69 AVLKCRNCGNEWSL   82 (135)
T ss_pred             eEEECCCCCCEEec
Confidence            45666666665554


No 142
>PRK04023 DNA polymerase II large subunit; Validated
Probab=54.86  E-value=15  Score=34.04  Aligned_cols=10  Identities=20%  Similarity=0.601  Sum_probs=6.1

Q ss_pred             CccCcchhhc
Q psy12195        219 QIQCPYCITD  228 (254)
Q Consensus       219 ~~~C~~C~~~  228 (254)
                      ++.||.|+..
T Consensus       663 ~y~CPKCG~E  672 (1121)
T PRK04023        663 EDECEKCGRE  672 (1121)
T ss_pred             CCcCCCCCCC
Confidence            3557777653


No 143
>COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair]
Probab=53.06  E-value=12  Score=33.63  Aligned_cols=13  Identities=23%  Similarity=0.659  Sum_probs=8.0

Q ss_pred             CCCcccccccccc
Q psy12195         72 TPSIYECNQCKEK   84 (254)
Q Consensus        72 ~~~~~~C~~C~~~   84 (254)
                      ...|..|+.||..
T Consensus       472 ~~~p~~Cp~Cgs~  484 (730)
T COG1198         472 EPIPQSCPECGSE  484 (730)
T ss_pred             CCCCCCCCCCCCC
Confidence            3456677777644


No 144
>TIGR00280 L37a ribosomal protein L37a. This model finds eukaryotic ribosomal protein L37a and its archaeal orthologs. The nomeclature is tricky because eukaryotes have proteins called both L37 and L37a.
Probab=53.05  E-value=4.2  Score=25.68  Aligned_cols=33  Identities=24%  Similarity=0.512  Sum_probs=18.4

Q ss_pred             CCcccCCCCcccCCCHHHHHHHHHHhhcCCCCCccCcchhhccCC
Q psy12195        187 SKSYQCNECPESFERLNKLKRHKFQAHNDSVHQIQCPYCITDFSE  231 (254)
Q Consensus       187 ~~~~~C~~C~~~f~~~~~l~~H~~~~h~~~~~~~~C~~C~~~f~~  231 (254)
                      ...|.||.||+.-     +.+    ..   .-++.|..|++.|+-
T Consensus        33 ~a~y~CpfCgk~~-----vkR----~a---~GIW~C~~C~~~~AG   65 (91)
T TIGR00280        33 KAKYVCPFCGKKT-----VKR----GS---TGIWTCRKCGAKFAG   65 (91)
T ss_pred             hcCccCCCCCCCc-----eEE----Ee---eEEEEcCCCCCEEeC
Confidence            3567777777421     111    11   236777777777654


No 145
>KOG4118|consensus
Probab=52.92  E-value=9.8  Score=22.11  Aligned_cols=29  Identities=21%  Similarity=0.504  Sum_probs=24.8

Q ss_pred             CccCcchhhccCCchHHHHHHHHhcCCCC
Q psy12195        219 QIQCPYCITDFSEDKNLIQHIVSVHLGKE  247 (254)
Q Consensus       219 ~~~C~~C~~~f~~~~~l~~H~~~~h~~~~  247 (254)
                      .|+|.+|.........+..|....|+.+.
T Consensus        38 ~~kCtVC~~~mpdpktfkqhfe~kHpk~~   66 (74)
T KOG4118|consen   38 HHKCTVCMVQMPDPKTFKQHFENKHPKEP   66 (74)
T ss_pred             HhhhHhhHhhCCCCchHHHHHhhcCCCCC
Confidence            47899999999999999999988887653


No 146
>COG0068 HypF Hydrogenase maturation factor [Posttranslational modification, protein turnover, chaperones]
Probab=52.88  E-value=1.6  Score=38.24  Aligned_cols=56  Identities=20%  Similarity=0.420  Sum_probs=27.9

Q ss_pred             cccccccccCCHHHHHHHHHhcCCcccc-cCCCcccCCChHHHHHHHhHhhCCCcccCCCCcc
Q psy12195        136 QCNMCSLVLDSKESLVTHISQTHTLMFT-CRRCPSTFLNSATLSKHVKMEHNSKSYQCNECPE  197 (254)
Q Consensus       136 ~C~~C~~~f~~~~~l~~h~~~~~~~~~~-C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~  197 (254)
                      .|+.||..|+--.+|---...+-...|. |+.|.+.+.++.+-+-|.      .|..||.||-
T Consensus       125 ~CT~CGPRfTIi~alPYDR~nTsM~~F~lC~~C~~EY~dP~nRRfHA------Qp~aCp~CGP  181 (750)
T COG0068         125 NCTNCGPRFTIIEALPYDRENTSMADFPLCPFCDKEYKDPLNRRFHA------QPIACPKCGP  181 (750)
T ss_pred             ccCCCCcceeeeccCCCCcccCccccCcCCHHHHHHhcCcccccccc------ccccCcccCC
Confidence            3666666665433332222222223444 666666666665544443      2455666664


No 147
>KOG2923|consensus
Probab=52.21  E-value=12  Score=21.68  Aligned_cols=28  Identities=25%  Similarity=0.807  Sum_probs=14.8

Q ss_pred             eecccccccCC-CHHHHHhhhcccccCcceeecCcCC
Q psy12195         16 IRCETCTRNYE-SLESLTTHLSFKHSNQFLMKCTNCN   51 (254)
Q Consensus        16 ~~C~~C~~~f~-~~~~l~~H~~~~h~~~~~~~C~~C~   51 (254)
                      |.|| ||..|. ++..|       ..++....|+-|.
T Consensus        23 yPCp-CGDrf~It~edL-------~~ge~Va~CpsCS   51 (67)
T KOG2923|consen   23 YPCP-CGDRFQITLEDL-------ENGEDVARCPSCS   51 (67)
T ss_pred             cCCC-CCCeeeecHHHH-------hCCCeeecCCCce
Confidence            3454 666665 44444       2344455666664


No 148
>KOG2593|consensus
Probab=52.21  E-value=14  Score=30.62  Aligned_cols=17  Identities=24%  Similarity=0.778  Sum_probs=9.0

Q ss_pred             CcccCCCCcccCCCHHH
Q psy12195        188 KSYQCNECPESFERLNK  204 (254)
Q Consensus       188 ~~~~C~~C~~~f~~~~~  204 (254)
                      .-|.||.|.+.|+..-.
T Consensus       127 ~~Y~Cp~C~kkyt~Lea  143 (436)
T KOG2593|consen  127 AGYVCPNCQKKYTSLEA  143 (436)
T ss_pred             ccccCCccccchhhhHH
Confidence            34666666665544433


No 149
>PF05443 ROS_MUCR:  ROS/MUCR transcriptional regulator protein;  InterPro: IPR008807 This family consists of several ROS/MUCR transcriptional regulator proteins. The ros chromosomal gene is present in octopine and nopaline strains of Agrobacterium tumefaciens as well as in Rhizobium meliloti (Sinorhizobium meliloti). This gene encodes a 15.5 kDa protein that specifically represses the virC and virD operons in the virulence region of the Ti plasmid [] and is necessary for succinoglycan production []. S. meliloti can produce two types of acidic exopolysaccharides, succinoglycan and galactoglucan, that are interchangeable for infection of Medicago sativa (Alfalfa) nodules. MucR from S. meliloti acts as a transcriptional repressor that blocks the expression of the exp genes responsible for galactoglucan production therefore allowing the exclusive production of succinoglycan [].; GO: 0003677 DNA binding, 0008270 zinc ion binding, 0006355 regulation of transcription, DNA-dependent; PDB: 2JSP_A.
Probab=51.08  E-value=9.2  Score=26.18  Aligned_cols=27  Identities=33%  Similarity=0.536  Sum_probs=15.9

Q ss_pred             CCcccCCCCcccCCCHHHHHHHHHHhhcCC
Q psy12195        187 SKSYQCNECPESFERLNKLKRHKFQAHNDS  216 (254)
Q Consensus       187 ~~~~~C~~C~~~f~~~~~l~~H~~~~h~~~  216 (254)
                      +....|-+||+.|...   .+|+..+|+-.
T Consensus        70 ~d~i~clecGk~~k~L---krHL~~~~glt   96 (132)
T PF05443_consen   70 PDYIICLECGKKFKTL---KRHLRTHHGLT   96 (132)
T ss_dssp             SS-EE-TBT--EESBH---HHHHHHTT-S-
T ss_pred             cCeeEEccCCcccchH---HHHHHHccCCC
Confidence            3457899999999764   89998665553


No 150
>PF08271 TF_Zn_Ribbon:  TFIIB zinc-binding;  InterPro: IPR013137 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents a zinc finger motif found in transcription factor IIB (TFIIB). In eukaryotes the initiation of transcription of protein encoding genes by the polymerase II complexe (Pol II) is modulated by general and specific transcription factors. The general transcription factors operate through common promoters elements (such as the TATA box). At least seven different proteins associate to form the general transcription factors: TFIIA, -IIB, -IID, -IIE, -IIF, -IIG, and -IIH [].  TFIIB and TFIID are responsible for promoter recognition and interaction with pol II; together with Pol II, they form a minimal initiation complex capable of transcription under certain conditions. The TATA box of a Pol II promoter is bound in the initiation complex by the TBP subunit of TFIID, which bends the DNA around the C-terminal domain of TFIIB whereas the N-terminal zinc finger of TFIIB interacts with Pol II [, ]. The TFIIB zinc finger adopts a zinc ribbon fold characterised by two beta-hairpins forming two structurally similar zinc-binding sub-sites []. The zinc finger contacts the rbp1 subunit of Pol II through its dock domain, a conserved region of about 70 amino acids located close to the polymerase active site []. In the Pol II complex this surface is located near the RNA exit groove. Interestingly this sequence is best conserved in the three polymerases that utilise a TFIIB-like general transcription factor (Pol II, Pol III, and archaeal RNA polymerase) but not in Pol I [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0006355 regulation of transcription, DNA-dependent; PDB: 1VD4_A 1PFT_A 3K1F_M 3K7A_M 1RO4_A 1RLY_A 1DL6_A.
Probab=51.07  E-value=6.8  Score=20.73  Aligned_cols=9  Identities=22%  Similarity=0.567  Sum_probs=3.7

Q ss_pred             ccccccccc
Q psy12195         76 YECNQCKEK   84 (254)
Q Consensus        76 ~~C~~C~~~   84 (254)
                      +.|..||.+
T Consensus        20 ~vC~~CG~V   28 (43)
T PF08271_consen   20 LVCPNCGLV   28 (43)
T ss_dssp             EEETTT-BB
T ss_pred             EECCCCCCE
Confidence            345555444


No 151
>PF13878 zf-C2H2_3:  zinc-finger of acetyl-transferase ESCO
Probab=49.24  E-value=22  Score=18.66  Aligned_cols=22  Identities=23%  Similarity=0.415  Sum_probs=9.8

Q ss_pred             ccCCCcccCC--ChHHHHHHHhHh
Q psy12195        163 TCRRCPSTFL--NSATLSKHVKME  184 (254)
Q Consensus       163 ~C~~C~~~f~--~~~~l~~H~~~h  184 (254)
                      .|+.||..|.  ....-..|.+-|
T Consensus        15 ~C~~CgM~Y~~~~~eD~~~H~~yH   38 (41)
T PF13878_consen   15 TCPTCGMLYSPGSPEDEKLHKKYH   38 (41)
T ss_pred             CCCCCCCEECCCCHHHHHHHHHHH
Confidence            4555555444  233344444433


No 152
>PRK04023 DNA polymerase II large subunit; Validated
Probab=48.58  E-value=20  Score=33.37  Aligned_cols=12  Identities=17%  Similarity=0.537  Sum_probs=7.0

Q ss_pred             cccCCCCcccCC
Q psy12195        189 SYQCNECPESFE  200 (254)
Q Consensus       189 ~~~C~~C~~~f~  200 (254)
                      +|.|+-||..-.
T Consensus       663 ~y~CPKCG~El~  674 (1121)
T PRK04023        663 EDECEKCGREPT  674 (1121)
T ss_pred             CCcCCCCCCCCC
Confidence            356777775443


No 153
>smart00440 ZnF_C2C2 C2C2 Zinc finger. Nucleic-acid-binding motif in transcriptional elongation factor TFIIS and RNA polymerases.
Probab=48.36  E-value=4.6  Score=21.08  Aligned_cols=9  Identities=33%  Similarity=1.217  Sum_probs=3.9

Q ss_pred             ccccccccc
Q psy12195         76 YECNQCKEK   84 (254)
Q Consensus        76 ~~C~~C~~~   84 (254)
                      |.|..|+..
T Consensus        29 y~C~~C~~~   37 (40)
T smart00440       29 YVCTKCGHR   37 (40)
T ss_pred             EEeCCCCCE
Confidence            444444433


No 154
>PF06397 Desulfoferrod_N:  Desulfoferrodoxin, N-terminal domain;  InterPro: IPR004462 This domain is found as essentially the full length of desulforedoxin, a 37-residue homodimeric non-haem iron protein. It is also found as the N-terminal domain of desulfoferrodoxin (rbo), a homodimeric non-haem iron protein with 2 Fe atoms per monomer in different oxidation states. This domain binds the ferric rather than the ferrous Fe of desulfoferrodoxin. Neelaredoxin, a monomeric blue non-haem iron protein, lacks this domain.; GO: 0005506 iron ion binding; PDB: 1DFX_A 1VZI_B 2JI2_D 1VZH_B 2JI3_C 2JI1_C 1VZG_A 1CFW_A 2LK5_B 1DHG_B ....
Probab=47.27  E-value=10  Score=19.35  Aligned_cols=12  Identities=25%  Similarity=0.631  Sum_probs=5.0

Q ss_pred             eeeecccccccC
Q psy12195         14 VIIRCETCTRNY   25 (254)
Q Consensus        14 ~~~~C~~C~~~f   25 (254)
                      +.|+|..||...
T Consensus         5 ~~YkC~~CGniV   16 (36)
T PF06397_consen    5 EFYKCEHCGNIV   16 (36)
T ss_dssp             EEEE-TTT--EE
T ss_pred             cEEEccCCCCEE
Confidence            456666666543


No 155
>COG1773 Rubredoxin [Energy production and conversion]
Probab=46.50  E-value=8.9  Score=21.66  Aligned_cols=13  Identities=15%  Similarity=0.644  Sum_probs=6.3

Q ss_pred             eecCcCCcccCCC
Q psy12195         45 MKCTNCNVLVPRD   57 (254)
Q Consensus        45 ~~C~~C~~~~~~~   57 (254)
                      |+|..||..|...
T Consensus         4 ~~C~~CG~vYd~e   16 (55)
T COG1773           4 WRCSVCGYVYDPE   16 (55)
T ss_pred             eEecCCceEeccc
Confidence            4455555554433


No 156
>TIGR00686 phnA alkylphosphonate utilization operon protein PhnA. The protein family includes an uncharacterized member designated phnA in Escherichia coli, part of a large operon associated with alkylphosphonate uptake and carbon-phosphorus bond cleavage. This protein is not related to the characterized phosphonoacetate hydrolase designated PhnA by Kulakova, et al. (2001, 1997).
Probab=45.73  E-value=11  Score=24.57  Aligned_cols=13  Identities=38%  Similarity=1.127  Sum_probs=6.8

Q ss_pred             CccCcchhhccCC
Q psy12195        219 QIQCPYCITDFSE  231 (254)
Q Consensus       219 ~~~C~~C~~~f~~  231 (254)
                      .|.||.|+..++.
T Consensus        19 ~~iCpeC~~EW~~   31 (109)
T TIGR00686        19 QLICPSCLYEWNE   31 (109)
T ss_pred             eeECccccccccc
Confidence            3555555555543


No 157
>PF14369 zf-RING_3:  zinc-finger
Probab=45.55  E-value=23  Score=17.87  Aligned_cols=10  Identities=20%  Similarity=0.597  Sum_probs=6.2

Q ss_pred             cccccccccc
Q psy12195         77 ECNQCKEKTN   86 (254)
Q Consensus        77 ~C~~C~~~~~   86 (254)
                      .|+.|+..|.
T Consensus        23 ~CP~C~~gFv   32 (35)
T PF14369_consen   23 ACPRCHGGFV   32 (35)
T ss_pred             CCcCCCCcEe
Confidence            4777766554


No 158
>PF01096 TFIIS_C:  Transcription factor S-II (TFIIS);  InterPro: IPR001222 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents a zinc finger motif found in transcription factor IIs (TFIIS). In eukaryotes the initiation of transcription of protein encoding genes by polymerase II (Pol II) is modulated by general and specific transcription factors. The general transcription factors operate through common promoters elements (such as the TATA box). At least eight different proteins associate to form the general transcription factors: TFIIA, -IIB, -IID, -IIE, -IIF, -IIG, -IIH and -IIS []. During mRNA elongation, Pol II can encounter DNA sequences that cause reverse movement of the enzyme. Such backtracking involves extrusion of the RNA 3'-end into the pore, and can lead to transcriptional arrest. Escape from arrest requires cleavage of the extruded RNA with the help of TFIIS, which induces mRNA cleavage by enhancing the intrinsic nuclease activity of RNA polymerase (Pol) II, past template-encoded pause sites []. TFIIS extends from the polymerase surface via a pore to the internal active site. Two essential and invariant acidic residues in a TFIIS loop complement the Pol II active site and could position a metal ion and a water molecule for hydrolytic RNA cleavage. TFIIS also induces extensive structural changes in Pol II that would realign nucleic acids in the active centre.  TFIIS is a protein of about 300 amino acids. It contains three regions: a variable N-terminal domain not required for TFIIS activity; a conserved central domain required for Pol II binding; and a conserved C-terminal C4-type zinc finger essential for RNA cleavage. The zinc finger folds in a conformation termed a zinc ribbon [] characterised by a three-stranded antiparallel beta-sheet and two beta-hairpins. A backbone model for Pol II-TFIIS complex was obtained from X-ray analysis. It shows that a beta hairpin protrudes from the zinc finger and complements the pol II active site [].  Some viral proteins also contain the TFIIS zinc ribbon C-terminal domain. The Vaccinia virus protein, unlike its eukaryotic homologue, is an integral RNA polymerase subunit rather than a readily separable transcription factor []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003676 nucleic acid binding, 0008270 zinc ion binding, 0006351 transcription, DNA-dependent; PDB: 3M4O_I 3S14_I 2E2J_I 4A3J_I 3HOZ_I 1TWA_I 3S1Q_I 3S1N_I 1TWG_I 3I4M_I ....
Probab=45.35  E-value=1.8  Score=22.53  Aligned_cols=9  Identities=33%  Similarity=1.102  Sum_probs=4.1

Q ss_pred             ccccccccc
Q psy12195         76 YECNQCKEK   84 (254)
Q Consensus        76 ~~C~~C~~~   84 (254)
                      |.|..|+..
T Consensus        29 y~C~~C~~~   37 (39)
T PF01096_consen   29 YVCCNCGHR   37 (39)
T ss_dssp             EEESSSTEE
T ss_pred             EEeCCCCCe
Confidence            445444443


No 159
>KOG2807|consensus
Probab=45.04  E-value=29  Score=27.64  Aligned_cols=25  Identities=28%  Similarity=0.529  Sum_probs=19.4

Q ss_pred             CCccCcchhhccCCchHHHHHHHHhc
Q psy12195        218 HQIQCPYCITDFSEDKNLIQHIVSVH  243 (254)
Q Consensus       218 ~~~~C~~C~~~f~~~~~l~~H~~~~h  243 (254)
                      ..|+|+.|...|-...+.-.|- +-|
T Consensus       344 ~~y~C~~Ck~~FCldCDv~iHe-sLh  368 (378)
T KOG2807|consen  344 GRYRCESCKNVFCLDCDVFIHE-SLH  368 (378)
T ss_pred             CcEEchhccceeeccchHHHHh-hhh
Confidence            3588889988888888887885 555


No 160
>PF07282 OrfB_Zn_ribbon:  Putative transposase DNA-binding domain;  InterPro: IPR010095 This entry represents a region of a sequence similarity between a family of putative transposases of Thermoanaerobacter tengcongensis, smaller related proteins from Bacillus anthracis, putative transposes described by IPR001959 from INTERPRO, and other proteins. More information about these proteins can be found at Protein of the Month: Transposase [].
Probab=44.57  E-value=12  Score=22.07  Aligned_cols=13  Identities=15%  Similarity=0.680  Sum_probs=6.1

Q ss_pred             CCcccCCCCcccC
Q psy12195        187 SKSYQCNECPESF  199 (254)
Q Consensus       187 ~~~~~C~~C~~~f  199 (254)
                      .+.|.|+.||..+
T Consensus        44 ~r~~~C~~Cg~~~   56 (69)
T PF07282_consen   44 GRVFTCPNCGFEM   56 (69)
T ss_pred             cceEEcCCCCCEE
Confidence            3445555555443


No 161
>PF13824 zf-Mss51:  Zinc-finger of mitochondrial splicing suppressor 51
Probab=43.86  E-value=20  Score=20.31  Aligned_cols=8  Identities=25%  Similarity=1.286  Sum_probs=3.3

Q ss_pred             cccCCCCc
Q psy12195        189 SYQCNECP  196 (254)
Q Consensus       189 ~~~C~~C~  196 (254)
                      .|.||.||
T Consensus        14 ~~~Cp~cG   21 (55)
T PF13824_consen   14 NFECPDCG   21 (55)
T ss_pred             CCcCCCCC
Confidence            34444444


No 162
>PF01363 FYVE:  FYVE zinc finger;  InterPro: IPR000306 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The FYVE zinc finger is named after four proteins that it has been found in: Fab1, YOTB/ZK632.12, Vac1, and EEA1. The FYVE finger has been shown to bind two zinc ions []. The FYVE finger has eight potential zinc coordinating cysteine positions. Many members of this family also include two histidines in a motif R+HHC+XCG, where + represents a charged residue and X any residue. FYVE-type domains are divided into two known classes: FYVE domains that specifically bind to phosphatidylinositol 3-phosphate in lipid bilayers and FYVE-related domains of undetermined function []. Those that bind to phosphatidylinositol 3-phosphate are often found in proteins targeted to lipid membranes that are involved in regulating membrane traffic [, , ]. Most FYVE domains target proteins to endosomes by binding specifically to phosphatidylinositol-3-phosphate at the membrane surface. By contrast, the CARP2 FYVE-like domain is not optimized to bind to phosphoinositides or insert into lipid bilayers. FYVE domains are distinguished from other zinc fingers by three signature sequences: an N-terminal WxxD motif, a basic R(R/K)HHCR patch, and a C-terminal RVC motif. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0046872 metal ion binding; PDB: 1HYI_A 1JOC_B 1HYJ_A 1DVP_A 3ZYQ_A 4AVX_A 1VFY_A 3T7L_A 1X4U_A 1WFK_A ....
Probab=43.57  E-value=12  Score=22.11  Aligned_cols=8  Identities=38%  Similarity=1.020  Sum_probs=1.9

Q ss_pred             cCCCcccC
Q psy12195        164 CRRCPSTF  171 (254)
Q Consensus       164 C~~C~~~f  171 (254)
                      |..|++.|
T Consensus        12 C~~C~~~F   19 (69)
T PF01363_consen   12 CMICGKKF   19 (69)
T ss_dssp             -TTT--B-
T ss_pred             CcCcCCcC
Confidence            44444444


No 163
>PRK10220 hypothetical protein; Provisional
Probab=43.35  E-value=14  Score=24.19  Aligned_cols=14  Identities=21%  Similarity=0.781  Sum_probs=7.2

Q ss_pred             CccCcchhhccCCc
Q psy12195        219 QIQCPYCITDFSED  232 (254)
Q Consensus       219 ~~~C~~C~~~f~~~  232 (254)
                      .|.||.|+..++..
T Consensus        20 ~~vCpeC~hEW~~~   33 (111)
T PRK10220         20 MYICPECAHEWNDA   33 (111)
T ss_pred             eEECCcccCcCCcc
Confidence            35555555555433


No 164
>COG5151 SSL1 RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, subunit SSL1 [Transcription / DNA replication, recombination, and repair]
Probab=43.03  E-value=22  Score=28.05  Aligned_cols=26  Identities=19%  Similarity=0.381  Sum_probs=18.1

Q ss_pred             CCCCcccccchhhccChHHHHHHHHh
Q psy12195        101 MDINMSCVPCDVLFHNKATLYKHLYL  126 (254)
Q Consensus       101 ~~~~~~C~~C~~~f~~~~~l~~H~~~  126 (254)
                      ....|.|+.|...|-.-.++..|...
T Consensus       385 ss~rY~Ce~CK~~FC~dCdvfiHe~L  410 (421)
T COG5151         385 SSGRYQCELCKSTFCSDCDVFIHETL  410 (421)
T ss_pred             cccceechhhhhhhhhhhHHHHHHHH
Confidence            34567777777777777777777654


No 165
>PF09332 Mcm10:  Mcm10 replication factor;  InterPro: IPR015411 Mcm10 is a eukaryotic DNA replication factor that regulates the stability and chromatin association of DNA polymerase alpha []. ; PDB: 2KWQ_A.
Probab=43.01  E-value=10  Score=30.66  Aligned_cols=69  Identities=22%  Similarity=0.329  Sum_probs=27.9

Q ss_pred             ceeeeecccccccCCCHHHH---Hhhhccccc-CcceeecCcCCcccCCCCccchhhhhccCCCCCCccccccccccccc
Q psy12195         12 KVVIIRCETCTRNYESLESL---TTHLSFKHS-NQFLMKCTNCNVLVPRDEILPHLSIQHCQGTTPSIYECNQCKEKTND   87 (254)
Q Consensus        12 ~~~~~~C~~C~~~f~~~~~l---~~H~~~~h~-~~~~~~C~~C~~~~~~~~~l~~~~~~h~~~~~~~~~~C~~C~~~~~~   87 (254)
                      ..+.+.|..|.+.+-.....   ..|.-..+. ....|+|..|++....-..+             ..-.|..||..-..
T Consensus       249 k~kav~C~~C~yt~~~~~~~C~~~~H~l~~~~a~KRFFkC~~C~~Rt~sl~r~-------------P~~~C~~Cg~~~we  315 (344)
T PF09332_consen  249 KCKAVTCKQCKYTAFKPSDRCKEEGHPLKWHDAVKRFFKCKDCGNRTISLERL-------------PKKHCSNCGSSKWE  315 (344)
T ss_dssp             EEEEEEETTT--EESS--HHHHHTT--EEEEEEE-EEEE-T-TS-EEEESSSS---------------S--TTT-S---E
T ss_pred             EEEEEEcCCCCCcccCcchhHHhcCCceEEeeeeeeeEECCCCCCeeeecccC-------------CCCCCCcCCcCcee
Confidence            47888999998766544433   234433233 34568899998764433222             12358788765444


Q ss_pred             HHHHHh
Q psy12195         88 MTTMLN   93 (254)
Q Consensus        88 ~~~l~~   93 (254)
                      ...|+.
T Consensus       316 r~~M~~  321 (344)
T PF09332_consen  316 RTGMLK  321 (344)
T ss_dssp             EE---S
T ss_pred             ehhhhh
Confidence            444433


No 166
>COG1571 Predicted DNA-binding protein containing a Zn-ribbon domain [General function prediction only]
Probab=42.73  E-value=17  Score=30.19  Aligned_cols=30  Identities=20%  Similarity=0.393  Sum_probs=19.3

Q ss_pred             cCCCCcccCCCHHHHHHHHHHhhcCCCCCccCcchhhccCCch
Q psy12195        191 QCNECPESFERLNKLKRHKFQAHNDSVHQIQCPYCITDFSEDK  233 (254)
Q Consensus       191 ~C~~C~~~f~~~~~l~~H~~~~h~~~~~~~~C~~C~~~f~~~~  233 (254)
                      .||.||.+.            ...+.. -|+|+.|+..+....
T Consensus       352 ~Cp~Cg~~m------------~S~G~~-g~rC~kCg~~~~~~~  381 (421)
T COG1571         352 VCPRCGGRM------------KSAGRN-GFRCKKCGTRARETL  381 (421)
T ss_pred             CCCccCCch------------hhcCCC-CcccccccccCCccc
Confidence            688888644            223322 788888887776643


No 167
>cd00065 FYVE FYVE domain; Zinc-binding domain; targets proteins to membrane lipids via interaction with phosphatidylinositol-3-phosphate, PI3P; present in Fab1, YOTB, Vac1, and EEA1;
Probab=42.56  E-value=21  Score=19.97  Aligned_cols=14  Identities=21%  Similarity=0.631  Sum_probs=7.3

Q ss_pred             CcccCCCCcccCCC
Q psy12195        188 KSYQCNECPESFER  201 (254)
Q Consensus       188 ~~~~C~~C~~~f~~  201 (254)
                      +.+.|..||+.|-.
T Consensus        17 rk~~Cr~Cg~~~C~   30 (57)
T cd00065          17 RRHHCRNCGRIFCS   30 (57)
T ss_pred             cccccCcCcCCcCh
Confidence            34555555555543


No 168
>PF04780 DUF629:  Protein of unknown function (DUF629);  InterPro: IPR006865 This domain represents a region of several plant proteins of unknown function. A C2H2 zinc finger is predicted in this region in some family members, but the spacing between the cysteine residues is not conserved throughout the family.
Probab=42.46  E-value=20  Score=30.35  Aligned_cols=33  Identities=18%  Similarity=0.434  Sum_probs=27.9

Q ss_pred             hcceeeeecccccccCCCHHHHHhhhcccccCc
Q psy12195         10 EHKVVIIRCETCTRNYESLESLTTHLSFKHSNQ   42 (254)
Q Consensus        10 ~~~~~~~~C~~C~~~f~~~~~l~~H~~~~h~~~   42 (254)
                      +....=+.|+.|.+.|.+..++..|+...|.+.
T Consensus        52 n~sWrFWiCp~CskkF~d~~~~~~H~~~eH~~~   84 (466)
T PF04780_consen   52 NKSWRFWICPRCSKKFSDAESCLSHMEQEHPAG   84 (466)
T ss_pred             cCceeEeeCCcccceeCCHHHHHHHHHHhhhhh
Confidence            445677889999999999999999999777654


No 169
>COG4888 Uncharacterized Zn ribbon-containing protein [General function prediction only]
Probab=42.23  E-value=11  Score=24.21  Aligned_cols=15  Identities=20%  Similarity=0.392  Sum_probs=8.3

Q ss_pred             eeeeecccccccCCC
Q psy12195         13 VVIIRCETCTRNYES   27 (254)
Q Consensus        13 ~~~~~C~~C~~~f~~   27 (254)
                      ++.|.|+.|+..-..
T Consensus        20 ~k~FtCp~Cghe~vs   34 (104)
T COG4888          20 PKTFTCPRCGHEKVS   34 (104)
T ss_pred             CceEecCccCCeeee
Confidence            455666666654443


No 170
>PF12760 Zn_Tnp_IS1595:  Transposase zinc-ribbon domain;  InterPro: IPR024442 This zinc binding domain is found in a range of transposase proteins such as ISSPO8, ISSOD11, ISRSSP2 etc. It may be a zinc-binding beta ribbon domain that could bind DNA.
Probab=42.04  E-value=15  Score=19.76  Aligned_cols=8  Identities=25%  Similarity=0.837  Sum_probs=4.2

Q ss_pred             CccCcchh
Q psy12195        219 QIQCPYCI  226 (254)
Q Consensus       219 ~~~C~~C~  226 (254)
                      .|+|..|+
T Consensus        37 ~~~C~~C~   44 (46)
T PF12760_consen   37 RYRCKACR   44 (46)
T ss_pred             eEECCCCC
Confidence            45555554


No 171
>KOG3408|consensus
Probab=41.64  E-value=16  Score=24.31  Aligned_cols=25  Identities=28%  Similarity=0.474  Sum_probs=17.0

Q ss_pred             CCCcccCCCCcccCCCHHHHHHHHH
Q psy12195        186 NSKSYQCNECPESFERLNKLKRHKF  210 (254)
Q Consensus       186 ~~~~~~C~~C~~~f~~~~~l~~H~~  210 (254)
                      |...|.|-.|.+-|.+...|..|.+
T Consensus        54 G~GqfyCi~CaRyFi~~~~l~~H~k   78 (129)
T KOG3408|consen   54 GGGQFYCIECARYFIDAKALKTHFK   78 (129)
T ss_pred             CCceeehhhhhhhhcchHHHHHHHh
Confidence            3345777777777777777777765


No 172
>PF13453 zf-TFIIB:  Transcription factor zinc-finger
Probab=41.45  E-value=12  Score=19.46  Aligned_cols=8  Identities=25%  Similarity=0.904  Sum_probs=3.0

Q ss_pred             CCCCcccC
Q psy12195        192 CNECPESF  199 (254)
Q Consensus       192 C~~C~~~f  199 (254)
                      |+.|+-.+
T Consensus        22 C~~C~G~W   29 (41)
T PF13453_consen   22 CPSCGGIW   29 (41)
T ss_pred             CCCCCeEE
Confidence            33333333


No 173
>PF04423 Rad50_zn_hook:  Rad50 zinc hook motif;  InterPro: IPR007517 The Mre11 complex (Mre11 Rad50 Nbs1) is central to chromosomal maintenance and functions in homologous recombination, telomere maintenance and sister chromatid association. The Rad50 coiled-coil region contains a dimer interface at the apex of the coiled coils in which pairs of conserved Cys-X-X-Cys motifs form interlocking hooks that bind one Zn ion. This alignment includes the zinc hook motif and a short stretch of coiled-coil on either side.; GO: 0004518 nuclease activity, 0005524 ATP binding, 0008270 zinc ion binding, 0006281 DNA repair; PDB: 1L8D_B.
Probab=40.20  E-value=9.8  Score=21.29  Aligned_cols=12  Identities=33%  Similarity=0.877  Sum_probs=6.5

Q ss_pred             cCcchhhccCCc
Q psy12195        221 QCPYCITDFSED  232 (254)
Q Consensus       221 ~C~~C~~~f~~~  232 (254)
                      .||+|+..|...
T Consensus        22 ~CPlC~r~l~~e   33 (54)
T PF04423_consen   22 CCPLCGRPLDEE   33 (54)
T ss_dssp             E-TTT--EE-HH
T ss_pred             cCCCCCCCCCHH
Confidence            799999988764


No 174
>smart00661 RPOL9 RNA polymerase subunit 9.
Probab=39.68  E-value=16  Score=19.98  Aligned_cols=7  Identities=29%  Similarity=1.260  Sum_probs=3.0

Q ss_pred             ccCCCCc
Q psy12195        190 YQCNECP  196 (254)
Q Consensus       190 ~~C~~C~  196 (254)
                      +.|+.||
T Consensus        21 ~vC~~Cg   27 (52)
T smart00661       21 FVCRKCG   27 (52)
T ss_pred             EECCcCC
Confidence            3444444


No 175
>PF08209 Sgf11:  Sgf11 (transcriptional regulation protein);  InterPro: IPR013246 The Sgf11 family is a SAGA complex subunit in Saccharomyces cerevisiae (Baker's yeast). The SAGA complex is a multisubunit protein complex involved in transcriptional regulation. SAGA combines proteins involved in interactions with DNA-bound activators and TATA-binding protein (TBP), as well as enzymes for histone acetylation and deubiquitylation [].; PDB: 3M99_B 2LO2_A 3MHH_C 3MHS_C.
Probab=39.10  E-value=19  Score=17.93  Aligned_cols=21  Identities=24%  Similarity=0.589  Sum_probs=10.4

Q ss_pred             eeeecccccccCCCHHHHHhhh
Q psy12195         14 VIIRCETCTRNYESLESLTTHL   35 (254)
Q Consensus        14 ~~~~C~~C~~~f~~~~~l~~H~   35 (254)
                      ..+.|+.|+..+. .+.+..|+
T Consensus         3 ~~~~C~nC~R~v~-a~RfA~HL   23 (33)
T PF08209_consen    3 PYVECPNCGRPVA-ASRFAPHL   23 (33)
T ss_dssp             -EEE-TTTSSEEE-GGGHHHHH
T ss_pred             CeEECCCCcCCcc-hhhhHHHH
Confidence            4566777776554 33344444


No 176
>KOG4167|consensus
Probab=38.97  E-value=9.7  Score=33.76  Aligned_cols=25  Identities=24%  Similarity=0.331  Sum_probs=21.4

Q ss_pred             CCccCcchhhccCCchHHHHHHHHhc
Q psy12195        218 HQIQCPYCITDFSEDKNLIQHIVSVH  243 (254)
Q Consensus       218 ~~~~C~~C~~~f~~~~~l~~H~~~~h  243 (254)
                      -.|-|.+|+|.|-....+..|| ..|
T Consensus       791 giFpCreC~kvF~KiKSrNAHM-K~H  815 (907)
T KOG4167|consen  791 GIFPCRECGKVFFKIKSRNAHM-KTH  815 (907)
T ss_pred             ceeehHHHHHHHHHHhhhhHHH-HHH
Confidence            3589999999999999999999 444


No 177
>KOG3408|consensus
Probab=38.92  E-value=19  Score=24.07  Aligned_cols=25  Identities=28%  Similarity=0.587  Sum_probs=18.6

Q ss_pred             CcccccCCCcccCCChHHHHHHHhH
Q psy12195        159 TLMFTCRRCPSTFLNSATLSKHVKM  183 (254)
Q Consensus       159 ~~~~~C~~C~~~f~~~~~l~~H~~~  183 (254)
                      ...|.|-.|.+-|++...|..|.++
T Consensus        55 ~GqfyCi~CaRyFi~~~~l~~H~kt   79 (129)
T KOG3408|consen   55 GGQFYCIECARYFIDAKALKTHFKT   79 (129)
T ss_pred             CceeehhhhhhhhcchHHHHHHHhc
Confidence            3567777788778777777777775


No 178
>PF14446 Prok-RING_1:  Prokaryotic RING finger family 1
Probab=38.87  E-value=22  Score=20.04  Aligned_cols=12  Identities=25%  Similarity=0.714  Sum_probs=6.2

Q ss_pred             CcccCCCCcccC
Q psy12195        188 KSYQCNECPESF  199 (254)
Q Consensus       188 ~~~~C~~C~~~f  199 (254)
                      ....|+.||.-+
T Consensus        20 DiVvCp~Cgapy   31 (54)
T PF14446_consen   20 DIVVCPECGAPY   31 (54)
T ss_pred             CEEECCCCCCcc
Confidence            344566666443


No 179
>PF07503 zf-HYPF:  HypF finger;  InterPro: IPR011125 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  Proteins of the HypF family are involved in the maturation and regulation of hydrogenase []. In the N terminus they appear to have two zinc finger domains that are similar to those found in the DnaJ chaperone []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 3TTD_A 3TSQ_A 3TTC_A 3TSP_A 3TTF_A 3TSU_A.
Probab=37.91  E-value=2.7  Score=21.29  Aligned_cols=8  Identities=25%  Similarity=0.966  Sum_probs=2.6

Q ss_pred             ccCCCccc
Q psy12195        163 TCRRCPST  170 (254)
Q Consensus       163 ~C~~C~~~  170 (254)
                      .|+.||..
T Consensus        23 sC~~CGPr   30 (35)
T PF07503_consen   23 SCTNCGPR   30 (35)
T ss_dssp             -BTTCC-S
T ss_pred             cCCCCCCC
Confidence            34444443


No 180
>KOG2907|consensus
Probab=37.70  E-value=38  Score=22.36  Aligned_cols=11  Identities=45%  Similarity=1.008  Sum_probs=5.8

Q ss_pred             ccccccccccc
Q psy12195         76 YECNQCKEKTN   86 (254)
Q Consensus        76 ~~C~~C~~~~~   86 (254)
                      |.|+.|+..|.
T Consensus       103 YTC~kC~~k~~  113 (116)
T KOG2907|consen  103 YTCPKCKYKFT  113 (116)
T ss_pred             EEcCccceeee
Confidence            55555555443


No 181
>COG1326 Uncharacterized archaeal Zn-finger protein [General function prediction only]
Probab=37.46  E-value=46  Score=24.44  Aligned_cols=39  Identities=21%  Similarity=0.568  Sum_probs=22.9

Q ss_pred             eeeeecccccccCCCHHHHHhhhcccccCcceeecCcCCcccCC
Q psy12195         13 VVIIRCETCTRNYESLESLTTHLSFKHSNQFLMKCTNCNVLVPR   56 (254)
Q Consensus        13 ~~~~~C~~C~~~f~~~~~l~~H~~~~h~~~~~~~C~~C~~~~~~   56 (254)
                      ...+.||.|+ .-.....+   ++. ...+..+.|..||..++.
T Consensus         4 ~iy~~Cp~Cg-~eev~hEV---ik~-~g~~~lvrC~eCG~V~~~   42 (201)
T COG1326           4 EIYIECPSCG-SEEVSHEV---IKE-RGREPLVRCEECGTVHPA   42 (201)
T ss_pred             eEEEECCCCC-cchhhHHH---HHh-cCCceEEEccCCCcEeec
Confidence            3457799999 21111122   122 234467899999988744


No 182
>KOG1842|consensus
Probab=37.20  E-value=20  Score=29.87  Aligned_cols=27  Identities=22%  Similarity=0.409  Sum_probs=17.1

Q ss_pred             cccCCCCcccCCCHHHHHHHHHHhhcC
Q psy12195        189 SYQCNECPESFERLNKLKRHKFQAHND  215 (254)
Q Consensus       189 ~~~C~~C~~~f~~~~~l~~H~~~~h~~  215 (254)
                      -|.||+|...|.+...|..|....|.+
T Consensus        15 gflCPiC~~dl~~~~~L~~H~d~eH~~   41 (505)
T KOG1842|consen   15 GFLCPICLLDLPNLSALNDHLDVEHFE   41 (505)
T ss_pred             cccCchHhhhhhhHHHHHHHHhhhccc
Confidence            356666666666666666666555544


No 183
>smart00154 ZnF_AN1 AN1-like Zinc finger. Zinc finger at the C-terminus of An1, a ubiquitin-like protein in Xenopus laevis.
Probab=36.63  E-value=18  Score=18.75  Aligned_cols=14  Identities=21%  Similarity=0.669  Sum_probs=10.7

Q ss_pred             cccCCCCcccCCCH
Q psy12195        189 SYQCNECPESFERL  202 (254)
Q Consensus       189 ~~~C~~C~~~f~~~  202 (254)
                      |+.|..|++.|-..
T Consensus        12 ~f~C~~C~~~FC~~   25 (39)
T smart00154       12 GFKCRHCGNLFCGE   25 (39)
T ss_pred             CeECCccCCccccc
Confidence            78888888888653


No 184
>PF10083 DUF2321:  Uncharacterized protein conserved in bacteria (DUF2321);  InterPro: IPR016891 This entry is represented by Bacteriophage 'Lactobacillus prophage Lj928', Orf-Ljo1454. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches. There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function.
Probab=36.44  E-value=12  Score=26.28  Aligned_cols=48  Identities=17%  Similarity=0.271  Sum_probs=25.5

Q ss_pred             eeecCcCCcccCCCCccchhhhhccCCCCCCcccccccccccccHHHHHh
Q psy12195         44 LMKCTNCNVLVPRDEILPHLSIQHCQGTTPSIYECNQCKEKTNDMTTMLN   93 (254)
Q Consensus        44 ~~~C~~C~~~~~~~~~l~~~~~~h~~~~~~~~~~C~~C~~~~~~~~~l~~   93 (254)
                      .-.|+.|+....-.....-....  ......|.-|..||..|+.....+.
T Consensus        39 I~~Cp~C~~~IrG~y~v~gv~~~--g~~~~~PsYC~~CGkpyPWt~~~L~   86 (158)
T PF10083_consen   39 ITSCPNCSTPIRGDYHVEGVFGL--GGHYEAPSYCHNCGKPYPWTENALE   86 (158)
T ss_pred             HHHCcCCCCCCCCceecCCeeee--CCCCCCChhHHhCCCCCchHHHHHH
Confidence            34577776544433222211110  0134467888888888876655443


No 185
>COG3091 SprT Zn-dependent metalloprotease, SprT family [General function prediction only]
Probab=35.89  E-value=31  Score=24.18  Aligned_cols=37  Identities=19%  Similarity=0.492  Sum_probs=20.6

Q ss_pred             CcceeecCcCCcccCCCCccchhhhhccCCCCCCccccccccccc
Q psy12195         41 NQFLMKCTNCNVLVPRDEILPHLSIQHCQGTTPSIYECNQCKEKT   85 (254)
Q Consensus        41 ~~~~~~C~~C~~~~~~~~~l~~~~~~h~~~~~~~~~~C~~C~~~~   85 (254)
                      ...+|.|. |+..+.........+      .++ .|.|..|+...
T Consensus       114 ~~~~Y~C~-C~q~~l~~RRhn~~~------~g~-~YrC~~C~gkL  150 (156)
T COG3091         114 TTYPYRCQ-CQQHYLRIRRHNTVR------RGE-VYRCGKCGGKL  150 (156)
T ss_pred             cceeEEee-cCCccchhhhccccc------ccc-eEEeccCCceE
Confidence            44567787 776655443222222      233 67787776543


No 186
>smart00064 FYVE Protein present in Fab1, YOTB, Vac1, and EEA1. The FYVE zinc finger is named after four proteins where it was first found: Fab1, YOTB/ZK632.12, Vac1, and EEA1. The FYVE finger has been shown to bind two Zn2+ ions. The FYVE finger has eight potential zinc coordinating cysteine positions. The FYVE finger is structurally related to the TIGR00100 hypA hydrogenase nickel insertion protein HypA. In Hpylori, hypA mutant abolished hydrogenase activity and decrease in urease activity. Nickel supplementation in media restored urease activity and partial hydrogenase activity. HypA probably involved in inserting Ni in enzymes.
Probab=35.24  E-value=15  Score=24.49  Aligned_cols=11  Identities=18%  Similarity=0.628  Sum_probs=5.9

Q ss_pred             cccCCCcccCC
Q psy12195        162 FTCRRCPSTFL  172 (254)
Q Consensus       162 ~~C~~C~~~f~  172 (254)
                      ..|..|+..|.
T Consensus        71 ~~C~~Cg~~~~   81 (115)
T TIGR00100        71 CECEDCSEEVS   81 (115)
T ss_pred             EEcccCCCEEe
Confidence            45555555554


No 188
>PRK03681 hypA hydrogenase nickel incorporation protein; Validated
Probab=35.21  E-value=19  Score=23.92  Aligned_cols=9  Identities=22%  Similarity=0.630  Sum_probs=4.6

Q ss_pred             cccCCCccc
Q psy12195        162 FTCRRCPST  170 (254)
Q Consensus       162 ~~C~~C~~~  170 (254)
                      ..|..|+..
T Consensus        71 ~~C~~Cg~~   79 (114)
T PRK03681         71 CWCETCQQY   79 (114)
T ss_pred             EEcccCCCe
Confidence            445555543


No 189
>KOG0782|consensus
Probab=34.73  E-value=9.3  Score=32.83  Aligned_cols=54  Identities=17%  Similarity=0.468  Sum_probs=38.7

Q ss_pred             ChHHHHHHHhHhhCCCcccCCCCcccCCCHHHHHHHHHHhhcCCCCCccCcchhhccCCch
Q psy12195        173 NSATLSKHVKMEHNSKSYQCNECPESFERLNKLKRHKFQAHNDSVHQIQCPYCITDFSEDK  233 (254)
Q Consensus       173 ~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~~h~~~~~~~~C~~C~~~f~~~~  233 (254)
                      ..+.+.+|-=+|.-...=+|..|||+|.++-.+       |+.+.-...|+.|...|-.+.
T Consensus       237 rE~~fvrHHWVHrrRqeGkC~~CgKgFQQKf~F-------hsKEivAisCSWCKqayH~Kv  290 (1004)
T KOG0782|consen  237 RESGFVRHHWVHRRRQEGKCNTCGKGFQQKFFF-------HSKEIVAISCSWCKQAYHLKV  290 (1004)
T ss_pred             ccccchHHhHhhHhhhccccchhhhhhhhheee-------ccccEEEEEehHHHHHhhcch
Confidence            344677777777666666899999999765444       343344578999999988776


No 190
>COG1594 RPB9 DNA-directed RNA polymerase, subunit M/Transcription elongation factor TFIIS [Transcription]
Probab=34.71  E-value=6.8  Score=26.04  Aligned_cols=10  Identities=30%  Similarity=1.075  Sum_probs=4.7

Q ss_pred             ccCCCCcccC
Q psy12195        190 YQCNECPESF  199 (254)
Q Consensus       190 ~~C~~C~~~f  199 (254)
                      |.|..||..|
T Consensus       101 y~C~~Cg~~w  110 (113)
T COG1594         101 YKCTRCGYRW  110 (113)
T ss_pred             EEecccCCEe
Confidence            4444444443


No 191
>KOG1842|consensus
Probab=34.60  E-value=23  Score=29.51  Aligned_cols=31  Identities=16%  Similarity=0.404  Sum_probs=26.5

Q ss_pred             CCcccccccccccccHHHHHhHHhhhccCCC
Q psy12195         73 PSIYECNQCKEKTNDMTTMLNHYSVKHYMDI  103 (254)
Q Consensus        73 ~~~~~C~~C~~~~~~~~~l~~h~~~~h~~~~  103 (254)
                      ...|.|++|...|.+...|..|+...|..+-
T Consensus        13 ~egflCPiC~~dl~~~~~L~~H~d~eH~~ed   43 (505)
T KOG1842|consen   13 LEGFLCPICLLDLPNLSALNDHLDVEHFEED   43 (505)
T ss_pred             hhcccCchHhhhhhhHHHHHHHHhhhccccc
Confidence            3568999999999999999999988887654


No 192
>PF11789 zf-Nse:  Zinc-finger of the MIZ type in Nse subunit; PDB: 2YU4_A 3HTK_C.
Probab=34.34  E-value=18  Score=20.66  Aligned_cols=31  Identities=16%  Similarity=0.448  Sum_probs=13.4

Q ss_pred             CcccCCCCcccCCCHHHHHHHHHHhhcCCCCCccCcc
Q psy12195        188 KSYQCNECPESFERLNKLKRHKFQAHNDSVHQIQCPY  224 (254)
Q Consensus       188 ~~~~C~~C~~~f~~~~~l~~H~~~~h~~~~~~~~C~~  224 (254)
                      .|+....||..|.. ..+...+     ......+||+
T Consensus        23 ~PV~s~~C~H~fek-~aI~~~i-----~~~~~~~CPv   53 (57)
T PF11789_consen   23 DPVKSKKCGHTFEK-EAILQYI-----QRNGSKRCPV   53 (57)
T ss_dssp             SEEEESSS--EEEH-HHHHHHC-----TTTS-EE-SC
T ss_pred             CCcCcCCCCCeecH-HHHHHHH-----HhcCCCCCCC
Confidence            45566667776633 3333333     1144566766


No 193
>PF07975 C1_4:  TFIIH C1-like domain;  InterPro: IPR004595 All proteins in this domain for which functions are known are components of the TFIIH complex which is involved in the initiation of transcription and nucleotide excision repair. It includes the yeast transcription factor Ssl1 (Suppressor of stem-loop protein 1) that is essential for translation initiation and affects UV resistance. The C-terminal region is essential for transcription activity. This regions binds three zinc atoms through two independent domain. The first contains a C4 zinc finger motif, whereas the second is characterised by a CX(2)CX(2-4)FCADCD motif. The solution structure of the second C-terminal domain revealed homology with the regulatory domain of protein kinase C [].; GO: 0006281 DNA repair, 0005634 nucleus; PDB: 1Z60_A.
Probab=34.32  E-value=25  Score=19.57  Aligned_cols=25  Identities=16%  Similarity=0.312  Sum_probs=14.5

Q ss_pred             eeeeecccccccCCCHHHHHhhhcc
Q psy12195         13 VVIIRCETCTRNYESLESLTTHLSF   37 (254)
Q Consensus        13 ~~~~~C~~C~~~f~~~~~l~~H~~~   37 (254)
                      ...|+|+.|...|-..-++-.|...
T Consensus        19 ~~~y~C~~C~~~FC~dCD~fiHE~L   43 (51)
T PF07975_consen   19 SSRYRCPKCKNHFCIDCDVFIHETL   43 (51)
T ss_dssp             -EEE--TTTT--B-HHHHHTTTTTS
T ss_pred             CCeEECCCCCCccccCcChhhhccc
Confidence            4678888888888877777777665


No 194
>PRK12380 hydrogenase nickel incorporation protein HybF; Provisional
Probab=34.20  E-value=18  Score=24.03  Aligned_cols=11  Identities=18%  Similarity=0.401  Sum_probs=5.6

Q ss_pred             cccCCCcccCC
Q psy12195        162 FTCRRCPSTFL  172 (254)
Q Consensus       162 ~~C~~C~~~f~  172 (254)
                      ..|..||..|.
T Consensus        71 ~~C~~Cg~~~~   81 (113)
T PRK12380         71 AWCWDCSQVVE   81 (113)
T ss_pred             EEcccCCCEEe
Confidence            44555554443


No 195
>cd00924 Cyt_c_Oxidase_Vb Cytochrome c oxidase subunit Vb.  Cytochrome c oxidase (CcO), the terminal oxidase in the respiratory chains of eukaryotes and most bacteria, is a multi-chain transmembrane protein located in the inner membrane of mitochondria and the cell membrane of prokaryotes.  It catalyzes the reduction of O2 and simultaneously pumps protons across the membrane.  The number of subunits varies from three to five in bacteria and up to 13 in mammalian mitochondria. Subunits I, II, and III of mammalian CcO are encoded within the mitochondrial genome and the remaining 10 subunits are encoded within the nuclear genome.  Found only in eukaryotes, subunit Vb is one of three mammalian subunits that lacks a transmembrane region.  Subunit Vb is located on the matrix side of the membrane and binds the regulatory subunit of protein kinase A.  The abnormally extended conformation is stable only in the CcO assembly.
Probab=34.12  E-value=18  Score=23.25  Aligned_cols=16  Identities=25%  Similarity=0.513  Sum_probs=11.4

Q ss_pred             cceeeeecccccccCC
Q psy12195         11 HKVVIIRCETCTRNYE   26 (254)
Q Consensus        11 ~~~~~~~C~~C~~~f~   26 (254)
                      ++.++.+|+.||..|.
T Consensus        75 ~~g~~~rC~eCG~~fk   90 (97)
T cd00924          75 EKGKPKRCPECGHVFK   90 (97)
T ss_pred             eCCCceeCCCCCcEEE
Confidence            3456778888887775


No 196
>PRK08222 hydrogenase 4 subunit H; Validated
Probab=33.38  E-value=53  Score=23.94  Aligned_cols=18  Identities=17%  Similarity=0.558  Sum_probs=10.1

Q ss_pred             CcccCCCCcccCCCHHHH
Q psy12195        188 KSYQCNECPESFERLNKL  205 (254)
Q Consensus       188 ~~~~C~~C~~~f~~~~~l  205 (254)
                      ....|..||+.|.....+
T Consensus       113 ~~~~C~~Cg~~f~~~k~i  130 (181)
T PRK08222        113 HLQRCSRCERPFAPQKTV  130 (181)
T ss_pred             ccCcCcccCCccCcHhHH
Confidence            355666666666654443


No 197
>PF01780 Ribosomal_L37ae:  Ribosomal L37ae protein family;  InterPro: IPR002674 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms. The codons of the mRNA are exposed on the ribosome to allow tRNA binding. This leads to the incorporation of amino acids into the growing polypeptide chain in accordance with the genetic information. Incoming amino acid monomers enter the ribosomal A site in the form of aminoacyl-tRNAs complexed with elongation factor Tu (EF-Tu) and GTP. The growing polypeptide chain, situated in the P site as peptidyl-tRNA, is then transferred to aminoacyl-tRNA and the new peptidyl-tRNA, extended by one residue, is translocated to the P site with the aid the elongation factor G (EF-G) and GTP as the deacylated tRNA is released from the ribosome through one or more exit sites [, ]. About 2/3 of the mass of the ribosome consists of RNA and 1/3 of protein. The proteins are named in accordance with the subunit of the ribosome which they belong to - the small (S1 to S31) and the large (L1 to L44). Usually they decorate the rRNA cores of the subunits.  Many ribosomal proteins, particularly those of the large subunit, are composed of a globular, surfaced-exposed domain with long finger-like projections that extend into the rRNA core to stabilise its structure. Most of the proteins interact with multiple RNA elements, often from different domains. In the large subunit, about 1/3 of the 23S rRNA nucleotides are at least in van der Waal's contact with protein, and L22 interacts with all six domains of the 23S rRNA. Proteins S4 and S7, which initiate assembly of the 16S rRNA, are located at junctions of five and four RNA helices, respectively. In this way proteins serve to organise and stabilise the rRNA tertiary structure. While the crucial activities of decoding and peptide transfer are RNA based, proteins play an active role in functions that may have evolved to streamline the process of protein synthesis. In addition to their function in the ribosome, many ribosomal proteins have some function 'outside' the ribosome [, ]. This ribosomal protein is found in archaebacteria and eukaryotes []. Ribosomal protein L37 has a single zinc finger-like motif of the C2-C2 type [].; GO: 0003735 structural constituent of ribosome, 0006412 translation, 0005622 intracellular, 0005840 ribosome; PDB: 4A1E_Y 4A17_Y 4A1C_Y 4A1A_Y 3O58_g 3IZS_m 3O5H_g 1S1I_9 3IZR_m 1YSH_D ....
Probab=32.82  E-value=13  Score=23.43  Aligned_cols=11  Identities=36%  Similarity=1.081  Sum_probs=7.0

Q ss_pred             ccccccccccc
Q psy12195         75 IYECNQCKEKT   85 (254)
Q Consensus        75 ~~~C~~C~~~~   85 (254)
                      .+.|..|+..|
T Consensus        53 IW~C~~C~~~~   63 (90)
T PF01780_consen   53 IWKCKKCGKKF   63 (90)
T ss_dssp             EEEETTTTEEE
T ss_pred             EeecCCCCCEE
Confidence            46677776655


No 198
>PF10276 zf-CHCC:  Zinc-finger domain;  InterPro: IPR019401 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.   This entry represents a short conserved zinc-finger domain. It contains the sequence motif Cx8Hx14Cx2C. ; PDB: 2JVM_A 2JRR_A 2JZ8_A.
Probab=32.62  E-value=15  Score=19.21  Aligned_cols=12  Identities=17%  Similarity=0.537  Sum_probs=7.9

Q ss_pred             CcccCCCCcccC
Q psy12195        188 KSYQCNECPESF  199 (254)
Q Consensus       188 ~~~~C~~C~~~f  199 (254)
                      ++-.|++|+..|
T Consensus        28 ~~~~CpYCg~~y   39 (40)
T PF10276_consen   28 GPVVCPYCGTRY   39 (40)
T ss_dssp             CEEEETTTTEEE
T ss_pred             CeEECCCCCCEE
Confidence            356777777665


No 199
>PF10013 DUF2256:  Uncharacterized protein conserved in bacteria (DUF2256);  InterPro: IPR017136 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function.
Probab=32.57  E-value=34  Score=18.07  Aligned_cols=18  Identities=28%  Similarity=0.499  Sum_probs=12.2

Q ss_pred             cCCCCcccCCCHHHHHHH
Q psy12195        191 QCNECPESFERLNKLKRH  208 (254)
Q Consensus       191 ~C~~C~~~f~~~~~l~~H  208 (254)
                      .|++||+.|.......+-
T Consensus        10 ~C~~C~rpf~WRKKW~~~   27 (42)
T PF10013_consen   10 ICPVCGRPFTWRKKWARC   27 (42)
T ss_pred             cCcccCCcchHHHHHHHh
Confidence            578888888776655543


No 200
>COG4896 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=31.66  E-value=18  Score=20.80  Aligned_cols=7  Identities=57%  Similarity=1.521  Sum_probs=2.7

Q ss_pred             ccCCCCc
Q psy12195        190 YQCNECP  196 (254)
Q Consensus       190 ~~C~~C~  196 (254)
                      |-|+.|.
T Consensus        32 ymC~eC~   38 (68)
T COG4896          32 YMCPECE   38 (68)
T ss_pred             EechhhH
Confidence            3333333


No 201
>smart00731 SprT SprT homologues. Predicted to have roles in transcription elongation. Contains a conserved HExxH motif, indicating a metalloprotease function.
Probab=31.20  E-value=44  Score=23.28  Aligned_cols=34  Identities=26%  Similarity=0.560  Sum_probs=19.5

Q ss_pred             cceeecCcCCcccCCCCccchhhhhccCCCCCCccccccccccc
Q psy12195         42 QFLMKCTNCNVLVPRDEILPHLSIQHCQGTTPSIYECNQCKEKT   85 (254)
Q Consensus        42 ~~~~~C~~C~~~~~~~~~l~~~~~~h~~~~~~~~~~C~~C~~~~   85 (254)
                      ...|.|..|+..+...      .+ +   .....|.|..|+..+
T Consensus       110 ~~~y~C~~C~~~~~~~------rr-~---~~~~~y~C~~C~g~l  143 (146)
T smart00731      110 KYPYRCTGCGQRYLRV------RR-S---NNVSRYRCGKCGGKL  143 (146)
T ss_pred             eEEEECCCCCCCCceE------cc-c---cCcceEEcCCCCCEE
Confidence            3467888887655311      11 2   222567888887655


No 202
>PRK00564 hypA hydrogenase nickel incorporation protein; Provisional
Probab=31.02  E-value=30  Score=23.15  Aligned_cols=11  Identities=27%  Similarity=0.981  Sum_probs=5.3

Q ss_pred             cccCCCcccCC
Q psy12195        162 FTCRRCPSTFL  172 (254)
Q Consensus       162 ~~C~~C~~~f~  172 (254)
                      +.|..||..|.
T Consensus        72 ~~C~~Cg~~~~   82 (117)
T PRK00564         72 LECKDCSHVFK   82 (117)
T ss_pred             EEhhhCCCccc
Confidence            44555554443


No 203
>PF07800 DUF1644:  Protein of unknown function (DUF1644);  InterPro: IPR012866 This family consists of sequences found in a number of hypothetical plant proteins of unknown function. The region of interest contains nine highly conserved cysteine residues and is approximately 160 amino acids in length, which probably represent a zinc-binding domain. 
Probab=30.98  E-value=2e+02  Score=20.55  Aligned_cols=57  Identities=16%  Similarity=0.187  Sum_probs=31.1

Q ss_pred             cccCCCCcccCCCHHHHHHHHHHhhcCCCCCccCcc--hhhccCCchHHHHHHHHhcCCCCCC
Q psy12195        189 SYQCNECPESFERLNKLKRHKFQAHNDSVHQIQCPY--CITDFSEDKNLIQHIVSVHLGKEGT  249 (254)
Q Consensus       189 ~~~C~~C~~~f~~~~~l~~H~~~~h~~~~~~~~C~~--C~~~f~~~~~l~~H~~~~h~~~~~~  249 (254)
                      ...||.|.-... .+.+....+..-+.  |+-.|..  |.. ..+-..|..|++..|...+|-
T Consensus        80 ~L~CPLCRG~V~-GWtvve~AR~~LN~--K~RsC~~e~C~F-~GtY~eLrKHar~~HP~~rP~  138 (162)
T PF07800_consen   80 ELACPLCRGEVK-GWTVVEPARRFLNA--KKRSCSQESCSF-SGTYSELRKHARSEHPSARPS  138 (162)
T ss_pred             cccCccccCcee-ceEEchHHHHHhcc--CCccCccccccc-ccCHHHHHHHHHhhCCCCCCc
Confidence            467888863221 12222223322222  3333544  543 245677899998999888874


No 204
>PRK12496 hypothetical protein; Provisional
Probab=30.79  E-value=38  Score=24.25  Aligned_cols=11  Identities=18%  Similarity=0.721  Sum_probs=8.6

Q ss_pred             cccCCCcccCC
Q psy12195        162 FTCRRCPSTFL  172 (254)
Q Consensus       162 ~~C~~C~~~f~  172 (254)
                      |.|..|++.|.
T Consensus       128 ~~C~gC~~~~~  138 (164)
T PRK12496        128 KVCKGCKKKYP  138 (164)
T ss_pred             EECCCCCcccc
Confidence            67888888875


No 205
>PF01428 zf-AN1:  AN1-like Zinc finger;  InterPro: IPR000058 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents the AN1-type zinc finger domain, which has a dimetal (zinc)-bound alpha/beta fold. This domain was first identified as a zinc finger at the C terminus of AN1 Q91889 from SWISSPROT, a ubiquitin-like protein in Xenopus laevis []. The AN1-type zinc finger contains six conserved cysteines and two histidines that could potentially coordinate 2 zinc atoms. Certain stress-associated proteins (SAP) contain AN1 domain, often in combination with A20 zinc finger domains (SAP8) or C2H2 domains (SAP16) []. For example, the human protein Znf216 has an A20 zinc-finger at the N terminus and an AN1 zinc-finger at the C terminus, acting to negatively regulate the NFkappaB activation pathway and to interact with components of the immune response like RIP, IKKgamma and TRAF6. The interact of Znf216 with IKK-gamma and RIP is mediated by the A20 zinc-finger domain, while its interaction with TRAF6 is mediated by the AN1 zinc-finger domain; therefore, both zinc-finger domains are involved in regulating the immune response []. The AN1 zinc finger domain is also found in proteins containing a ubiquitin-like domain, which are involved in the ubiquitination pathway []. Proteins containing an AN1-type zinc finger include:   Ascidian posterior end mark 6 (pem-6) protein []. Human AWP1 protein (associated with PRK1), which is expressed during early embryogenesis []. Human immunoglobulin mu binding protein 2 (SMUBP-2), mutations in which cause muscular atrophy with respiratory distress type 1 [].   More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 1WFP_A 1WYS_A 1WG2_A 1WFH_A 1X4W_A 1WFE_A 1WFL_A 1X4V_A.
Probab=30.65  E-value=16  Score=19.29  Aligned_cols=15  Identities=27%  Similarity=0.680  Sum_probs=8.7

Q ss_pred             CcccCCCCcccCCCH
Q psy12195        188 KSYQCNECPESFERL  202 (254)
Q Consensus       188 ~~~~C~~C~~~f~~~  202 (254)
                      -|+.|+.|++.|=..
T Consensus        12 ~~~~C~~C~~~FC~~   26 (43)
T PF01428_consen   12 LPFKCKHCGKSFCLK   26 (43)
T ss_dssp             SHEE-TTTS-EE-TT
T ss_pred             CCeECCCCCcccCcc
Confidence            467888888888653


No 206
>PF08790 zf-LYAR:  LYAR-type C2HC zinc finger ;  InterPro: IPR014898 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This C2HC zinc finger domain is found in LYAR proteins such as Q08288 from SWISSPROT, which are involved in cell growth regulation.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 1WJV_A.
Probab=30.01  E-value=7.1  Score=18.60  Aligned_cols=6  Identities=33%  Similarity=0.429  Sum_probs=2.2

Q ss_pred             cccccc
Q psy12195        139 MCSLVL  144 (254)
Q Consensus       139 ~C~~~f  144 (254)
                      .|++.|
T Consensus         5 DC~~~F   10 (28)
T PF08790_consen    5 DCSKDF   10 (28)
T ss_dssp             TTTEEE
T ss_pred             cCCCCc
Confidence            333333


No 207
>PRK04351 hypothetical protein; Provisional
Probab=29.72  E-value=25  Score=24.68  Aligned_cols=34  Identities=24%  Similarity=0.592  Sum_probs=21.6

Q ss_pred             ceeecCcCCcccCCCCccchhhhhccCCCCCCccccccccccccc
Q psy12195         43 FLMKCTNCNVLVPRDEILPHLSIQHCQGTTPSIYECNQCKEKTND   87 (254)
Q Consensus        43 ~~~~C~~C~~~~~~~~~l~~~~~~h~~~~~~~~~~C~~C~~~~~~   87 (254)
                      ..|.|..|+..+...      ++ +    ....|.|..|+..+..
T Consensus       111 y~Y~C~~Cg~~~~r~------Rr-~----n~~~yrCg~C~g~L~~  144 (149)
T PRK04351        111 YLYECQSCGQQYLRK------RR-I----NTKRYRCGKCRGKLKL  144 (149)
T ss_pred             EEEECCCCCCEeeee------ee-c----CCCcEEeCCCCcEeee
Confidence            568898888655332      11 2    2367889988866543


No 208
>PF12230 PRP21_like_P:  Pre-mRNA splicing factor PRP21 like protein;  InterPro: IPR022030  This domain family is found in eukaryotes, and is typically between 212 and 238 amino acids in length. The family is found in association with PF01805 from PFAM. There are two completely conserved residues (W and H) that may be functionally important. PRP21 is required for assembly of the prespliceosome and it interacts with U2 snRNP and/or pre-mRNA in the prespliceosome. This family also contains proteins similar to PRP21, such as the mammalian SF3a. SF3a also interacts with U2 snRNP from the prespliceosome, converting it to its active form. ; PDB: 4DGW_B.
Probab=29.49  E-value=18  Score=27.48  Aligned_cols=25  Identities=16%  Similarity=0.315  Sum_probs=0.0

Q ss_pred             ceeeeecccccccCCCHHHHHhhhcc
Q psy12195         12 KVVIIRCETCTRNYESLESLTTHLSF   37 (254)
Q Consensus        12 ~~~~~~C~~C~~~f~~~~~l~~H~~~   37 (254)
                      +.....||+||...+ .+.|..||++
T Consensus       165 ~~~~~~cPitGe~IP-~~e~~eHmRi  189 (229)
T PF12230_consen  165 KEKMIICPITGEMIP-ADEMDEHMRI  189 (229)
T ss_dssp             --------------------------
T ss_pred             ccccccccccccccc-cccccccccc
Confidence            567789999999998 7889999997


No 209
>KOG0717|consensus
Probab=29.24  E-value=27  Score=29.38  Aligned_cols=21  Identities=29%  Similarity=0.581  Sum_probs=17.0

Q ss_pred             ccCcchhhccCCchHHHHHHH
Q psy12195        220 IQCPYCITDFSEDKNLIQHIV  240 (254)
Q Consensus       220 ~~C~~C~~~f~~~~~l~~H~~  240 (254)
                      +.|.+|.|+|.+...|..|..
T Consensus       293 lyC~vCnKsFKseKq~kNHEn  313 (508)
T KOG0717|consen  293 LYCVVCNKSFKSEKQLKNHEN  313 (508)
T ss_pred             eEEeeccccccchHHHHhhHH
Confidence            668888888888888888853


No 210
>KOG0717|consensus
Probab=29.20  E-value=31  Score=29.01  Aligned_cols=21  Identities=33%  Similarity=0.616  Sum_probs=18.8

Q ss_pred             ccCCCCcccCCCHHHHHHHHH
Q psy12195        190 YQCNECPESFERLNKLKRHKF  210 (254)
Q Consensus       190 ~~C~~C~~~f~~~~~l~~H~~  210 (254)
                      +.|.+|.|+|.+...|..|..
T Consensus       293 lyC~vCnKsFKseKq~kNHEn  313 (508)
T KOG0717|consen  293 LYCVVCNKSFKSEKQLKNHEN  313 (508)
T ss_pred             eEEeeccccccchHHHHhhHH
Confidence            889999999999999998864


No 211
>COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair]
Probab=28.57  E-value=14  Score=33.29  Aligned_cols=11  Identities=27%  Similarity=0.652  Sum_probs=5.6

Q ss_pred             CCcccCCCCcc
Q psy12195        187 SKSYQCNECPE  197 (254)
Q Consensus       187 ~~~~~C~~C~~  197 (254)
                      ..|..||.||.
T Consensus       473 ~~p~~Cp~Cgs  483 (730)
T COG1198         473 PIPQSCPECGS  483 (730)
T ss_pred             CCCCCCCCCCC
Confidence            34555555553


No 212
>KOG2636|consensus
Probab=28.25  E-value=40  Score=28.24  Aligned_cols=28  Identities=18%  Similarity=0.383  Sum_probs=22.6

Q ss_pred             HhhCCCcccCCCCc-ccCCCHHHHHHHHH
Q psy12195        183 MEHNSKSYQCNECP-ESFERLNKLKRHKF  210 (254)
Q Consensus       183 ~h~~~~~~~C~~C~-~~f~~~~~l~~H~~  210 (254)
                      .|--+..|.|.+|| +++....++.+|..
T Consensus       395 LHGL~~ey~CEICGNy~Y~GrkaF~RHF~  423 (497)
T KOG2636|consen  395 LHGLDIEYNCEICGNYVYKGRKAFDRHFN  423 (497)
T ss_pred             hcCCCcccceeeccCccccCcHHHHHHhH
Confidence            44556779999999 88888889999964


No 213
>TIGR00319 desulf_FeS4 desulfoferrodoxin FeS4 iron-binding domain. Neelaredoxin, a monomeric blue non-heme iron protein, lacks this domain.
Probab=28.00  E-value=33  Score=16.94  Aligned_cols=12  Identities=25%  Similarity=0.708  Sum_probs=7.6

Q ss_pred             eeeecccccccC
Q psy12195         14 VIIRCETCTRNY   25 (254)
Q Consensus        14 ~~~~C~~C~~~f   25 (254)
                      +.|+|..|+..+
T Consensus         6 ~~ykC~~Cgniv   17 (34)
T TIGR00319         6 QVYKCEVCGNIV   17 (34)
T ss_pred             cEEEcCCCCcEE
Confidence            466777776654


No 214
>smart00504 Ubox Modified RING finger domain. Modified RING finger domain, without the full complement of Zn2+-binding ligands. Probable involvement in E2-dependent ubiquitination.
Probab=27.73  E-value=1.2e+02  Score=17.06  Aligned_cols=10  Identities=10%  Similarity=0.039  Sum_probs=6.3

Q ss_pred             cCcchhhccC
Q psy12195        221 QCPYCITDFS  230 (254)
Q Consensus       221 ~C~~C~~~f~  230 (254)
                      .||.|++.++
T Consensus        37 ~cP~~~~~~~   46 (63)
T smart00504       37 TDPVTGQPLT   46 (63)
T ss_pred             CCCCCcCCCC
Confidence            4777766654


No 215
>PF02591 DUF164:  Putative zinc ribbon domain;  InterPro: IPR003743 This entry describes proteins of unknown function.
Probab=27.63  E-value=60  Score=18.23  Aligned_cols=11  Identities=18%  Similarity=0.546  Sum_probs=5.2

Q ss_pred             CCcccCCCCcc
Q psy12195        187 SKSYQCNECPE  197 (254)
Q Consensus       187 ~~~~~C~~C~~  197 (254)
                      +....||.||+
T Consensus        44 ~~i~~Cp~CgR   54 (56)
T PF02591_consen   44 DEIVFCPNCGR   54 (56)
T ss_pred             CCeEECcCCCc
Confidence            34444555543


No 216
>PHA02998 RNA polymerase subunit; Provisional
Probab=27.52  E-value=20  Score=25.79  Aligned_cols=14  Identities=14%  Similarity=0.387  Sum_probs=7.2

Q ss_pred             eeecCcCCcccCCC
Q psy12195         44 LMKCTNCNVLVPRD   57 (254)
Q Consensus        44 ~~~C~~C~~~~~~~   57 (254)
                      .|.|..|+..|..+
T Consensus       171 FYkC~~CG~~wkpp  184 (195)
T PHA02998        171 RHACRDCKKHFKPP  184 (195)
T ss_pred             EEEcCCCCCccCCc
Confidence            35555555554443


No 217
>COG4391 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=27.37  E-value=30  Score=20.00  Aligned_cols=39  Identities=13%  Similarity=0.251  Sum_probs=21.0

Q ss_pred             CCcccccCCCcccCCChHHHHHHHhHhhCCCcccCCCCcccCC
Q psy12195        158 HTLMFTCRRCPSTFLNSATLSKHVKMEHNSKSYQCNECPESFE  200 (254)
Q Consensus       158 ~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~  200 (254)
                      +..++.|+.=+..|....-+.   .+ -.++...|++|+..|+
T Consensus        21 ~~~~l~C~g~~~p~~HPrV~L---~m-g~~gev~CPYC~t~y~   59 (62)
T COG4391          21 GDLPLMCPGPEPPNDHPRVFL---DM-GDEGEVVCPYCSTRYR   59 (62)
T ss_pred             CCeeEEcCCCCCCCCCCEEEE---Ec-CCCCcEecCccccEEE
Confidence            335666766555544332111   11 3455677888887775


No 218
>TIGR01206 lysW lysine biosynthesis protein LysW. This very small, poorly characterized protein has been shown essential in Thermus thermophilus for an unusual pathway of Lys biosynthesis from aspartate by way of alpha-aminoadipate (AAA) rather than diaminopimelate. It is found also in Deinococcus radiodurans and Pyrococcus horikoshii, which appear to share the AAA pathway.
Probab=27.30  E-value=23  Score=20.00  Aligned_cols=12  Identities=25%  Similarity=0.769  Sum_probs=8.1

Q ss_pred             ccCcchhhccCC
Q psy12195        220 IQCPYCITDFSE  231 (254)
Q Consensus       220 ~~C~~C~~~f~~  231 (254)
                      |+||.|+..+.-
T Consensus         3 ~~CP~CG~~iev   14 (54)
T TIGR01206         3 FECPDCGAEIEL   14 (54)
T ss_pred             cCCCCCCCEEec
Confidence            578888776543


No 219
>COG4957 Predicted transcriptional regulator [Transcription]
Probab=26.78  E-value=39  Score=23.09  Aligned_cols=23  Identities=30%  Similarity=0.335  Sum_probs=16.8

Q ss_pred             cccCCCCcccCCCHHHHHHHHHHhhc
Q psy12195        189 SYQCNECPESFERLNKLKRHKFQAHN  214 (254)
Q Consensus       189 ~~~C~~C~~~f~~~~~l~~H~~~~h~  214 (254)
                      ...|-++|+.|   .+|+||+..+++
T Consensus        76 ~IicLEDGkkf---KSLKRHL~t~~g   98 (148)
T COG4957          76 YIICLEDGKKF---KSLKRHLTTHYG   98 (148)
T ss_pred             eEEEeccCcch---HHHHHHHhcccC
Confidence            35788888888   568888875444


No 220
>PF04438 zf-HIT:  HIT zinc finger;  InterPro: IPR007529 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents the HIT-type zinc finger, which contains 7 conserved cysteines and one histidine that can potentially coordinate two zinc atoms. It has been named after the first protein that originally defined the domain: the yeast HIT1 protein (P46973 from SWISSPROT) []. The HIT-type zinc finger displays some sequence similarities to the MYND-type zinc finger. The function of this domain is unknown but it is mainly found in nuclear proteins involved in gene regulation and chromatin remodeling. This domain is also found in the thyroid receptor interacting protein 3 (TRIP-3) Q15649 from SWISSPROT, that specifically interacts with the ligand binding domain of the thyroid receptor. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 2YQP_A 2YQQ_A 1X4S_A.
Probab=26.71  E-value=62  Score=15.60  Aligned_cols=17  Identities=35%  Similarity=0.630  Sum_probs=9.4

Q ss_pred             eeeeecccccccCCCHH
Q psy12195         13 VVIIRCETCTRNYESLE   29 (254)
Q Consensus        13 ~~~~~C~~C~~~f~~~~   29 (254)
                      ...|+|+.|+..+-+..
T Consensus        11 ~~kY~Cp~C~~~~CSl~   27 (30)
T PF04438_consen   11 PAKYRCPRCGARYCSLA   27 (30)
T ss_dssp             EESEE-TTT--EESSHH
T ss_pred             CCEEECCCcCCceeCcE
Confidence            55688888887765544


No 221
>KOG4167|consensus
Probab=26.54  E-value=23  Score=31.56  Aligned_cols=21  Identities=19%  Similarity=0.510  Sum_probs=14.2

Q ss_pred             cccccccccccccHHHHHhHH
Q psy12195         75 IYECNQCKEKTNDMTTMLNHY   95 (254)
Q Consensus        75 ~~~C~~C~~~~~~~~~l~~h~   95 (254)
                      .|.|.+|+++|....++..||
T Consensus       792 iFpCreC~kvF~KiKSrNAHM  812 (907)
T KOG4167|consen  792 IFPCRECGKVFFKIKSRNAHM  812 (907)
T ss_pred             eeehHHHHHHHHHHhhhhHHH
Confidence            466777777776666666666


No 222
>cd00974 DSRD Desulforedoxin (DSRD) domain; a small non-heme iron domain present in the desulforedoxin (rubredoxin oxidoreductase) and desulfoferrodoxin proteins of some archeael and bacterial methanogens and sulfate/sulfur reducers. Desulforedoxin is a small, single-domain homodimeric protein; each subunit contains an iron atom bound to four cysteinyl sulfur atoms, Fe(S-Cys)4, in a distorted tetrahedral coordination. Its metal center is similar to that found in rubredoxin type proteins. Desulforedoxin is regarded as a potential redox partner for rubredoxin. Desulfoferrodoxin forms a homodimeric protein, with each protomer comprised of two domains, the N-terminal DSRD domain and C-terminal superoxide reductase-like (SORL) domain. Each domain has a distinct iron center: the DSRD iron center I, Fe(S-Cys)4; and the SORL iron center II, Fe[His4Cys(Glu)].
Probab=26.46  E-value=35  Score=16.84  Aligned_cols=11  Identities=27%  Similarity=0.800  Sum_probs=5.2

Q ss_pred             eeecccccccC
Q psy12195         15 IIRCETCTRNY   25 (254)
Q Consensus        15 ~~~C~~C~~~f   25 (254)
                      .|+|..|+...
T Consensus         4 ~ykC~~CGniv   14 (34)
T cd00974           4 VYKCEICGNIV   14 (34)
T ss_pred             EEEcCCCCcEE
Confidence            45555554443


No 223
>KOG2272|consensus
Probab=26.24  E-value=65  Score=24.73  Aligned_cols=76  Identities=14%  Similarity=0.307  Sum_probs=35.9

Q ss_pred             hhccCCCCcccccchhhccChHHHHHH---------HHhhhccCCCcccccccccccCCHHHHHHHHHhcCCcccccCCC
Q psy12195         97 VKHYMDINMSCVPCDVLFHNKATLYKH---------LYLEHKATSLSIQCNMCSLVLDSKESLVTHISQTHTLMFTCRRC  167 (254)
Q Consensus        97 ~~h~~~~~~~C~~C~~~f~~~~~l~~H---------~~~~~~~~~~~~~C~~C~~~f~~~~~l~~h~~~~~~~~~~C~~C  167 (254)
                      +......-|.|+.|.+...+..-++.-         .+...... -.|.|..|-..... ..|..-...-|.-.|+|..|
T Consensus        92 nnSwHp~CF~Cd~Cn~~Lad~gf~rnqgr~LC~~Cn~k~Ka~~~-g~YvC~KCh~~iD~-~~l~fr~d~yH~yHFkCt~C  169 (332)
T KOG2272|consen   92 NNSWHPACFRCDLCNKHLADQGFYRNQGRALCRECNQKEKAKGR-GRYVCQKCHAHIDE-QPLTFRGDPYHPYHFKCTTC  169 (332)
T ss_pred             ccccCcccchhHHHHHHHhhhhhHhhcchHHhhhhhhhhccccc-ceeehhhhhhhccc-ccccccCCCCCccceecccc
Confidence            334445557788887766655444321         11111111 14566666544332 22221111223345778888


Q ss_pred             cccCCCh
Q psy12195        168 PSTFLNS  174 (254)
Q Consensus       168 ~~~f~~~  174 (254)
                      ++.+.+.
T Consensus       170 ~keL~sd  176 (332)
T KOG2272|consen  170 GKELTSD  176 (332)
T ss_pred             cccccch
Confidence            8777654


No 224
>PRK01343 zinc-binding protein; Provisional
Probab=25.92  E-value=35  Score=19.50  Aligned_cols=11  Identities=27%  Similarity=0.679  Sum_probs=7.2

Q ss_pred             cccCCCCcccC
Q psy12195        189 SYQCNECPESF  199 (254)
Q Consensus       189 ~~~C~~C~~~f  199 (254)
                      ...|++|++.+
T Consensus         9 ~~~CP~C~k~~   19 (57)
T PRK01343          9 TRPCPECGKPS   19 (57)
T ss_pred             CCcCCCCCCcC
Confidence            35677777765


No 225
>COG2331 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=25.76  E-value=36  Score=20.63  Aligned_cols=10  Identities=30%  Similarity=1.142  Sum_probs=5.1

Q ss_pred             cccCCCcccC
Q psy12195        162 FTCRRCPSTF  171 (254)
Q Consensus       162 ~~C~~C~~~f  171 (254)
                      |.|..|+..|
T Consensus        13 Y~c~~cg~~~   22 (82)
T COG2331          13 YECTECGNRF   22 (82)
T ss_pred             EeecccchHH
Confidence            4555555544


No 226
>TIGR00595 priA primosomal protein N'. All proteins in this family for which functions are known are components of the primosome which is involved in replication, repair, and recombination.This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=25.70  E-value=47  Score=28.75  Aligned_cols=10  Identities=20%  Similarity=0.687  Sum_probs=4.8

Q ss_pred             CCcccCCCCc
Q psy12195        187 SKSYQCNECP  196 (254)
Q Consensus       187 ~~~~~C~~C~  196 (254)
                      .+...|..||
T Consensus       238 ~~~l~Ch~Cg  247 (505)
T TIGR00595       238 EGKLRCHYCG  247 (505)
T ss_pred             CCeEEcCCCc
Confidence            3444555555


No 227
>COG1998 RPS31 Ribosomal protein S27AE [Translation, ribosomal structure and biogenesis]
Probab=25.64  E-value=45  Score=18.35  Aligned_cols=8  Identities=25%  Similarity=1.066  Sum_probs=3.6

Q ss_pred             ccccCCCc
Q psy12195        161 MFTCRRCP  168 (254)
Q Consensus       161 ~~~C~~C~  168 (254)
                      .+.|..||
T Consensus        37 R~~CGkCg   44 (51)
T COG1998          37 RWACGKCG   44 (51)
T ss_pred             eeEecccc
Confidence            34444444


No 228
>PF03811 Zn_Tnp_IS1:  InsA N-terminal domain;  InterPro: IPR003220 Insertion elements are mobile elements in DNA, usually encoding proteins required for transposition, for example transposases. Protein InsA is absolutely required for transposition of insertion element 1. This entry represents a short zinc binding domain found in IS1 InsA family protein. It is found at the N terminus of the protein and may be a DNA-binding domain.; GO: 0006313 transposition, DNA-mediated
Probab=25.30  E-value=75  Score=16.15  Aligned_cols=12  Identities=25%  Similarity=0.714  Sum_probs=5.9

Q ss_pred             ccCcceeecCcC
Q psy12195         39 HSNQFLMKCTNC   50 (254)
Q Consensus        39 h~~~~~~~C~~C   50 (254)
                      ..+...|.|..|
T Consensus        24 ~~G~qryrC~~C   35 (36)
T PF03811_consen   24 PSGHQRYRCKDC   35 (36)
T ss_pred             CCCCEeEecCcC
Confidence            344445555554


No 229
>PTZ00448 hypothetical protein; Provisional
Probab=25.23  E-value=44  Score=27.27  Aligned_cols=25  Identities=12%  Similarity=0.376  Sum_probs=22.4

Q ss_pred             eeeecccccccCCCHHHHHhhhccc
Q psy12195         14 VIIRCETCTRNYESLESLTTHLSFK   38 (254)
Q Consensus        14 ~~~~C~~C~~~f~~~~~l~~H~~~~   38 (254)
                      ..|.|..|+..|.+....+.|+++.
T Consensus       313 ~~~tC~~C~v~F~~~~~qR~H~KSD  337 (373)
T PTZ00448        313 NMLLCRKCNIQLMDHNAFKQHYRSE  337 (373)
T ss_pred             CCccccccccccCCHHHHHHHhhhh
Confidence            4689999999999999999999974


No 230
>PF11672 DUF3268:  Protein of unknown function (DUF3268);  InterPro: IPR021686 This entry is represented by Listeria phage P100, Gp150. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches.
Probab=25.11  E-value=40  Score=21.95  Aligned_cols=9  Identities=33%  Similarity=0.648  Sum_probs=4.5

Q ss_pred             eeecccccc
Q psy12195         15 IIRCETCTR   23 (254)
Q Consensus        15 ~~~C~~C~~   23 (254)
                      +-.|+.||.
T Consensus         2 p~~CpYCg~   10 (102)
T PF11672_consen    2 PIICPYCGG   10 (102)
T ss_pred             CcccCCCCC
Confidence            344555554


No 231
>PLN02294 cytochrome c oxidase subunit Vb
Probab=24.82  E-value=36  Score=24.36  Aligned_cols=15  Identities=40%  Similarity=0.979  Sum_probs=11.6

Q ss_pred             CCCcccCCCCcccCC
Q psy12195        186 NSKSYQCNECPESFE  200 (254)
Q Consensus       186 ~~~~~~C~~C~~~f~  200 (254)
                      ..+|+.|++||..|.
T Consensus       138 kGkp~RCpeCG~~fk  152 (174)
T PLN02294        138 KGKSFECPVCTQYFE  152 (174)
T ss_pred             CCCceeCCCCCCEEE
Confidence            347888999998775


No 232
>KOG2857|consensus
Probab=24.66  E-value=38  Score=23.32  Aligned_cols=25  Identities=28%  Similarity=0.542  Sum_probs=22.1

Q ss_pred             ceeeeecccccccCCCHHHHHhhhc
Q psy12195         12 KVVIIRCETCTRNYESLESLTTHLS   36 (254)
Q Consensus        12 ~~~~~~C~~C~~~f~~~~~l~~H~~   36 (254)
                      .+.-|+|+.|..-|-+...|+.|..
T Consensus        14 ~~~KYKCpkC~vPYCSl~CfKiHk~   38 (157)
T KOG2857|consen   14 SEIKYKCPKCSVPYCSLPCFKIHKS   38 (157)
T ss_pred             chhhccCCCCCCccccchhhhhccC
Confidence            3457999999999999999999976


No 233
>cd00162 RING RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H)
Probab=24.66  E-value=1.1e+02  Score=15.31  Aligned_cols=8  Identities=50%  Similarity=1.161  Sum_probs=4.5

Q ss_pred             ccCcchhh
Q psy12195        220 IQCPYCIT  227 (254)
Q Consensus       220 ~~C~~C~~  227 (254)
                      ..||.|..
T Consensus        36 ~~Cp~C~~   43 (45)
T cd00162          36 NTCPLCRT   43 (45)
T ss_pred             CCCCCCCC
Confidence            44666654


No 234
>PRK00420 hypothetical protein; Validated
Probab=24.00  E-value=58  Score=21.63  Aligned_cols=9  Identities=11%  Similarity=0.220  Sum_probs=4.1

Q ss_pred             cccCCCccc
Q psy12195        162 FTCRRCPST  170 (254)
Q Consensus       162 ~~C~~C~~~  170 (254)
                      ..|+.||..
T Consensus        41 ~~Cp~Cg~~   49 (112)
T PRK00420         41 VVCPVHGKV   49 (112)
T ss_pred             eECCCCCCe
Confidence            344444443


No 235
>PF14803 Nudix_N_2:  Nudix N-terminal; PDB: 3CNG_C.
Probab=23.93  E-value=8.6  Score=19.30  Aligned_cols=12  Identities=25%  Similarity=0.531  Sum_probs=6.1

Q ss_pred             CCCccCcchhhc
Q psy12195        217 VHQIQCPYCITD  228 (254)
Q Consensus       217 ~~~~~C~~C~~~  228 (254)
                      ...+.|+.|+..
T Consensus        20 r~R~vC~~Cg~I   31 (34)
T PF14803_consen   20 RERLVCPACGFI   31 (34)
T ss_dssp             S-EEEETTTTEE
T ss_pred             ccceECCCCCCE
Confidence            344566666643


No 236
>PRK12387 formate hydrogenlyase complex iron-sulfur subunit; Provisional
Probab=23.83  E-value=34  Score=24.87  Aligned_cols=17  Identities=18%  Similarity=0.466  Sum_probs=10.3

Q ss_pred             CcccCCCCcccCCCHHH
Q psy12195        188 KSYQCNECPESFERLNK  204 (254)
Q Consensus       188 ~~~~C~~C~~~f~~~~~  204 (254)
                      .++.|..||+.|.....
T Consensus       113 ~~~~C~~CG~~f~~~~~  129 (180)
T PRK12387        113 ALCNCRVCGRPFAVQKE  129 (180)
T ss_pred             CcccchhhCCccccHHH
Confidence            45567777776665543


No 237
>PLN03239 histone acetyltransferase; Provisional
Probab=23.68  E-value=85  Score=25.57  Aligned_cols=24  Identities=17%  Similarity=0.174  Sum_probs=21.5

Q ss_pred             eeeeecccccccCCCHHHHHhhhc
Q psy12195         13 VVIIRCETCTRNYESLESLTTHLS   36 (254)
Q Consensus        13 ~~~~~C~~C~~~f~~~~~l~~H~~   36 (254)
                      +..|.|..|-+-|.+...|..|+.
T Consensus       104 ~~lYiCE~Clky~~~~~~l~~H~~  127 (351)
T PLN03239        104 DVLYVCEFSFGFFARKSELLRFQA  127 (351)
T ss_pred             ceEEEeccchhhhcCHHHHHHHHH
Confidence            679999999999999999998875


No 238
>PF09963 DUF2197:  Uncharacterized protein conserved in bacteria (DUF2197);  InterPro: IPR019241  This family represents various hypothetical bacterial proteins with no known function. 
Probab=23.63  E-value=19  Score=20.43  Aligned_cols=38  Identities=29%  Similarity=0.539  Sum_probs=19.9

Q ss_pred             eecCcCCcccCCCCccchhhhhccCCCCCCcccccccccc
Q psy12195         45 MKCTNCNVLVPRDEILPHLSIQHCQGTTPSIYECNQCKEK   84 (254)
Q Consensus        45 ~~C~~C~~~~~~~~~l~~~~~~h~~~~~~~~~~C~~C~~~   84 (254)
                      ++|..|++.+.-.+......+...  .....|-|..|...
T Consensus         3 vkC~lCdk~~~Id~~~~~aKrLrn--rPi~tYmC~eC~~R   40 (56)
T PF09963_consen    3 VKCILCDKKEEIDEDTPEAKRLRN--RPIHTYMCDECKER   40 (56)
T ss_pred             eEEEecCCEEEeccCCHHHHHhhc--CCCcceeChhHHHH
Confidence            567778776655443332221110  24456778888544


No 239
>PRK14714 DNA polymerase II large subunit; Provisional
Probab=23.55  E-value=1e+02  Score=29.86  Aligned_cols=12  Identities=25%  Similarity=0.509  Sum_probs=8.5

Q ss_pred             eeeecccccccC
Q psy12195         14 VIIRCETCTRNY   25 (254)
Q Consensus        14 ~~~~C~~C~~~f   25 (254)
                      ..++||.||...
T Consensus       666 ~~rkCPkCG~~t  677 (1337)
T PRK14714        666 GRRRCPSCGTET  677 (1337)
T ss_pred             EEEECCCCCCcc
Confidence            357788888754


No 240
>PF04606 Ogr_Delta:  Ogr/Delta-like zinc finger;  InterPro: IPR007684 This entry is represented by Bacteriophage P2, Ogr. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches. This is a viral family of phage zinc-binding transcriptional activators, which also contains cryptic members in some bacterial genomes []. The P4 phage delta protein contains two such domains attached covalently, while the P2 phage Ogr proteins possess one domain but function as dimers. All the members of this family have the following consensus sequence: C-X(2)-C-X(3)-A-(X)2-R-X(15)-C-X(4)-C-X(3)-F [].; GO: 0006355 regulation of transcription, DNA-dependent
Probab=23.41  E-value=12  Score=20.32  Aligned_cols=6  Identities=33%  Similarity=1.066  Sum_probs=2.4

Q ss_pred             cccchh
Q psy12195        107 CVPCDV  112 (254)
Q Consensus       107 C~~C~~  112 (254)
                      ||.||.
T Consensus         2 CP~Cg~    7 (47)
T PF04606_consen    2 CPHCGS    7 (47)
T ss_pred             cCCCCC
Confidence            344433


No 241
>PF14634 zf-RING_5:  zinc-RING finger domain
Probab=23.19  E-value=76  Score=16.64  Aligned_cols=8  Identities=38%  Similarity=1.343  Sum_probs=4.6

Q ss_pred             CccCcchh
Q psy12195        219 QIQCPYCI  226 (254)
Q Consensus       219 ~~~C~~C~  226 (254)
                      ...||+|+
T Consensus        36 ~~~CP~C~   43 (44)
T PF14634_consen   36 SVKCPICR   43 (44)
T ss_pred             CCCCcCCC
Confidence            45566665


No 242
>KOG3002|consensus
Probab=22.57  E-value=1.3e+02  Score=24.07  Aligned_cols=79  Identities=19%  Similarity=0.380  Sum_probs=44.6

Q ss_pred             cccccccccccCCHHHHHHHHHhcCCcccccC----CCcccCCChHHHHHHHhHhhCCCcccCCCCccc--C-CCHHHHH
Q psy12195        134 SIQCNMCSLVLDSKESLVTHISQTHTLMFTCR----RCPSTFLNSATLSKHVKMEHNSKSYQCNECPES--F-ERLNKLK  206 (254)
Q Consensus       134 ~~~C~~C~~~f~~~~~l~~h~~~~~~~~~~C~----~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~--f-~~~~~l~  206 (254)
                      ..+|+.|...+.+...+..-.. .......|+    .|.+.|..... ..|.+.... +||.||+=|-.  + .....|.
T Consensus        80 ~~~CP~Cr~~~g~~R~~amEkV-~e~~~vpC~~~~~GC~~~~~Y~~~-~~HE~~C~f-~~~~CP~p~~~C~~~G~~~~l~  156 (299)
T KOG3002|consen   80 SNKCPTCRLPIGNIRCRAMEKV-AEAVLVPCKNAKLGCTKSFPYGEK-SKHEKVCEF-RPCSCPVPGAECKYTGSYKDLY  156 (299)
T ss_pred             cccCCccccccccHHHHHHHHH-HHhceecccccccCCceeeccccc-ccccccccc-CCcCCCCCcccCCccCcHHHHH
Confidence            4568888777765544332221 222344454    47777765544 555555555 77888776322  2 2345677


Q ss_pred             HHHHHhhcC
Q psy12195        207 RHKFQAHND  215 (254)
Q Consensus       207 ~H~~~~h~~  215 (254)
                      .|....|..
T Consensus       157 ~H~~~~hk~  165 (299)
T KOG3002|consen  157 AHLNDTHKS  165 (299)
T ss_pred             HHHHhhChh
Confidence            787766655


No 243
>KOG4727|consensus
Probab=22.47  E-value=48  Score=23.73  Aligned_cols=23  Identities=17%  Similarity=0.310  Sum_probs=19.6

Q ss_pred             CcccCCCCcccCCCHHHHHHHHH
Q psy12195        188 KSYQCNECPESFERLNKLKRHKF  210 (254)
Q Consensus       188 ~~~~C~~C~~~f~~~~~l~~H~~  210 (254)
                      .-|.|.+|+-.|....+++.|+.
T Consensus        74 ~GyyCdVCdcvvKDSinflDHiN   96 (193)
T KOG4727|consen   74 GGYYCDVCDCVVKDSINFLDHIN   96 (193)
T ss_pred             CceeeeecceeehhhHHHHHHhc
Confidence            45889999999999999999873


No 244
>PF01155 HypA:  Hydrogenase expression/synthesis hypA family;  InterPro: IPR000688 Bacterial membrane-bound nickel-dependent hydrogenases requires a number of accessory proteins which are involved in their maturation. The exact role of these proteins is not yet clear, but some seem to be required for the incorporation of the nickel ions []. One of these proteins is generally known as hypA. It is a protein of about 12 to 14 kDa that contains, in its C-terminal region, four conserved cysteines that form a zinc-finger like motif. Escherichia coli has two proteins that belong to this family, hypA and hybF. A homologue, MJ0214, has also been found in a number of archaeal species, including the genome of Methanocaldococcus jannaschii (Methanococcus jannaschii).; GO: 0016151 nickel ion binding, 0006464 protein modification process; PDB: 2KDX_A 3A44_D 3A43_B.
Probab=22.34  E-value=25  Score=23.32  Aligned_cols=11  Identities=36%  Similarity=0.824  Sum_probs=5.3

Q ss_pred             cccCCCcccCC
Q psy12195        162 FTCRRCPSTFL  172 (254)
Q Consensus       162 ~~C~~C~~~f~  172 (254)
                      ..|..||..|.
T Consensus        71 ~~C~~Cg~~~~   81 (113)
T PF01155_consen   71 ARCRDCGHEFE   81 (113)
T ss_dssp             EEETTTS-EEE
T ss_pred             EECCCCCCEEe
Confidence            44555555554


No 245
>PF06220 zf-U1:  U1 zinc finger;  InterPro: IPR013085 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  C2H2-type (classical) zinc fingers (Znf) were the first class to be characterised. They contain a short beta hairpin and an alpha helix (beta/beta/alpha structure), where a single zinc atom is held in place by Cys(2)His(2) (C2H2) residues in a tetrahedral array. C2H2 Znf's can be divided into three groups based on the number and pattern of fingers: triple-C2H2 (binds single ligand), multiple-adjacent-C2H2 (binds multiple ligands), and separated paired-C2H2 []. C2H2 Znf's are the most common DNA-binding motifs found in eukaryotic transcription factors, and have also been identified in prokaryotes []. Transcription factors usually contain several Znf's (each with a conserved beta/beta/alpha structure) capable of making multiple contacts along the DNA, where the C2H2 Znf motifs recognise DNA sequences by binding to the major groove of DNA via a short alpha-helix in the Znf, the Znf spanning 3-4 bases of the DNA []. C2H2 Znf's can also bind to RNA and protein targets []. This entry represents a C2H2-type zinc finger motif found in several U1 small nuclear ribonucleoprotein C (U1-C) proteins. Some proteins contain multiple copies of this motif. The U1 small nuclear ribonucleoprotein (U1 snRNP) binds to the pre-mRNA 5' splice site at early stages of spliceosome assembly. Recruitment of U1 to a class of weak 5' splice site is promoted by binding of the protein TIA-1 to uridine-rich sequences immediately downstream from the 5' splice site. Binding of TIA-1 in the vicinity of a 5' splice site helps to stabilise U1 snRNP recruitment, at least in part, via a direct interaction with U1-C, thus providing one molecular mechanism for the function of this splicing regulator []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 2VRD_A.
Probab=22.01  E-value=1e+02  Score=15.85  Aligned_cols=11  Identities=27%  Similarity=0.881  Sum_probs=3.4

Q ss_pred             cccCCCCcccC
Q psy12195        189 SYQCNECPESF  199 (254)
Q Consensus       189 ~~~C~~C~~~f  199 (254)
                      .|-|.+|+..|
T Consensus         3 ryyCdyC~~~~   13 (38)
T PF06220_consen    3 RYYCDYCKKYL   13 (38)
T ss_dssp             S-B-TTT--B-
T ss_pred             Ceeccccccee
Confidence            35566666666


No 246
>PF03833 PolC_DP2:  DNA polymerase II large subunit DP2;  InterPro: IPR016033 DP2 is the large subunit of a two-subunit novel archaebacterial replicative DNA polymerase first characterised for Pyrococcus furiosus. The structure of DP2 appears to be organised as a ~950 residue component separated from a ~300 residue component by a ~150 residue intein. The other subunit, DP1, has sequence similarity to the eukaryotic DNA polymerase delta small subunit. This entry represents the N-terminal ~950 residue component of DP2.; GO: 0003887 DNA-directed DNA polymerase activity; PDB: 3O59_X.
Probab=21.97  E-value=30  Score=31.61  Aligned_cols=10  Identities=30%  Similarity=0.916  Sum_probs=0.0

Q ss_pred             cCcchhhccC
Q psy12195        221 QCPYCITDFS  230 (254)
Q Consensus       221 ~C~~C~~~f~  230 (254)
                      .|+.|+....
T Consensus       694 ~C~~C~~~~~  703 (900)
T PF03833_consen  694 ECPKCGRETT  703 (900)
T ss_dssp             ----------
T ss_pred             ccccccccCc
Confidence            4666665433


No 247
>PF14255 Cys_rich_CPXG:  Cysteine-rich CPXCG
Probab=21.63  E-value=45  Score=18.65  Aligned_cols=9  Identities=44%  Similarity=0.944  Sum_probs=5.8

Q ss_pred             cCCCCcccC
Q psy12195        191 QCNECPESF  199 (254)
Q Consensus       191 ~C~~C~~~f  199 (254)
                      .||+||..+
T Consensus         2 ~CPyCge~~   10 (52)
T PF14255_consen    2 QCPYCGEPI   10 (52)
T ss_pred             CCCCCCCee
Confidence            577777655


No 248
>PF07295 DUF1451:  Protein of unknown function (DUF1451);  InterPro: IPR009912 This family consists of several hypothetical bacterial proteins of around 160 residues in length. Members of this family contain four highly conserved cysteine resides toward the C-terminal region of the protein. The function of this family is unknown.
Probab=21.57  E-value=66  Score=22.56  Aligned_cols=8  Identities=38%  Similarity=1.090  Sum_probs=4.6

Q ss_pred             eecCcCCc
Q psy12195         45 MKCTNCNV   52 (254)
Q Consensus        45 ~~C~~C~~   52 (254)
                      |.|..||.
T Consensus       113 l~C~~Cg~  120 (146)
T PF07295_consen  113 LVCENCGH  120 (146)
T ss_pred             EecccCCC
Confidence            56666653


No 249
>PF01286 XPA_N:  XPA protein N-terminal;  InterPro: IPR022652 Xeroderma pigmentosum (XP) [] is a human autosomal recessive disease, characterised by a high incidence of sunlight-induced skin cancer. Skin cells of individual's with this condition are hypersensitive to ultraviolet light, due to defects in the incision step of DNA excision repair. There are a minimum of seven genetic complementation groups involved in this pathway: XP-A to XP-G. XP-A is the most severe form of the disease and is due to defects in a 30 kDa nuclear protein called XPA (or XPAC) []. The sequence of the XPA protein is conserved from higher eukaryotes [] to yeast (gene RAD14) []. XPA is a hydrophilic protein of 247 to 296 amino-acid residues which has a C4-type zinc finger motif in its central section. This entry contains the zinc-finger containing region in the XPA protein. It is found N-terminal to PF05181 from PFAM ; PDB: 1D4U_A 1XPA_A.
Probab=21.54  E-value=58  Score=16.36  Aligned_cols=17  Identities=24%  Similarity=0.436  Sum_probs=8.8

Q ss_pred             eecCcCCcccCCCCccc
Q psy12195         45 MKCTNCNVLVPRDEILP   61 (254)
Q Consensus        45 ~~C~~C~~~~~~~~~l~   61 (254)
                      -.|..|++.|...-.+.
T Consensus         4 ~~C~eC~~~f~dSyL~~   20 (34)
T PF01286_consen    4 PKCDECGKPFMDSYLLN   20 (34)
T ss_dssp             EE-TTT--EES-SSCCC
T ss_pred             chHhHhCCHHHHHHHHH
Confidence            36888888887775443


No 250
>PF12156 ATPase-cat_bd:  Putative metal-binding domain of cation transport ATPase;  InterPro: IPR021993  This domain is found in bacteria, and is approximately 90 amino acids in length. It is found associated with PF00403 from PFAM, PF00122 from PFAM, PF00702 from PFAM. The cysteine-rich nature and composition suggest this might be a cation-binding domain; most members are annotated as being cation transport ATPases. 
Probab=21.22  E-value=39  Score=21.24  Aligned_cols=36  Identities=19%  Similarity=0.414  Sum_probs=21.1

Q ss_pred             ecCcCCcccCCCCccchhhhhccCCCCCCcccccccccccc
Q psy12195         46 KCTNCNVLVPRDEILPHLSIQHCQGTTPSIYECNQCKEKTN   86 (254)
Q Consensus        46 ~C~~C~~~~~~~~~l~~~~~~h~~~~~~~~~~C~~C~~~~~   86 (254)
                      .|..||..++....+.....     .....|-|..|..++.
T Consensus         2 ~C~HCg~~~p~~~~~~~~~~-----g~~~~FCC~GC~~V~~   37 (88)
T PF12156_consen    2 KCYHCGLPVPEGAKITVEID-----GEERPFCCPGCQAVYQ   37 (88)
T ss_pred             CCCCCCCCCCCCCCeeeeeC-----CCccccccHHHHHHHH
Confidence            47777777764443332221     3456788888865543


No 251
>PTZ00448 hypothetical protein; Provisional
Probab=20.73  E-value=68  Score=26.28  Aligned_cols=24  Identities=21%  Similarity=0.391  Sum_probs=19.8

Q ss_pred             CccCcchhhccCCchHHHHHHHHh
Q psy12195        219 QIQCPYCITDFSEDKNLIQHIVSV  242 (254)
Q Consensus       219 ~~~C~~C~~~f~~~~~l~~H~~~~  242 (254)
                      .|.|..|+..|.+......|+++.
T Consensus       314 ~~tC~~C~v~F~~~~~qR~H~KSD  337 (373)
T PTZ00448        314 MLLCRKCNIQLMDHNAFKQHYRSE  337 (373)
T ss_pred             CccccccccccCCHHHHHHHhhhh
Confidence            588999999998888888887553


No 252
>KOG3214|consensus
Probab=20.43  E-value=41  Score=21.62  Aligned_cols=14  Identities=21%  Similarity=0.560  Sum_probs=9.5

Q ss_pred             ccCcchhhccCCch
Q psy12195        220 IQCPYCITDFSEDK  233 (254)
Q Consensus       220 ~~C~~C~~~f~~~~  233 (254)
                      ..|.+|+.+|.+.-
T Consensus        48 ~sC~iC~esFqt~i   61 (109)
T KOG3214|consen   48 ASCRICEESFQTTI   61 (109)
T ss_pred             eeeeehhhhhccch
Confidence            45777877777643


No 253
>PF13821 DUF4187:  Domain of unknown function (DUF4187)
Probab=20.25  E-value=1e+02  Score=17.48  Aligned_cols=17  Identities=24%  Similarity=0.731  Sum_probs=11.6

Q ss_pred             cCcchhhccCCchHHHH
Q psy12195        221 QCPYCITDFSEDKNLIQ  237 (254)
Q Consensus       221 ~C~~C~~~f~~~~~l~~  237 (254)
                      -|-.||..|.+...|..
T Consensus        29 YC~~Cg~~Y~d~~dL~~   45 (55)
T PF13821_consen   29 YCFWCGTKYDDEEDLER   45 (55)
T ss_pred             eeeeeCCccCCHHHHHh
Confidence            37777777777776643


No 254
>PTZ00064 histone acetyltransferase; Provisional
Probab=20.23  E-value=1.2e+02  Score=26.19  Aligned_cols=26  Identities=27%  Similarity=0.314  Sum_probs=23.5

Q ss_pred             ceeeeecccccccCCCHHHHHhhhcc
Q psy12195         12 KVVIIRCETCTRNYESLESLTTHLSF   37 (254)
Q Consensus        12 ~~~~~~C~~C~~~f~~~~~l~~H~~~   37 (254)
                      -+..|.|..|-+-|.+...|.+|+..
T Consensus       277 ~d~LYICEfCLkY~~s~~~l~rH~~~  302 (552)
T PTZ00064        277 VDTLHFCEYCLDFFCFEDELIRHLSR  302 (552)
T ss_pred             CCeEEEccchhhhhCCHHHHHHHHhc
Confidence            47899999999999999999999874


No 255
>PF10263 SprT-like:  SprT-like family;  InterPro: IPR006640 This is a family of uncharacterised bacterial proteins which includes Escherichia coli SprT (P39902 from SWISSPROT). SprT is described as a regulator of bolA gene in stationary phase []. The majority of members contain the metallopeptidase zinc binding signature which has a HExxH motif, however there is no evidence for them being metallopeptidases. 
Probab=20.11  E-value=29  Score=24.36  Aligned_cols=11  Identities=27%  Similarity=1.050  Sum_probs=6.0

Q ss_pred             cccCCCCcccC
Q psy12195        189 SYQCNECPESF  199 (254)
Q Consensus       189 ~~~C~~C~~~f  199 (254)
                      .|.|+.|+..+
T Consensus       123 ~~~C~~C~~~~  133 (157)
T PF10263_consen  123 VYRCPSCGREY  133 (157)
T ss_pred             EEEcCCCCCEe
Confidence            45566666544


Done!