Query         psy12196
Match_columns 150
No_of_seqs    128 out of 1347
Neff          11.7
Searched_HMMs 46136
Date          Fri Aug 16 21:17:26 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy12196.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/12196hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG2462|consensus              100.0 4.5E-36 9.7E-41  185.5   5.6  138    1-141   131-269 (279)
  2 KOG2462|consensus              100.0 2.8E-29 6.2E-34  155.5   5.7  116   29-148   129-248 (279)
  3 KOG3608|consensus               99.8 8.9E-21 1.9E-25  121.7   7.1  105    3-108   210-315 (467)
  4 KOG3608|consensus               99.8 5.5E-20 1.2E-24  118.1   8.1  139    1-144   238-381 (467)
  5 KOG1074|consensus               99.8 9.2E-22   2E-26  137.6  -0.0   53    1-55    354-406 (958)
  6 KOG3576|consensus               99.8   5E-20 1.1E-24  110.0   3.8  116   28-144   115-241 (267)
  7 KOG1074|consensus               99.8 5.9E-20 1.3E-24  128.8   2.3   77    2-81    607-692 (958)
  8 KOG3623|consensus               99.7 2.1E-18 4.5E-23  119.8   3.0  105    2-106   212-330 (1007)
  9 KOG3623|consensus               99.7 3.1E-17 6.6E-22  114.2   2.2   79   55-135   892-970 (1007)
 10 KOG3576|consensus               99.7 2.2E-17 4.9E-22   98.8   1.1   85   56-142   116-200 (267)
 11 PLN03086 PRLI-interacting fact  99.4 9.4E-13   2E-17   91.5   6.2  104   30-141   453-566 (567)
 12 PHA00733 hypothetical protein   99.4 7.9E-13 1.7E-17   75.9   3.6   84   53-140    36-124 (128)
 13 PHA00733 hypothetical protein   99.2 4.4E-11 9.5E-16   68.8   3.9   82   27-110    37-124 (128)
 14 PLN03086 PRLI-interacting fact  99.1 1.1E-10 2.3E-15   81.5   5.5  124    3-147   410-545 (567)
 15 PHA02768 hypothetical protein;  99.1 2.5E-11 5.3E-16   58.3   1.3   42   86-131     6-47  (55)
 16 PHA02768 hypothetical protein;  99.1 3.8E-11 8.2E-16   57.7   1.8   44   57-102     5-48  (55)
 17 PHA00616 hypothetical protein   99.0 1.4E-10 3.1E-15   53.0   2.2   32  115-146     1-32  (44)
 18 KOG3993|consensus               98.9 3.1E-10 6.6E-15   75.5  -0.1   78    1-81    268-380 (500)
 19 PF13465 zf-H2C2_2:  Zinc-finge  98.8   2E-09 4.2E-14   44.4   1.7   24   73-96      2-25  (26)
 20 PF05605 zf-Di19:  Drought indu  98.8 2.5E-08 5.4E-13   48.8   4.4   53   85-140     2-54  (54)
 21 PF13465 zf-H2C2_2:  Zinc-finge  98.7 4.6E-09   1E-13   43.3   1.0   26  100-127     1-26  (26)
 22 KOG3993|consensus               98.7 1.2E-08 2.5E-13   68.2   2.5  107   31-139   268-380 (500)
 23 PF05605 zf-Di19:  Drought indu  98.6 7.7E-08 1.7E-12   47.0   4.3   48    1-51      3-50  (54)
 24 PHA00616 hypothetical protein   98.6 1.7E-08 3.7E-13   46.3   1.7   32   57-88      1-32  (44)
 25 PHA00732 hypothetical protein   98.6 2.8E-08 6.1E-13   52.2   1.8   46   57-108     1-47  (79)
 26 PHA00732 hypothetical protein   98.5 1.6E-07 3.4E-12   49.4   2.7   37   31-68      2-38  (79)
 27 PF00096 zf-C2H2:  Zinc finger,  98.4 9.1E-08   2E-12   38.2   0.9   23  116-138     1-23  (23)
 28 PF13894 zf-C2H2_4:  C2H2-type   98.3 3.6E-07 7.7E-12   36.8   1.4   24  116-139     1-24  (24)
 29 PF00096 zf-C2H2:  Zinc finger,  98.2 7.4E-07 1.6E-11   35.5   1.5   22    1-22      1-22  (23)
 30 PF12756 zf-C2H2_2:  C2H2 type   98.2 1.2E-06 2.6E-11   48.4   2.3   73    2-80      1-73  (100)
 31 PF13894 zf-C2H2_4:  C2H2-type   98.1   2E-06 4.3E-11   34.5   1.7   24    1-24      1-24  (24)
 32 PF13912 zf-C2H2_6:  C2H2-type   98.1 6.7E-07 1.4E-11   37.1  -0.0   25  115-139     1-25  (27)
 33 PF09237 GAGA:  GAGA factor;  I  98.0 3.5E-06 7.6E-11   39.5   2.0   31  114-144    23-53  (54)
 34 PF12756 zf-C2H2_2:  C2H2 type   98.0 2.8E-06   6E-11   47.0   1.3   73   59-138     1-73  (100)
 35 smart00355 ZnF_C2H2 zinc finge  97.8 2.6E-05 5.6E-10   31.6   2.2   23  116-138     1-23  (26)
 36 COG5189 SFP1 Putative transcri  97.7 1.1E-05 2.3E-10   52.7   0.7   69   55-135   347-418 (423)
 37 PF13909 zf-H2C2_5:  C2H2-type   97.7 2.1E-05 4.5E-10   31.5   1.2   24  116-140     1-24  (24)
 38 PF13912 zf-C2H2_6:  C2H2-type   97.7 3.2E-05 6.8E-10   31.9   1.5   19   59-77      3-21  (27)
 39 COG5189 SFP1 Putative transcri  97.6 2.6E-05 5.6E-10   50.9   0.9   25  115-139   349-375 (423)
 40 smart00355 ZnF_C2H2 zinc finge  97.6 0.00012 2.5E-09   29.6   2.6   22    1-22      1-22  (26)
 41 KOG2231|consensus               97.4 0.00063 1.4E-08   49.3   6.3  134    2-144   101-272 (669)
 42 PF12874 zf-met:  Zinc-finger o  97.4 3.8E-05 8.3E-10   31.1   0.1   23  116-138     1-23  (25)
 43 PF13909 zf-H2C2_5:  C2H2-type   97.4 0.00017 3.6E-09   28.8   1.7   23    1-24      1-23  (24)
 44 PF09237 GAGA:  GAGA factor;  I  97.3 0.00029 6.3E-09   33.2   2.5   30   56-85     23-52  (54)
 45 PF12171 zf-C2H2_jaz:  Zinc-fin  96.9 8.8E-05 1.9E-09   30.6  -1.1   22  116-137     2-23  (27)
 46 PRK04860 hypothetical protein;  96.9 0.00047   1E-08   41.4   1.5   38   85-128   119-156 (160)
 47 PRK04860 hypothetical protein;  96.9 0.00036 7.8E-09   41.9   1.0   28  115-146   119-146 (160)
 48 PF12874 zf-met:  Zinc-finger o  96.8  0.0011 2.3E-08   26.6   1.6   19   60-78      3-21  (25)
 49 PF12171 zf-C2H2_jaz:  Zinc-fin  96.6 0.00082 1.8E-08   27.6   0.6   21    1-21      2-22  (27)
 50 PF13913 zf-C2HC_2:  zinc-finge  96.2  0.0069 1.5E-07   24.4   2.3   19    2-21      4-22  (25)
 51 KOG1146|consensus               96.1  0.0015 3.2E-08   50.6   0.1   51   56-106   464-539 (1406)
 52 smart00451 ZnF_U1 U1-like zinc  95.7  0.0052 1.1E-07   26.8   1.0   24  115-138     3-26  (35)
 53 COG5236 Uncharacterized conser  95.6   0.022 4.8E-07   38.3   3.9  125    1-140   152-306 (493)
 54 TIGR00622 ssl1 transcription f  95.5    0.02 4.3E-07   32.2   2.7   25  115-139    81-105 (112)
 55 cd00350 rubredoxin_like Rubred  94.9   0.012 2.7E-07   25.4   0.7    9  115-123    17-25  (33)
 56 KOG2482|consensus               94.8    0.11 2.3E-06   35.1   5.1   51   87-137   281-356 (423)
 57 KOG1146|consensus               94.6   0.016 3.6E-07   45.3   1.2   58   81-138   461-541 (1406)
 58 COG4049 Uncharacterized protei  94.5   0.029 6.4E-07   27.0   1.6   25  115-139    17-41  (65)
 59 KOG2231|consensus               93.5    0.15 3.3E-06   37.7   4.2   98   38-139   122-236 (669)
 60 KOG2893|consensus               93.1    0.03 6.4E-07   35.7   0.2   40   60-103    13-52  (341)
 61 KOG4173|consensus               92.5   0.061 1.3E-06   33.5   1.0   79   58-139    80-170 (253)
 62 KOG2482|consensus               92.1     0.3 6.5E-06   33.1   3.8   50   58-107   280-356 (423)
 63 KOG2186|consensus               91.5    0.13 2.8E-06   33.2   1.6   45    1-50      4-48  (276)
 64 KOG4173|consensus               91.2    0.13 2.9E-06   32.1   1.4   77   31-109    80-170 (253)
 65 PF10571 UPF0547:  Uncharacteri  91.1    0.13 2.8E-06   20.9   0.9    9   59-67     16-24  (26)
 66 COG4049 Uncharacterized protei  91.0    0.16 3.4E-06   24.6   1.3   21    2-22     19-39  (65)
 67 COG5048 FOG: Zn-finger [Genera  90.8   0.045 9.7E-07   38.1  -1.0   58   85-144   289-352 (467)
 68 PF12907 zf-met2:  Zinc-binding  90.2    0.24 5.2E-06   22.4   1.4   33  116-148     2-38  (40)
 69 KOG2893|consensus               90.0   0.075 1.6E-06   33.9  -0.4   49   87-141    12-60  (341)
 70 PF05443 ROS_MUCR:  ROS/MUCR tr  89.9    0.21 4.6E-06   29.2   1.4   26  115-143    72-97  (132)
 71 PF09538 FYDLN_acid:  Protein o  89.7    0.26 5.7E-06   27.7   1.7   29   32-70     11-39  (108)
 72 COG1592 Rubrerythrin [Energy p  89.6     0.2 4.4E-06   30.4   1.3   24   84-122   133-156 (166)
 73 cd00729 rubredoxin_SM Rubredox  89.6    0.18   4E-06   21.9   0.8   10   86-95      3-12  (34)
 74 PF15269 zf-C2H2_7:  Zinc-finge  89.5    0.28   6E-06   22.6   1.4   29  110-138    15-43  (54)
 75 TIGR02098 MJ0042_CXXC MJ0042 f  89.4    0.15 3.4E-06   22.6   0.5   32   32-67      4-35  (38)
 76 COG2888 Predicted Zn-ribbon RN  89.4    0.18   4E-06   24.7   0.8    9   56-64     26-34  (61)
 77 PF12013 DUF3505:  Protein of u  89.2     1.1 2.3E-05   25.2   3.9   26  115-140    80-109 (109)
 78 smart00734 ZnF_Rad18 Rad18-lik  88.7    0.36 7.9E-06   19.5   1.3   20  117-137     3-22  (26)
 79 PF12013 DUF3505:  Protein of u  88.7     0.3 6.6E-06   27.4   1.5   26   85-110    80-109 (109)
 80 COG5236 Uncharacterized conser  88.7     1.4   3E-05   30.1   4.7   22    3-24    223-244 (493)
 81 PHA00626 hypothetical protein   88.6   0.081 1.8E-06   25.6  -0.7   11   86-96     24-34  (59)
 82 smart00614 ZnF_BED BED zinc fi  88.6    0.37 8.1E-06   22.9   1.6   24  116-139    19-47  (50)
 83 PF09986 DUF2225:  Uncharacteri  88.5   0.063 1.4E-06   34.2  -1.5   13  116-128    49-61  (214)
 84 TIGR02605 CxxC_CxxC_SSSS putat  88.3    0.13 2.9E-06   24.6  -0.1   29   86-123     6-34  (52)
 85 smart00659 RPOLCX RNA polymera  87.7    0.26 5.7E-06   22.8   0.7   11   86-96      3-13  (44)
 86 TIGR00373 conserved hypothetic  87.2    0.76 1.6E-05   27.8   2.7   34   82-126   106-139 (158)
 87 smart00834 CxxC_CXXC_SSSS Puta  86.9    0.18 3.9E-06   22.7  -0.1   29   86-123     6-34  (41)
 88 COG5048 FOG: Zn-finger [Genera  86.3    0.16 3.5E-06   35.4  -0.6   56   57-112   289-350 (467)
 89 PF13717 zinc_ribbon_4:  zinc-r  86.1    0.75 1.6E-05   20.2   1.7    9   33-41      5-13  (36)
 90 KOG2186|consensus               85.9    0.31 6.7E-06   31.5   0.5   49   31-81      4-52  (276)
 91 PF04959 ARS2:  Arsenite-resist  85.8    0.19   4E-06   32.0  -0.5   29  114-142    76-104 (214)
 92 PF02892 zf-BED:  BED zinc fing  85.8    0.34 7.3E-06   22.3   0.5   24  115-138    16-43  (45)
 93 PRK06266 transcription initiat  83.9     1.1 2.4E-05   27.7   2.3   33   83-126   115-147 (178)
 94 PF09723 Zn-ribbon_8:  Zinc rib  83.9    0.39 8.4E-06   21.9   0.2   31   29-65      4-34  (42)
 95 PRK14890 putative Zn-ribbon RN  83.1    0.51 1.1E-05   23.3   0.5    8  115-122    48-55  (59)
 96 smart00531 TFIIE Transcription  82.1     1.3 2.9E-05   26.4   2.1   39   82-126    96-134 (147)
 97 PF04780 DUF629:  Protein of un  81.7    0.96 2.1E-05   32.3   1.6   29  115-143    57-85  (466)
 98 PRK00398 rpoP DNA-directed RNA  81.1     1.2 2.5E-05   20.7   1.3   10   31-40      4-13  (46)
 99 PF14353 CpXC:  CpXC protein     81.1     2.4 5.2E-05   24.6   2.9   21   29-49     37-57  (128)
100 TIGR02300 FYDLN_acid conserved  80.6     1.3 2.9E-05   25.6   1.6   30   31-70     10-39  (129)
101 KOG2785|consensus               80.6     3.4 7.4E-05   28.7   3.7   24  115-138    68-91  (390)
102 KOG1842|consensus               79.7     1.3 2.9E-05   31.3   1.7   29  115-143    15-43  (505)
103 KOG4118|consensus               79.2     1.7 3.7E-05   21.8   1.6   31  115-145    38-68  (74)
104 KOG4167|consensus               79.1    0.66 1.4E-05   34.8   0.2   26  115-140   792-817 (907)
105 PRK00464 nrdR transcriptional   76.3    0.35 7.7E-06   29.1  -1.5   15   58-72     29-43  (154)
106 KOG3408|consensus               76.3     1.9 4.1E-05   24.7   1.4   24  115-138    57-80  (129)
107 PF09845 DUF2072:  Zn-ribbon co  75.5     1.5 3.3E-05   25.5   0.9   11   32-42      3-13  (131)
108 COG2879 Uncharacterized small   75.2     3.5 7.7E-05   20.6   2.0   19  126-144    23-41  (65)
109 PF08274 PhnA_Zn_Ribbon:  PhnA   74.9     1.1 2.3E-05   18.9   0.1    6  116-121    20-25  (30)
110 KOG1280|consensus               74.6     3.4 7.4E-05   28.3   2.4   37    1-37     80-116 (381)
111 PF00301 Rubredoxin:  Rubredoxi  74.3    0.59 1.3E-05   22.0  -0.8   13   86-98      2-14  (47)
112 COG4957 Predicted transcriptio  74.3     1.1 2.4E-05   26.1   0.1   23  116-141    77-99  (148)
113 PF07754 DUF1610:  Domain of un  74.2       1 2.3E-05   17.9   0.0    9  115-123    16-24  (24)
114 PF13451 zf-trcl:  Probable zin  73.3     3.6 7.8E-05   19.6   1.7   17   84-100     3-19  (49)
115 KOG2807|consensus               72.5     5.8 0.00013   27.1   3.1   24  115-138   345-368 (378)
116 PF03604 DNA_RNApol_7kD:  DNA d  72.0     3.9 8.5E-05   17.5   1.5    6   59-64     19-24  (32)
117 PRK09678 DNA-binding transcrip  71.6     1.2 2.5E-05   23.1  -0.1   41    1-45      2-44  (72)
118 COG3364 Zn-ribbon containing p  71.4     2.4 5.3E-05   23.4   1.0   11   32-42      4-14  (112)
119 PF04959 ARS2:  Arsenite-resist  70.0     3.2   7E-05   26.6   1.5   25    1-25     78-102 (214)
120 KOG4167|consensus               69.7     1.2 2.7E-05   33.5  -0.4   24    1-24    793-816 (907)
121 COG5151 SSL1 RNA polymerase II  68.6     3.7 8.1E-05   27.7   1.6   24  115-138   388-411 (421)
122 KOG2785|consensus               67.7      10 0.00022   26.5   3.5   23    3-25    169-191 (390)
123 PF06524 NOA36:  NOA36 protein;  67.7     1.9 4.1E-05   28.3   0.1   77   27-104   139-228 (314)
124 KOG2593|consensus               67.4     4.3 9.4E-05   28.7   1.8   36   82-122   125-160 (436)
125 COG1996 RPC10 DNA-directed RNA  67.2       3 6.4E-05   19.8   0.7   10   86-95      7-16  (49)
126 PRK03824 hypA hydrogenase nick  66.0     2.3 5.1E-05   25.0   0.3   13   85-97     70-82  (135)
127 COG1997 RPL43A Ribosomal prote  66.0     3.7 8.1E-05   22.1   1.0   11   86-96     54-64  (89)
128 PTZ00255 60S ribosomal protein  63.9     7.8 0.00017   21.1   2.0   14   55-68     52-65  (90)
129 COG0068 HypF Hydrogenase matur  63.1    0.66 1.4E-05   34.7  -2.7   57   58-123   124-181 (750)
130 PF13453 zf-TFIIB:  Transcripti  62.8     6.9 0.00015   17.6   1.5   18   31-48     20-37  (41)
131 PF05290 Baculo_IE-1:  Baculovi  61.4     5.6 0.00012   23.3   1.2   13  117-129   123-135 (140)
132 TIGR00280 L37a ribosomal prote  60.9     8.1 0.00018   21.1   1.7   29   31-68     36-64  (91)
133 PRK04023 DNA polymerase II lar  60.4      11 0.00024   30.1   2.9   10  115-124   663-672 (1121)
134 PF04780 DUF629:  Protein of un  60.0       9 0.00019   27.7   2.3   24    2-25     59-82  (466)
135 PF07503 zf-HYPF:  HypF finger;  59.3     3.1 6.6E-05   18.2  -0.0   12   56-67     20-31  (35)
136 COG0068 HypF Hydrogenase matur  59.2     1.7 3.6E-05   32.8  -1.3   28   33-65    154-181 (750)
137 PF01780 Ribosomal_L37ae:  Ribo  58.7     4.4 9.6E-05   22.0   0.5   28   31-67     36-63  (90)
138 PRK03976 rpl37ae 50S ribosomal  57.4     9.8 0.00021   20.7   1.7   29   31-68     37-65  (90)
139 smart00440 ZnF_C2C2 C2C2 Zinc   56.8    0.89 1.9E-05   20.5  -2.0   12  115-126    28-39  (40)
140 KOG2593|consensus               56.6     8.7 0.00019   27.3   1.8   38   28-67    126-163 (436)
141 COG1198 PriA Primosomal protei  55.0     5.1 0.00011   30.7   0.5   10  115-124   475-484 (730)
142 PF13878 zf-C2H2_3:  zinc-finge  54.8      20 0.00044   16.2   2.3   23   58-80     14-38  (41)
143 PF15135 UPF0515:  Uncharacteri  54.5     7.3 0.00016   25.5   1.1   13  115-127   155-167 (278)
144 PF12760 Zn_Tnp_IS1595:  Transp  52.9      13 0.00029   17.1   1.6    8  115-122    37-44  (46)
145 KOG2636|consensus               51.0      13 0.00028   26.7   1.9   21  115-135   401-422 (497)
146 TIGR00595 priA primosomal prot  49.8     7.8 0.00017   28.4   0.8    9  115-123   253-261 (505)
147 COG4530 Uncharacterized protei  49.7     6.4 0.00014   22.2   0.2   11   85-95     26-36  (129)
148 COG1675 TFA1 Transcription ini  49.6      28  0.0006   21.7   3.0   33   81-124   109-141 (176)
149 PRK00432 30S ribosomal protein  48.6      13 0.00027   17.8   1.1    9   86-94     38-46  (50)
150 KOG2272|consensus               48.3      11 0.00024   24.8   1.2   19    1-19    100-118 (332)
151 PLN03238 probable histone acet  48.2      15 0.00033   24.7   1.8   25  115-139    48-72  (290)
152 COG1655 Uncharacterized protei  44.9     4.8  0.0001   26.0  -0.7    6   87-92     64-69  (267)
153 KOG2907|consensus               44.3     9.6 0.00021   21.6   0.4   40   86-127    75-114 (116)
154 PF08790 zf-LYAR:  LYAR-type C2  44.2     6.5 0.00014   16.2  -0.2    8   88-95      3-10  (28)
155 TIGR00100 hypA hydrogenase nic  44.1     8.7 0.00019   21.9   0.3   10   58-67     71-80  (115)
156 COG5112 UFD2 U1-like Zn-finger  43.5      12 0.00027   20.9   0.8   24  115-138    55-78  (126)
157 PLN02294 cytochrome c oxidase   42.6      12 0.00025   23.1   0.6   15  114-128   140-154 (174)
158 smart00154 ZnF_AN1 AN1-like Zi  42.6       9 0.00019   17.1   0.1   14  115-128    12-25  (39)
159 KOG1280|consensus               42.3      22 0.00047   24.7   1.9   38   85-122    79-116 (381)
160 cd00924 Cyt_c_Oxidase_Vb Cytoc  42.2      11 0.00024   20.9   0.5   13  115-127    79-91  (97)
161 PF08209 Sgf11:  Sgf11 (transcr  42.2      21 0.00046   15.4   1.2   22  116-138     5-26  (33)
162 PF04423 Rad50_zn_hook:  Rad50   41.9     8.2 0.00018   18.5  -0.1   21  117-137    22-44  (54)
163 KOG1842|consensus               41.4      20 0.00043   25.8   1.6   28    1-28     16-43  (505)
164 PF06397 Desulfoferrod_N:  Desu  41.2     6.9 0.00015   17.3  -0.3    6    2-7       8-13  (36)
165 PRK05978 hypothetical protein;  41.2     7.6 0.00017   23.3  -0.3   10   59-68     54-63  (148)
166 PF10013 DUF2256:  Uncharacteri  41.1      16 0.00034   16.8   0.8   16   87-102    10-25  (42)
167 COG1594 RPB9 DNA-directed RNA   41.0     4.1 8.9E-05   23.2  -1.4   40   86-127    73-112 (113)
168 PF02891 zf-MIZ:  MIZ/SP-RING z  40.9     9.6 0.00021   18.1   0.1    9  115-123    41-49  (50)
169 PRK11823 DNA repair protein Ra  40.8      12 0.00026   27.0   0.6    8   86-93      8-15  (446)
170 PRK12380 hydrogenase nickel in  40.4      22 0.00049   20.2   1.5   10   58-67     71-80  (113)
171 TIGR00416 sms DNA repair prote  40.1      11 0.00025   27.2   0.4    9   86-94      8-16  (454)
172 PF07800 DUF1644:  Protein of u  39.0      93   0.002   19.1   4.6   53   86-141    81-134 (162)
173 PRK14714 DNA polymerase II lar  37.7      42 0.00091   27.9   3.0   10   85-94    692-701 (1337)
174 COG3677 Transposase and inacti  37.3      13 0.00029   21.7   0.3   14  115-128    53-66  (129)
175 COG3357 Predicted transcriptio  37.2      13 0.00028   20.2   0.3   14  114-127    57-70  (97)
176 PRK14873 primosome assembly pr  36.7      16 0.00034   28.0   0.7   10  115-124   422-431 (665)
177 COG5152 Uncharacterized conser  35.7      33 0.00071   21.8   1.8   15   56-70    195-209 (259)
178 COG5188 PRP9 Splicing factor 3  35.7      22 0.00049   24.7   1.2   24  115-138   238-261 (470)
179 PF14255 Cys_rich_CPXG:  Cystei  35.6      20 0.00043   17.3   0.7    8    2-9       2-9   (52)
180 TIGR01562 FdhE formate dehydro  35.5      28 0.00062   23.8   1.7    8   86-93    225-232 (305)
181 PF14311 DUF4379:  Domain of un  35.2      36 0.00077   16.3   1.6    6   87-92     30-35  (55)
182 PF07975 C1_4:  TFIIH C1-like d  35.0      16 0.00034   17.6   0.3   23   84-106    20-42  (51)
183 PLN00104 MYST -like histone ac  34.7      26 0.00057   25.4   1.5   25  115-139   198-222 (450)
184 PTZ00064 histone acetyltransfe  34.7      29 0.00063   25.5   1.7   25  115-139   280-304 (552)
185 PF11931 DUF3449:  Domain of un  34.5      13 0.00028   23.5   0.0   21  115-135   101-122 (196)
186 PF04606 Ogr_Delta:  Ogr/Delta-  34.3     6.2 0.00013   18.4  -1.1   12    3-14      2-13  (47)
187 COG1773 Rubredoxin [Energy pro  33.9      13 0.00027   18.2  -0.1   13  115-127     3-15  (55)
188 PF04328 DUF466:  Protein of un  33.8      38 0.00083   17.2   1.6   16  129-144    26-41  (65)
189 PF07282 OrfB_Zn_ribbon:  Putat  33.7      69  0.0015   16.0   2.8   31   32-71     30-60  (69)
190 PF01428 zf-AN1:  AN1-like Zinc  33.5      19 0.00042   16.3   0.5   14   29-42     12-25  (43)
191 KOG0717|consensus               33.4      27 0.00058   25.4   1.3   21    2-22    294-314 (508)
192 PTZ00448 hypothetical protein;  32.8      38 0.00082   23.8   1.9   22    1-22    315-336 (373)
193 KOG2071|consensus               32.8      30 0.00065   25.9   1.5   26  114-139   417-442 (579)
194 TIGR00686 phnA alkylphosphonat  32.5      14 0.00031   20.8  -0.1   11   86-96     20-30  (109)
195 PTZ00448 hypothetical protein;  32.4      32  0.0007   24.2   1.5   23  115-137   314-336 (373)
196 PF11672 DUF3268:  Protein of u  32.2      17 0.00037   20.3   0.2    9   57-65      2-10  (102)
197 PRK03681 hypA hydrogenase nick  31.9      36 0.00079   19.4   1.5   10   58-67     71-80  (114)
198 PF13824 zf-Mss51:  Zinc-finger  31.3      45 0.00098   16.3   1.5   10   57-66     14-23  (55)
199 PF05495 zf-CHY:  CHY zinc fing  31.3     3.4 7.5E-05   21.3  -2.5   13   85-97     41-53  (71)
200 PRK10220 hypothetical protein;  30.3      19 0.00041   20.4   0.2   10   86-95     21-30  (111)
201 KOG3002|consensus               30.0 1.5E+02  0.0032   20.5   4.2   73    2-79     82-161 (299)
202 PHA02998 RNA polymerase subuni  29.8     8.6 0.00019   23.8  -1.3   40   85-128   143-184 (195)
203 PF01363 FYVE:  FYVE zinc finge  29.1      32 0.00069   17.3   0.9    8   33-40     12-19  (69)
204 PRK05580 primosome assembly pr  29.0      25 0.00055   27.0   0.7    8  115-122   421-428 (679)
205 COG4888 Uncharacterized Zn rib  29.0     3.1 6.6E-05   23.0  -2.9    8   31-38     23-30  (104)
206 PF10122 Mu-like_Com:  Mu-like   28.7      11 0.00024   18.1  -0.8   31   85-125     4-34  (51)
207 cd00974 DSRD Desulforedoxin (D  28.5      20 0.00042   15.3   0.0    6    2-7       6-11  (34)
208 PF14369 zf-RING_3:  zinc-finge  28.5      29 0.00063   15.1   0.6    8    3-10     24-31  (35)
209 PF07295 DUF1451:  Protein of u  28.3      21 0.00046   21.5   0.2   31   83-125   110-140 (146)
210 cd00730 rubredoxin Rubredoxin;  28.2      29 0.00063   16.5   0.6    9    2-10      3-11  (50)
211 KOG2071|consensus               28.1      44 0.00096   25.1   1.7   26   56-81    417-442 (579)
212 PRK05452 anaerobic nitric oxid  28.0      16 0.00035   26.6  -0.4   39   84-123   424-466 (479)
213 PF01155 HypA:  Hydrogenase exp  27.9      32 0.00069   19.6   0.8   11   31-41     71-81  (113)
214 PLN02748 tRNA dimethylallyltra  27.7      38 0.00083   24.8   1.4   25  114-138   417-442 (468)
215 PF01286 XPA_N:  XPA protein N-  26.9      25 0.00054   15.3   0.2   12  117-128     5-16  (34)
216 PRK03564 formate dehydrogenase  26.5      29 0.00063   23.8   0.6    8  115-122   252-259 (309)
217 PF08271 TF_Zn_Ribbon:  TFIIB z  26.5      25 0.00053   15.9   0.2    9   31-39     20-28  (43)
218 PRK00564 hypA hydrogenase nick  26.3      45 0.00098   19.1   1.3   13   57-69     71-83  (117)
219 TIGR00143 hypF [NiFe] hydrogen  26.3     4.1 8.8E-05   31.2  -3.7   61   32-98     70-131 (711)
220 PRK00762 hypA hydrogenase nick  25.9      22 0.00048   20.6  -0.0    6  117-122    94-99  (124)
221 COG4338 Uncharacterized protei  25.9      24 0.00051   16.7   0.1   16   87-102    14-29  (54)
222 COG1326 Uncharacterized archae  25.8      64  0.0014   20.5   1.9   10   58-67     31-40  (201)
223 PRK14892 putative transcriptio  25.7      19 0.00042   20.0  -0.3   10   86-95     43-52  (99)
224 COG4896 Uncharacterized protei  25.6      30 0.00064   17.3   0.4    6   86-91     32-37  (68)
225 PLN03239 histone acetyltransfe  25.3      56  0.0012   22.9   1.7   23  115-137   106-128 (351)
226 COG1571 Predicted DNA-binding   25.3      47   0.001   23.9   1.4   30   59-99    352-381 (421)
227 KOG4124|consensus               24.6      18  0.0004   25.1  -0.6   53   83-135   347-418 (442)
228 KOG0782|consensus               24.5      21 0.00045   26.7  -0.4   52   71-129   239-290 (1004)
229 PF10276 zf-CHCC:  Zinc-finger   24.4      31 0.00068   15.6   0.3   11   30-40     29-39  (40)
230 cd00065 FYVE FYVE domain; Zinc  24.2      60  0.0013   15.4   1.3    6   60-65     21-26  (57)
231 PF14803 Nudix_N_2:  Nudix N-te  23.8      23  0.0005   15.3  -0.2    9  115-123    22-30  (34)
232 KOG2747|consensus               23.8      55  0.0012   23.3   1.5   28  114-141   157-184 (396)
233 COG1656 Uncharacterized conser  23.4      71  0.0015   19.7   1.7   11   58-68    131-141 (165)
234 PF14787 zf-CCHC_5:  GAG-polypr  23.3      28 0.00061   15.3   0.0   14  117-130     4-17  (36)
235 TIGR01206 lysW lysine biosynth  23.1      41  0.0009   16.4   0.6    8    2-9       4-11  (54)
236 KOG2923|consensus               22.9      73  0.0016   16.1   1.4   12   53-64     40-51  (67)
237 KOG1940|consensus               22.7 1.7E+02  0.0036   20.0   3.4   18   31-49    197-214 (276)
238 COG4391 Uncharacterized protei  22.4      38 0.00083   17.0   0.4   13  115-127    48-60  (62)
239 PF13821 DUF4187:  Domain of un  22.4      48   0.001   16.2   0.8   17    3-19     30-46  (55)
240 PF03470 zf-XS:  XS zinc finger  22.3      83  0.0018   14.6   1.5    8   13-20     14-21  (43)
241 PF13240 zinc_ribbon_2:  zinc-r  22.1      29 0.00062   13.4  -0.0    6    3-8       2-7   (23)
242 PF12773 DZR:  Double zinc ribb  21.8      46 0.00099   15.4   0.6    6   87-92     31-36  (50)
243 KOG1813|consensus               21.8      75  0.0016   21.7   1.7   15   56-70    240-254 (313)
244 PF12230 PRP21_like_P:  Pre-mRN  21.8      30 0.00066   22.4   0.0   29  115-144   168-196 (229)
245 PRK01343 zinc-binding protein;  21.3      42 0.00091   16.6   0.4   12  115-126     9-20  (57)
246 TIGR03831 YgiT_finger YgiT-typ  21.3      42 0.00091   15.0   0.4   11   58-68     33-43  (46)
247 KOG3352|consensus               21.0      43 0.00093   20.3   0.5   13  115-127   133-145 (153)
248 PF09963 DUF2197:  Uncharacteri  20.8      27  0.0006   17.2  -0.3    8  115-122    31-38  (56)
249 smart00064 FYVE Protein presen  20.3      69  0.0015   15.9   1.2    9   33-41     13-21  (68)
250 PF06220 zf-U1:  U1 zinc finger  20.2      78  0.0017   14.0   1.2    9    2-10      5-13  (38)
251 PF02591 DUF164:  Putative zinc  20.2 1.3E+02  0.0027   14.5   2.4   10   56-65     45-54  (56)
252 KOG4577|consensus               20.1      31 0.00068   23.3  -0.2   33    2-37     35-67  (383)

No 1  
>KOG2462|consensus
Probab=100.00  E-value=4.5e-36  Score=185.49  Aligned_cols=138  Identities=25%  Similarity=0.485  Sum_probs=128.9

Q ss_pred             CCCCcccccccCHHHHHHHHHHHhh-CCCcceecccccccccChHHHHHHHhccCCcccccCCCCcccCChHHHHHHHHh
Q psy12196          1 MSCVPCDVLFHNKATLYKHLYLEHK-ATSLSIQCNMCSLVLDSKESLVTHISQTHTLMFTCRRCPSTFLNSATLSKHVKM   79 (150)
Q Consensus         1 ~~C~~C~~~f~~~~~l~~h~~~~~~-~~~~~~~c~~c~~~f~~~~~l~~h~~~~~~~~~~c~~c~~~f~~~~~l~~h~~~   79 (150)
                      |+|+.||+.+.+.++|.+|...|-. ...+.+.|+.|++.+.....|..|+ ++|..+++|.+||++|...+.|+-|+++
T Consensus       131 ~~c~eCgk~ysT~snLsrHkQ~H~~~~s~ka~~C~~C~K~YvSmpALkMHi-rTH~l~c~C~iCGKaFSRPWLLQGHiRT  209 (279)
T KOG2462|consen  131 YKCPECGKSYSTSSNLSRHKQTHRSLDSKKAFSCKYCGKVYVSMPALKMHI-RTHTLPCECGICGKAFSRPWLLQGHIRT  209 (279)
T ss_pred             eeccccccccccccccchhhcccccccccccccCCCCCceeeehHHHhhHh-hccCCCcccccccccccchHHhhccccc
Confidence            6899999999999999999988543 3467789999999999999999999 9999999999999999999999999999


Q ss_pred             hcCCCcccCCCChhhhcchhHHhhHHhhhcCCCCCCcCCcchhhhccCchHHHHHHHHhcCC
Q psy12196         80 EHNSKSYQCNECPESFERLNKLKRHKFQAHNDSVHQIQCPYCITDFSEDKNLIQHIVSVHLG  141 (150)
Q Consensus        80 ~~~~~~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~~C~~C~~~f~~~~~l~~H~~~~~~~  141 (150)
                      |+|||||.|..|++.|..+++|+.|+++|.+.+  +|+|..|+|.|...+.|.+|.++--..
T Consensus       210 HTGEKPF~C~hC~kAFADRSNLRAHmQTHS~~K--~~qC~~C~KsFsl~SyLnKH~ES~C~~  269 (279)
T KOG2462|consen  210 HTGEKPFSCPHCGKAFADRSNLRAHMQTHSDVK--KHQCPRCGKSFALKSYLNKHSESACLK  269 (279)
T ss_pred             ccCCCCccCCcccchhcchHHHHHHHHhhcCCc--cccCcchhhHHHHHHHHHHhhhhcccc
Confidence            999999999999999999999999999999988  999999999999999999999876433


No 2  
>KOG2462|consensus
Probab=99.96  E-value=2.8e-29  Score=155.51  Aligned_cols=116  Identities=21%  Similarity=0.454  Sum_probs=107.7

Q ss_pred             cceecccccccccChHHHHHHHhccC----CcccccCCCCcccCChHHHHHHHHhhcCCCcccCCCChhhhcchhHHhhH
Q psy12196         29 LSIQCNMCSLVLDSKESLVTHISQTH----TLMFTCRRCPSTFLNSATLSKHVKMEHNSKSYQCNECPESFERLNKLKRH  104 (150)
Q Consensus        29 ~~~~c~~c~~~f~~~~~l~~h~~~~~----~~~~~c~~c~~~f~~~~~l~~h~~~~~~~~~~~c~~c~~~~~~~~~l~~h  104 (150)
                      ..|+|+.|++.+.+.++|..|.+.+.    .+.+.|..|++.|.+...|..|+++|+  -+.+|.+||+.|...|-|+.|
T Consensus       129 ~r~~c~eCgk~ysT~snLsrHkQ~H~~~~s~ka~~C~~C~K~YvSmpALkMHirTH~--l~c~C~iCGKaFSRPWLLQGH  206 (279)
T KOG2462|consen  129 PRYKCPECGKSYSTSSNLSRHKQTHRSLDSKKAFSCKYCGKVYVSMPALKMHIRTHT--LPCECGICGKAFSRPWLLQGH  206 (279)
T ss_pred             CceeccccccccccccccchhhcccccccccccccCCCCCceeeehHHHhhHhhccC--CCcccccccccccchHHhhcc
Confidence            44899999999999999999974433    278999999999999999999999998  568999999999999999999


Q ss_pred             HhhhcCCCCCCcCCcchhhhccCchHHHHHHHHhcCCCCCCCCC
Q psy12196        105 KFQAHNDSVHQIQCPYCITDFSEDKNLIQHIVSVHLGKEGTAPA  148 (150)
Q Consensus       105 ~~~~~~~~~~~~~C~~C~~~f~~~~~l~~H~~~~~~~~~~~~~~  148 (150)
                      +++|+||+  ||.|+.|+|+|.++++|+.||++|.+.|.|+|+.
T Consensus       207 iRTHTGEK--PF~C~hC~kAFADRSNLRAHmQTHS~~K~~qC~~  248 (279)
T KOG2462|consen  207 IRTHTGEK--PFSCPHCGKAFADRSNLRAHMQTHSDVKKHQCPR  248 (279)
T ss_pred             cccccCCC--CccCCcccchhcchHHHHHHHHhhcCCccccCcc
Confidence            99999999  9999999999999999999999999999999974


No 3  
>KOG3608|consensus
Probab=99.84  E-value=8.9e-21  Score=121.68  Aligned_cols=105  Identities=26%  Similarity=0.566  Sum_probs=50.8

Q ss_pred             CCcccccccCHHHHHHHHHHHhhCCCcceecccccccccChHHHHHHHhccCCcccccCCCCcccCChHHHHHHHHh-hc
Q psy12196          3 CVPCDVLFHNKATLYKHLYLEHKATSLSIQCNMCSLVLDSKESLVTHISQTHTLMFTCRRCPSTFLNSATLSKHVKM-EH   81 (150)
Q Consensus         3 C~~C~~~f~~~~~l~~h~~~~~~~~~~~~~c~~c~~~f~~~~~l~~h~~~~~~~~~~c~~c~~~f~~~~~l~~h~~~-~~   81 (150)
                      |+.||..|.+...|..|++..+.....+|+|..|.+.|..+..|..|+ ..|...|+|+.|+......++|..|++. |.
T Consensus       210 Cp~Cg~~F~~~tkl~DH~rRqt~l~~n~fqC~~C~KrFaTeklL~~Hv-~rHvn~ykCplCdmtc~~~ssL~~H~r~rHs  288 (467)
T KOG3608|consen  210 CPHCGELFRTKTKLFDHLRRQTELNTNSFQCAQCFKRFATEKLLKSHV-VRHVNCYKCPLCDMTCSSASSLTTHIRYRHS  288 (467)
T ss_pred             cchHHHHhccccHHHHHHHhhhhhcCCchHHHHHHHHHhHHHHHHHHH-HHhhhcccccccccCCCChHHHHHHHHhhhc
Confidence            444444444444444444443333333444444444444444444444 3334445555555555555555555543 44


Q ss_pred             CCCcccCCCChhhhcchhHHhhHHhhh
Q psy12196         82 NSKSYQCNECPESFERLNKLKRHKFQA  108 (150)
Q Consensus        82 ~~~~~~c~~c~~~~~~~~~l~~h~~~~  108 (150)
                      ..+||+|..|++.+...++|.+|...|
T Consensus       289 ~dkpfKCd~Cd~~c~~esdL~kH~~~H  315 (467)
T KOG3608|consen  289 KDKPFKCDECDTRCVRESDLAKHVQVH  315 (467)
T ss_pred             cCCCccccchhhhhccHHHHHHHHHhc
Confidence            455555555555555555555555443


No 4  
>KOG3608|consensus
Probab=99.82  E-value=5.5e-20  Score=118.11  Aligned_cols=139  Identities=27%  Similarity=0.525  Sum_probs=123.8

Q ss_pred             CCCCcccccccCHHHHHHHHHHHhhCCCcceecccccccccChHHHHHHHhccC--CcccccCCCCcccCChHHHHHHHH
Q psy12196          1 MSCVPCDVLFHNKATLYKHLYLEHKATSLSIQCNMCSLVLDSKESLVTHISQTH--TLMFTCRRCPSTFLNSATLSKHVK   78 (150)
Q Consensus         1 ~~C~~C~~~f~~~~~l~~h~~~~~~~~~~~~~c~~c~~~f~~~~~l~~h~~~~~--~~~~~c~~c~~~f~~~~~l~~h~~   78 (150)
                      |+|..|.+.|.+...|..|+.. |.   ..|+|+.|+.+.+..++|..|+.-.|  .+||+|..|++.+.+...|..|..
T Consensus       238 fqC~~C~KrFaTeklL~~Hv~r-Hv---n~ykCplCdmtc~~~ssL~~H~r~rHs~dkpfKCd~Cd~~c~~esdL~kH~~  313 (467)
T KOG3608|consen  238 FQCAQCFKRFATEKLLKSHVVR-HV---NCYKCPLCDMTCSSASSLTTHIRYRHSKDKPFKCDECDTRCVRESDLAKHVQ  313 (467)
T ss_pred             hHHHHHHHHHhHHHHHHHHHHH-hh---hcccccccccCCCChHHHHHHHHhhhccCCCccccchhhhhccHHHHHHHHH
Confidence            6899999999999999999887 43   34899999999999999999985433  499999999999999999999999


Q ss_pred             hhcCCCcccCCC--ChhhhcchhHHhhHHhhhc-CCCCCCcCCcchhhhccCchHHHHHHHHhcCCCCC
Q psy12196         79 MEHNSKSYQCNE--CPESFERLNKLKRHKFQAH-NDSVHQIQCPYCITDFSEDKNLIQHIVSVHLGKEG  144 (150)
Q Consensus        79 ~~~~~~~~~c~~--c~~~~~~~~~l~~h~~~~~-~~~~~~~~C~~C~~~f~~~~~l~~H~~~~~~~~~~  144 (150)
                      .|. +..|.|..  |..++.+...+++|++.++ +..+-+|.|-.|++.|++--+|.+|+...|+-+..
T Consensus       314 ~HS-~~~y~C~h~~C~~s~r~~~q~~~H~~evhEg~np~~Y~CH~Cdr~ft~G~~L~~HL~kkH~f~~P  381 (467)
T KOG3608|consen  314 VHS-KTVYQCEHPDCHYSVRTYTQMRRHFLEVHEGNNPILYACHCCDRFFTSGKSLSAHLMKKHGFRLP  381 (467)
T ss_pred             hcc-ccceecCCCCCcHHHHHHHHHHHHHHHhccCCCCCceeeecchhhhccchhHHHHHHHhhcccCC
Confidence            887 67799988  9999999999999998876 66667899999999999999999999988876654


No 5  
>KOG1074|consensus
Probab=99.82  E-value=9.2e-22  Score=137.65  Aligned_cols=53  Identities=25%  Similarity=0.468  Sum_probs=45.5

Q ss_pred             CCCCcccccccCHHHHHHHHHHHhhCCCcceecccccccccChHHHHHHHhccCC
Q psy12196          1 MSCVPCDVLFHNKATLYKHLYLEHKATSLSIQCNMCSLVLDSKESLVTHISQTHT   55 (150)
Q Consensus         1 ~~C~~C~~~f~~~~~l~~h~~~~~~~~~~~~~c~~c~~~f~~~~~l~~h~~~~~~   55 (150)
                      .+|.+|.+.|...+.|+.|.+.|+  ++.+|+|..|+..|+.+.+|..|.+++++
T Consensus       354 hkCr~CakvfgS~SaLqiHlRSHT--GERPfqCnvCG~~FSTkGNLKvH~~rH~e  406 (958)
T KOG1074|consen  354 HKCRFCAKVFGSDSALQIHLRSHT--GERPFQCNVCGNRFSTKGNLKVHFQRHRE  406 (958)
T ss_pred             chhhhhHhhcCchhhhhhhhhccC--CCCCeeecccccccccccceeeeeeeccc
Confidence            369999999999999999999844  67789999999999999999998755443


No 6  
>KOG3576|consensus
Probab=99.80  E-value=5e-20  Score=110.03  Aligned_cols=116  Identities=19%  Similarity=0.368  Sum_probs=102.0

Q ss_pred             CcceecccccccccChHHHHHHHhccCC--cccccCCCCcccCChHHHHHHHHhhcCCCcccCCCChhhhcchhHHhhHH
Q psy12196         28 SLSIQCNMCSLVLDSKESLVTHISQTHT--LMFTCRRCPSTFLNSATLSKHVKMEHNSKSYQCNECPESFERLNKLKRHK  105 (150)
Q Consensus        28 ~~~~~c~~c~~~f~~~~~l~~h~~~~~~--~~~~c~~c~~~f~~~~~l~~h~~~~~~~~~~~c~~c~~~~~~~~~l~~h~  105 (150)
                      ...+.|..|++.|..-.-|.+|+ ..|.  +.+.|..||+.|.+.-+|.+|+++|+|.+||+|..|++.|.+...|..|.
T Consensus       115 ~d~ftCrvCgK~F~lQRmlnrh~-kch~~vkr~lct~cgkgfndtfdlkrh~rthtgvrpykc~~c~kaftqrcsleshl  193 (267)
T KOG3576|consen  115 QDSFTCRVCGKKFGLQRMLNRHL-KCHSDVKRHLCTFCGKGFNDTFDLKRHTRTHTGVRPYKCSLCEKAFTQRCSLESHL  193 (267)
T ss_pred             CCeeeeehhhhhhhHHHHHHHHh-hhccHHHHHHHhhccCcccchhhhhhhhccccCccccchhhhhHHHHhhccHHHHH
Confidence            34589999999999888888898 4443  78899999999999999999999999999999999999999999999998


Q ss_pred             hhhcCC---------CCCCcCCcchhhhccCchHHHHHHHHhcCCCCC
Q psy12196        106 FQAHND---------SVHQIQCPYCITDFSEDKNLIQHIVSVHLGKEG  144 (150)
Q Consensus       106 ~~~~~~---------~~~~~~C~~C~~~f~~~~~l~~H~~~~~~~~~~  144 (150)
                      ...++.         +.+.|.|..||..-.....+..|++.+|+..|+
T Consensus       194 ~kvhgv~~~yaykerr~kl~vcedcg~t~~~~e~~~~h~~~~hp~Spa  241 (267)
T KOG3576|consen  194 KKVHGVQHQYAYKERRAKLYVCEDCGYTSERPEVYYLHLKLHHPFSPA  241 (267)
T ss_pred             HHHcCchHHHHHHHhhhheeeecccCCCCCChhHHHHHHHhcCCCCHH
Confidence            876653         345799999999999999999999999976653


No 7  
>KOG1074|consensus
Probab=99.78  E-value=5.9e-20  Score=128.77  Aligned_cols=77  Identities=25%  Similarity=0.608  Sum_probs=66.2

Q ss_pred             CCCcccccccCHHHHHHHHHHHhhCCCcceecccccccccChHHHHHHHhccCC------cccccC---CCCcccCChHH
Q psy12196          2 SCVPCDVLFHNKATLYKHLYLEHKATSLSIQCNMCSLVLDSKESLVTHISQTHT------LMFTCR---RCPSTFLNSAT   72 (150)
Q Consensus         2 ~C~~C~~~f~~~~~l~~h~~~~~~~~~~~~~c~~c~~~f~~~~~l~~h~~~~~~------~~~~c~---~c~~~f~~~~~   72 (150)
                      +|-.|-+.++..+.|+.|.+. |. ++.+|+|..|++.|..+.+|..|+ ..|.      ..+.|+   +|-+.|.+...
T Consensus       607 qCiiC~rVlSC~saLqmHyrt-Ht-GERPFkCKiCgRAFtTkGNLkaH~-~vHka~p~~R~q~ScP~~~ic~~kftn~V~  683 (958)
T KOG1074|consen  607 QCIICLRVLSCPSALQMHYRT-HT-GERPFKCKICGRAFTTKGNLKAHM-SVHKAKPPARVQFSCPSTFICQKKFTNAVT  683 (958)
T ss_pred             ceeeeeecccchhhhhhhhhc-cc-CcCccccccccchhccccchhhcc-cccccCccccccccCCchhhhccccccccc
Confidence            577899999999999999888 44 677899999999999999999998 4443      568899   89999999999


Q ss_pred             HHHHHHhhc
Q psy12196         73 LSKHVKMEH   81 (150)
Q Consensus        73 l~~h~~~~~   81 (150)
                      |..|++.|.
T Consensus       684 lpQhIriH~  692 (958)
T KOG1074|consen  684 LPQHIRIHL  692 (958)
T ss_pred             ccceEEeec
Confidence            999988886


No 8  
>KOG3623|consensus
Probab=99.72  E-value=2.1e-18  Score=119.82  Aligned_cols=105  Identities=21%  Similarity=0.530  Sum_probs=85.6

Q ss_pred             CCCcccccccCHHHHHHHHHHHhhCCCcceecccccccccChHHHHHHHhccCC--------------cccccCCCCccc
Q psy12196          2 SCVPCDVLFHNKATLYKHLYLEHKATSLSIQCNMCSLVLDSKESLVTHISQTHT--------------LMFTCRRCPSTF   67 (150)
Q Consensus         2 ~C~~C~~~f~~~~~l~~h~~~~~~~~~~~~~c~~c~~~f~~~~~l~~h~~~~~~--------------~~~~c~~c~~~f   67 (150)
                      .|++|+..+.....|+.|++..|...+..|.|..|..+|.....|.+|++.+..              +.|+|.+|+++|
T Consensus       212 tcpycdrgykrltslkeHikyrhekne~nfsC~lCsytFAyRtQLErhm~~hkpg~dqa~sltqsa~lRKFKCtECgKAF  291 (1007)
T KOG3623|consen  212 TCPYCDRGYKRLTSLKEHIKYRHEKNEPNFSCMLCSYTFAYRTQLERHMQLHKPGGDQAISLTQSALLRKFKCTECGKAF  291 (1007)
T ss_pred             cchhHHHHHHHHHHHHHHHHHHHhhCCCCCcchhhhhhhhhHHHHHHHHHhhcCCCcccccccchhhhccccccccchhh
Confidence            688999999999999999988777666678899999999999999888732211              568888888888


Q ss_pred             CChHHHHHHHHhhcCCCcccCCCChhhhcchhHHhhHHh
Q psy12196         68 LNSATLSKHVKMEHNSKSYQCNECPESFERLNKLKRHKF  106 (150)
Q Consensus        68 ~~~~~l~~h~~~~~~~~~~~c~~c~~~~~~~~~l~~h~~  106 (150)
                      ..+.-|.-|+++|.|+|||.|..|++.|.....+..|+.
T Consensus       292 KfKHHLKEHlRIHSGEKPfeCpnCkKRFSHSGSySSHmS  330 (1007)
T KOG3623|consen  292 KFKHHLKEHLRIHSGEKPFECPNCKKRFSHSGSYSSHMS  330 (1007)
T ss_pred             hhHHHHHhhheeecCCCCcCCcccccccccCCccccccc
Confidence            888888888888888888888888888888888777754


No 9  
>KOG3623|consensus
Probab=99.66  E-value=3.1e-17  Score=114.17  Aligned_cols=79  Identities=27%  Similarity=0.615  Sum_probs=76.5

Q ss_pred             CcccccCCCCcccCChHHHHHHHHhhcCCCcccCCCChhhhcchhHHhhHHhhhcCCCCCCcCCcchhhhccCchHHHHH
Q psy12196         55 TLMFTCRRCPSTFLNSATLSKHVKMEHNSKSYQCNECPESFERLNKLKRHKFQAHNDSVHQIQCPYCITDFSEDKNLIQH  134 (150)
Q Consensus        55 ~~~~~c~~c~~~f~~~~~l~~h~~~~~~~~~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~~C~~C~~~f~~~~~l~~H  134 (150)
                      ...|.|..|+++|.-..+|.+|...|+|.+||.|.+|.+.|...-.|.-|++.|.|++  ||+|..|+|.|...+++..|
T Consensus       892 ~gmyaCDqCDK~FqKqSSLaRHKYEHsGqRPyqC~iCkKAFKHKHHLtEHkRLHSGEK--PfQCdKClKRFSHSGSYSQH  969 (1007)
T KOG3623|consen  892 DGMYACDQCDKAFQKQSSLARHKYEHSGQRPYQCIICKKAFKHKHHLTEHKRLHSGEK--PFQCDKCLKRFSHSGSYSQH  969 (1007)
T ss_pred             cccchHHHHHHHHHhhHHHHHhhhhhcCCCCcccchhhHhhhhhhhhhhhhhhccCCC--cchhhhhhhhcccccchHhh
Confidence            3689999999999999999999999999999999999999999999999999999998  99999999999999999999


Q ss_pred             H
Q psy12196        135 I  135 (150)
Q Consensus       135 ~  135 (150)
                      |
T Consensus       970 M  970 (1007)
T KOG3623|consen  970 M  970 (1007)
T ss_pred             h
Confidence            8


No 10 
>KOG3576|consensus
Probab=99.65  E-value=2.2e-17  Score=98.80  Aligned_cols=85  Identities=28%  Similarity=0.474  Sum_probs=80.5

Q ss_pred             cccccCCCCcccCChHHHHHHHHhhcCCCcccCCCChhhhcchhHHhhHHhhhcCCCCCCcCCcchhhhccCchHHHHHH
Q psy12196         56 LMFTCRRCPSTFLNSATLSKHVKMEHNSKSYQCNECPESFERLNKLKRHKFQAHNDSVHQIQCPYCITDFSEDKNLIQHI  135 (150)
Q Consensus        56 ~~~~c~~c~~~f~~~~~l~~h~~~~~~~~~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~~C~~C~~~f~~~~~l~~H~  135 (150)
                      ..|.|.+|++.|..-..|.+|++.|...+.+.|..||+.|...-+|.+|.++|++.+  ||+|..|+|+|+...+|..|+
T Consensus       116 d~ftCrvCgK~F~lQRmlnrh~kch~~vkr~lct~cgkgfndtfdlkrh~rthtgvr--pykc~~c~kaftqrcsleshl  193 (267)
T KOG3576|consen  116 DSFTCRVCGKKFGLQRMLNRHLKCHSDVKRHLCTFCGKGFNDTFDLKRHTRTHTGVR--PYKCSLCEKAFTQRCSLESHL  193 (267)
T ss_pred             CeeeeehhhhhhhHHHHHHHHhhhccHHHHHHHhhccCcccchhhhhhhhccccCcc--ccchhhhhHHHHhhccHHHHH
Confidence            568999999999999999999999999999999999999999999999999999988  999999999999999999999


Q ss_pred             HHhcCCC
Q psy12196        136 VSVHLGK  142 (150)
Q Consensus       136 ~~~~~~~  142 (150)
                      +..||..
T Consensus       194 ~kvhgv~  200 (267)
T KOG3576|consen  194 KKVHGVQ  200 (267)
T ss_pred             HHHcCch
Confidence            9888643


No 11 
>PLN03086 PRLI-interacting factor K; Provisional
Probab=99.39  E-value=9.4e-13  Score=91.48  Aligned_cols=104  Identities=15%  Similarity=0.373  Sum_probs=83.1

Q ss_pred             ceecccccccccChHHHHHHHhccCCcccccCCCCcccCChHHHHHHHHhhcCCCcccCCCChhhhc----------chh
Q psy12196         30 SIQCNMCSLVLDSKESLVTHISQTHTLMFTCRRCPSTFLNSATLSKHVKMEHNSKSYQCNECPESFE----------RLN   99 (150)
Q Consensus        30 ~~~c~~c~~~f~~~~~l~~h~~~~~~~~~~c~~c~~~f~~~~~l~~h~~~~~~~~~~~c~~c~~~~~----------~~~   99 (150)
                      .+.|+.|++.|. ...+..|+... ..++.|+ |+..+ ....|..|+..|.+.+++.|..|+..+.          ..+
T Consensus       453 H~~C~~Cgk~f~-~s~LekH~~~~-Hkpv~Cp-Cg~~~-~R~~L~~H~~thCp~Kpi~C~fC~~~v~~g~~~~d~~d~~s  528 (567)
T PLN03086        453 HVHCEKCGQAFQ-QGEMEKHMKVF-HEPLQCP-CGVVL-EKEQMVQHQASTCPLRLITCRFCGDMVQAGGSAMDVRDRLR  528 (567)
T ss_pred             CccCCCCCCccc-hHHHHHHHHhc-CCCccCC-CCCCc-chhHHHhhhhccCCCCceeCCCCCCccccCccccchhhhhh
Confidence            357999999986 57788997444 4889999 99655 6688999999999999999999998884          235


Q ss_pred             HHhhHHhhhcCCCCCCcCCcchhhhccCchHHHHHHHHhcCC
Q psy12196        100 KLKRHKFQAHNDSVHQIQCPYCITDFSEDKNLIQHIVSVHLG  141 (150)
Q Consensus       100 ~l~~h~~~~~~~~~~~~~C~~C~~~f~~~~~l~~H~~~~~~~  141 (150)
                      .|..|.... +.+  ++.|..|++.+..+ ++..|+...|..
T Consensus       529 ~Lt~HE~~C-G~r--t~~C~~Cgk~Vrlr-dm~~H~~~~h~~  566 (567)
T PLN03086        529 GMSEHESIC-GSR--TAPCDSCGRSVMLK-EMDIHQIAVHQK  566 (567)
T ss_pred             hHHHHHHhc-CCc--ceEccccCCeeeeh-hHHHHHHHhhcC
Confidence            788888763 555  88999999998885 688898877753


No 12 
>PHA00733 hypothetical protein
Probab=99.35  E-value=7.9e-13  Score=75.95  Aligned_cols=84  Identities=18%  Similarity=0.330  Sum_probs=67.0

Q ss_pred             cCCcccccCCCCcccCChHHHHHH--H---HhhcCCCcccCCCChhhhcchhHHhhHHhhhcCCCCCCcCCcchhhhccC
Q psy12196         53 THTLMFTCRRCPSTFLNSATLSKH--V---KMEHNSKSYQCNECPESFERLNKLKRHKFQAHNDSVHQIQCPYCITDFSE  127 (150)
Q Consensus        53 ~~~~~~~c~~c~~~f~~~~~l~~h--~---~~~~~~~~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~~C~~C~~~f~~  127 (150)
                      ...+++.|.+|...|..+..|..+  +   ..+.+.++|.|..||+.|...+.|..|++.+  +.  +|.|+.|+++|..
T Consensus        36 ~~~~~~~~~~~~~~~~~~~~l~~~~~l~~~~~~~~~kPy~C~~Cgk~Fss~s~L~~H~r~h--~~--~~~C~~CgK~F~~  111 (128)
T PHA00733         36 PEQKRLIRAVVKTLIYNPQLLDESSYLYKLLTSKAVSPYVCPLCLMPFSSSVSLKQHIRYT--EH--SKVCPVCGKEFRN  111 (128)
T ss_pred             hhhhhHHHHHHhhhccChhhhcchHHHHhhcccCCCCCccCCCCCCcCCCHHHHHHHHhcC--Cc--CccCCCCCCccCC
Confidence            334778888888887777666554  1   1334578999999999999999999998754  33  7899999999999


Q ss_pred             chHHHHHHHHhcC
Q psy12196        128 DKNLIQHIVSVHL  140 (150)
Q Consensus       128 ~~~l~~H~~~~~~  140 (150)
                      ...|..|+...|+
T Consensus       112 ~~sL~~H~~~~h~  124 (128)
T PHA00733        112 TDSTLDHVCKKHN  124 (128)
T ss_pred             HHHHHHHHHHhcC
Confidence            9999999988875


No 13 
>PHA00733 hypothetical protein
Probab=99.16  E-value=4.4e-11  Score=68.79  Aligned_cols=82  Identities=17%  Similarity=0.348  Sum_probs=66.9

Q ss_pred             CCcceecccccccccChHHHHHH------HhccCCcccccCCCCcccCChHHHHHHHHhhcCCCcccCCCChhhhcchhH
Q psy12196         27 TSLSIQCNMCSLVLDSKESLVTH------ISQTHTLMFTCRRCPSTFLNSATLSKHVKMEHNSKSYQCNECPESFERLNK  100 (150)
Q Consensus        27 ~~~~~~c~~c~~~f~~~~~l~~h------~~~~~~~~~~c~~c~~~f~~~~~l~~h~~~~~~~~~~~c~~c~~~~~~~~~  100 (150)
                      +++.+.|..|.+.|.....+..+      +......+|.|+.|++.|.+...|..|+..+  ..++.|.+|++.|.....
T Consensus        37 ~~~~~~~~~~~~~~~~~~~l~~~~~l~~~~~~~~~kPy~C~~Cgk~Fss~s~L~~H~r~h--~~~~~C~~CgK~F~~~~s  114 (128)
T PHA00733         37 EQKRLIRAVVKTLIYNPQLLDESSYLYKLLTSKAVSPYVCPLCLMPFSSSVSLKQHIRYT--EHSKVCPVCGKEFRNTDS  114 (128)
T ss_pred             hhhhHHHHHHhhhccChhhhcchHHHHhhcccCCCCCccCCCCCCcCCCHHHHHHHHhcC--CcCccCCCCCCccCCHHH
Confidence            46678899999888776665554      2222348999999999999999999999876  356999999999999999


Q ss_pred             HhhHHhhhcC
Q psy12196        101 LKRHKFQAHN  110 (150)
Q Consensus       101 l~~h~~~~~~  110 (150)
                      |..|+...++
T Consensus       115 L~~H~~~~h~  124 (128)
T PHA00733        115 TLDHVCKKHN  124 (128)
T ss_pred             HHHHHHHhcC
Confidence            9999887665


No 14 
>PLN03086 PRLI-interacting factor K; Provisional
Probab=99.13  E-value=1.1e-10  Score=81.53  Aligned_cols=124  Identities=19%  Similarity=0.393  Sum_probs=87.2

Q ss_pred             CCcccccccCHHHHHHHHHHHhhCCCcceeccc--ccccccChHHHHHHHhccCCcccccCCCCcccCChHHHHHHHHhh
Q psy12196          3 CVPCDVLFHNKATLYKHLYLEHKATSLSIQCNM--CSLVLDSKESLVTHISQTHTLMFTCRRCPSTFLNSATLSKHVKME   80 (150)
Q Consensus         3 C~~C~~~f~~~~~l~~h~~~~~~~~~~~~~c~~--c~~~f~~~~~l~~h~~~~~~~~~~c~~c~~~f~~~~~l~~h~~~~   80 (150)
                      |+.|...... ..|..|.... . . ..-.|+.  |+..|. ...+.        ..+.|+.|++.|. ...+..|+..+
T Consensus       410 C~NC~~~i~l-~~l~lHe~~C-~-r-~~V~Cp~~~Cg~v~~-r~el~--------~H~~C~~Cgk~f~-~s~LekH~~~~  475 (567)
T PLN03086        410 CRNCKHYIPS-RSIALHEAYC-S-R-HNVVCPHDGCGIVLR-VEEAK--------NHVHCEKCGQAFQ-QGEMEKHMKVF  475 (567)
T ss_pred             CCCCCCccch-hHHHHHHhhC-C-C-cceeCCcccccceee-ccccc--------cCccCCCCCCccc-hHHHHHHHHhc
Confidence            5555544433 3344665432 1 1 1235774  888773 22222        3458999999996 57799999998


Q ss_pred             cCCCcccCCCChhhhcchhHHhhHHhhhcCCCCCCcCCcchhhhccC----------chHHHHHHHHhcCCCCCCCC
Q psy12196         81 HNSKSYQCNECPESFERLNKLKRHKFQAHNDSVHQIQCPYCITDFSE----------DKNLIQHIVSVHLGKEGTAP  147 (150)
Q Consensus        81 ~~~~~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~~C~~C~~~f~~----------~~~l~~H~~~~~~~~~~~~~  147 (150)
                      +  +++.|. ||..+ ....|..|+..+...+  ++.|+.|++.|..          .+.|..|..+. |.+++.|.
T Consensus       476 H--kpv~Cp-Cg~~~-~R~~L~~H~~thCp~K--pi~C~fC~~~v~~g~~~~d~~d~~s~Lt~HE~~C-G~rt~~C~  545 (567)
T PLN03086        476 H--EPLQCP-CGVVL-EKEQMVQHQASTCPLR--LITCRFCGDMVQAGGSAMDVRDRLRGMSEHESIC-GSRTAPCD  545 (567)
T ss_pred             C--CCccCC-CCCCc-chhHHHhhhhccCCCC--ceeCCCCCCccccCccccchhhhhhhHHHHHHhc-CCcceEcc
Confidence            6  789999 99755 5689999988777777  9999999999952          35788998774 88888874


No 15 
>PHA02768 hypothetical protein; Provisional
Probab=99.11  E-value=2.5e-11  Score=58.30  Aligned_cols=42  Identities=14%  Similarity=0.324  Sum_probs=21.3

Q ss_pred             ccCCCChhhhcchhHHhhHHhhhcCCCCCCcCCcchhhhccCchHH
Q psy12196         86 YQCNECPESFERLNKLKRHKFQAHNDSVHQIQCPYCITDFSEDKNL  131 (150)
Q Consensus        86 ~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~~C~~C~~~f~~~~~l  131 (150)
                      |.|++||+.|...+.|..|+++|+  +  +++|..|++.|...+.|
T Consensus         6 y~C~~CGK~Fs~~~~L~~H~r~H~--k--~~kc~~C~k~f~~~s~l   47 (55)
T PHA02768          6 YECPICGEIYIKRKSMITHLRKHN--T--NLKLSNCKRISLRTGEY   47 (55)
T ss_pred             cCcchhCCeeccHHHHHHHHHhcC--C--cccCCcccceeccccee
Confidence            455555555555555555555544  2  44555555555544433


No 16 
>PHA02768 hypothetical protein; Provisional
Probab=99.11  E-value=3.8e-11  Score=57.66  Aligned_cols=44  Identities=11%  Similarity=0.381  Sum_probs=34.5

Q ss_pred             ccccCCCCcccCChHHHHHHHHhhcCCCcccCCCChhhhcchhHHh
Q psy12196         57 MFTCRRCPSTFLNSATLSKHVKMEHNSKSYQCNECPESFERLNKLK  102 (150)
Q Consensus        57 ~~~c~~c~~~f~~~~~l~~h~~~~~~~~~~~c~~c~~~~~~~~~l~  102 (150)
                      -|.|++||+.|.....|..|++.|+  +++.|..|++.|...+.|.
T Consensus         5 ~y~C~~CGK~Fs~~~~L~~H~r~H~--k~~kc~~C~k~f~~~s~l~   48 (55)
T PHA02768          5 GYECPICGEIYIKRKSMITHLRKHN--TNLKLSNCKRISLRTGEYI   48 (55)
T ss_pred             ccCcchhCCeeccHHHHHHHHHhcC--CcccCCcccceecccceeE
Confidence            3678888888888888888888888  6788888888887766553


No 17 
>PHA00616 hypothetical protein
Probab=99.04  E-value=1.4e-10  Score=53.04  Aligned_cols=32  Identities=34%  Similarity=0.507  Sum_probs=27.7

Q ss_pred             CcCCcchhhhccCchHHHHHHHHhcCCCCCCC
Q psy12196        115 QIQCPYCITDFSEDKNLIQHIVSVHLGKEGTA  146 (150)
Q Consensus       115 ~~~C~~C~~~f~~~~~l~~H~~~~~~~~~~~~  146 (150)
                      ||+|+.||+.|..+++|.+|++.+|+++++.+
T Consensus         1 pYqC~~CG~~F~~~s~l~~H~r~~hg~~~~~~   32 (44)
T PHA00616          1 MYQCLRCGGIFRKKKEVIEHLLSVHKQNKLTL   32 (44)
T ss_pred             CCccchhhHHHhhHHHHHHHHHHhcCCCccce
Confidence            57899999999999999999999999888754


No 18 
>KOG3993|consensus
Probab=98.88  E-value=3.1e-10  Score=75.46  Aligned_cols=78  Identities=23%  Similarity=0.481  Sum_probs=50.4

Q ss_pred             CCCCcccccccCHHHHHHHHHHHhhCCCcceecccccccccChHHHHHHHhccC--------------------------
Q psy12196          1 MSCVPCDVLFHNKATLYKHLYLEHKATSLSIQCNMCSLVLDSKESLVTHISQTH--------------------------   54 (150)
Q Consensus         1 ~~C~~C~~~f~~~~~l~~h~~~~~~~~~~~~~c~~c~~~f~~~~~l~~h~~~~~--------------------------   54 (150)
                      |.|..|-..|.+...|.+|.-.  ......|+|+.|++.|+...+|..|. +=|                          
T Consensus       268 yiCqLCK~kYeD~F~LAQHrC~--RIV~vEYrCPEC~KVFsCPANLASHR-RWHKPR~eaa~a~~~P~k~~~~~rae~~e  344 (500)
T KOG3993|consen  268 YICQLCKEKYEDAFALAQHRCP--RIVHVEYRCPECDKVFSCPANLASHR-RWHKPRPEAAKAGSPPPKQAVETRAEVQE  344 (500)
T ss_pred             HHHHHHHHhhhhHHHHhhccCC--eeEEeeecCCcccccccCchhhhhhh-cccCCchhhhhcCCCChhhhhhhhhhhhh
Confidence            4566677777777777766422  11234467777777777777776664 111                          


Q ss_pred             ---------CcccccCCCCcccCChHHHHHHHHhhc
Q psy12196         55 ---------TLMFTCRRCPSTFLNSATLSKHVKMEH   81 (150)
Q Consensus        55 ---------~~~~~c~~c~~~f~~~~~l~~h~~~~~   81 (150)
                               ...|.|..|++.|.....|..|+.+|+
T Consensus       345 a~rsg~dss~gi~~C~~C~KkFrRqAYLrKHqlthq  380 (500)
T KOG3993|consen  345 AERSGDDSSSGIFSCHTCGKKFRRQAYLRKHQLTHQ  380 (500)
T ss_pred             ccccCCcccCceeecHHhhhhhHHHHHHHHhHHhhh
Confidence                     124778888888888888888877775


No 19 
>PF13465 zf-H2C2_2:  Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A ....
Probab=98.83  E-value=2e-09  Score=44.42  Aligned_cols=24  Identities=33%  Similarity=0.808  Sum_probs=14.8

Q ss_pred             HHHHHHhhcCCCcccCCCChhhhc
Q psy12196         73 LSKHVKMEHNSKSYQCNECPESFE   96 (150)
Q Consensus        73 l~~h~~~~~~~~~~~c~~c~~~~~   96 (150)
                      |..|++.|++++||.|++|++.|.
T Consensus         2 l~~H~~~H~~~k~~~C~~C~k~F~   25 (26)
T PF13465_consen    2 LRRHMRTHTGEKPYKCPYCGKSFS   25 (26)
T ss_dssp             HHHHHHHHSSSSSEEESSSSEEES
T ss_pred             HHHHhhhcCCCCCCCCCCCcCeeC
Confidence            556666666666666666666553


No 20 
>PF05605 zf-Di19:  Drought induced 19 protein (Di19), zinc-binding;  InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins. Di19 has been found to be strongly expressed in both the roots and leaves of Arabidopsis thaliana during progressive drought [], whilst RING finger proteins are thought to play a role in spermatogenesis. The precise function is unknown.
Probab=98.75  E-value=2.5e-08  Score=48.76  Aligned_cols=53  Identities=28%  Similarity=0.521  Sum_probs=38.7

Q ss_pred             cccCCCChhhhcchhHHhhHHhhhcCCCCCCcCCcchhhhccCchHHHHHHHHhcC
Q psy12196         85 SYQCNECPESFERLNKLKRHKFQAHNDSVHQIQCPYCITDFSEDKNLIQHIVSVHL  140 (150)
Q Consensus        85 ~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~~C~~C~~~f~~~~~l~~H~~~~~~  140 (150)
                      .|.|+.|++ ......|..|....+....+.+.||+|...+.  .+|..|+..+|+
T Consensus         2 ~f~CP~C~~-~~~~~~L~~H~~~~H~~~~~~v~CPiC~~~~~--~~l~~Hl~~~H~   54 (54)
T PF05605_consen    2 SFTCPYCGK-GFSESSLVEHCEDEHRSESKNVVCPICSSRVT--DNLIRHLNSQHR   54 (54)
T ss_pred             CcCCCCCCC-ccCHHHHHHHHHhHCcCCCCCccCCCchhhhh--hHHHHHHHHhcC
Confidence            377888888 44556788887776655555788999987655  488889888774


No 21 
>PF13465 zf-H2C2_2:  Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A ....
Probab=98.72  E-value=4.6e-09  Score=43.28  Aligned_cols=26  Identities=35%  Similarity=0.781  Sum_probs=22.9

Q ss_pred             HHhhHHhhhcCCCCCCcCCcchhhhccC
Q psy12196        100 KLKRHKFQAHNDSVHQIQCPYCITDFSE  127 (150)
Q Consensus       100 ~l~~h~~~~~~~~~~~~~C~~C~~~f~~  127 (150)
                      +|..|+++|++++  ||.|+.|++.|.+
T Consensus         1 ~l~~H~~~H~~~k--~~~C~~C~k~F~~   26 (26)
T PF13465_consen    1 NLRRHMRTHTGEK--PYKCPYCGKSFSN   26 (26)
T ss_dssp             HHHHHHHHHSSSS--SEEESSSSEEESS
T ss_pred             CHHHHhhhcCCCC--CCCCCCCcCeeCc
Confidence            4788999999988  9999999999863


No 22 
>KOG3993|consensus
Probab=98.68  E-value=1.2e-08  Score=68.17  Aligned_cols=107  Identities=15%  Similarity=0.318  Sum_probs=72.3

Q ss_pred             eecccccccccChHHHHHHH-hccCCcccccCCCCcccCChHHHHHHHHhhcCCCccc---CCCChhhhcchhHHhhHHh
Q psy12196         31 IQCNMCSLVLDSKESLVTHI-SQTHTLMFTCRRCPSTFLNSATLSKHVKMEHNSKSYQ---CNECPESFERLNKLKRHKF  106 (150)
Q Consensus        31 ~~c~~c~~~f~~~~~l~~h~-~~~~~~~~~c~~c~~~f~~~~~l~~h~~~~~~~~~~~---c~~c~~~~~~~~~l~~h~~  106 (150)
                      |.|..|...|.+...|.+|. .++....|.|++|++.|.-..+|..|.+=|.......   -+-=..........+.-.+
T Consensus       268 yiCqLCK~kYeD~F~LAQHrC~RIV~vEYrCPEC~KVFsCPANLASHRRWHKPR~eaa~a~~~P~k~~~~~rae~~ea~r  347 (500)
T KOG3993|consen  268 YICQLCKEKYEDAFALAQHRCPRIVHVEYRCPECDKVFSCPANLASHRRWHKPRPEAAKAGSPPPKQAVETRAEVQEAER  347 (500)
T ss_pred             HHHHHHHHhhhhHHHHhhccCCeeEEeeecCCcccccccCchhhhhhhcccCCchhhhhcCCCChhhhhhhhhhhhhccc
Confidence            88999999999999999994 2233378999999999999999999988775432111   0000000001100000000


Q ss_pred             --hhcCCCCCCcCCcchhhhccCchHHHHHHHHhc
Q psy12196        107 --QAHNDSVHQIQCPYCITDFSEDKNLIQHIVSVH  139 (150)
Q Consensus       107 --~~~~~~~~~~~C~~C~~~f~~~~~l~~H~~~~~  139 (150)
                        ....++  .|.|..|+|.|.....|..|+.+|+
T Consensus       348 sg~dss~g--i~~C~~C~KkFrRqAYLrKHqlthq  380 (500)
T KOG3993|consen  348 SGDDSSSG--IFSCHTCGKKFRRQAYLRKHQLTHQ  380 (500)
T ss_pred             cCCcccCc--eeecHHhhhhhHHHHHHHHhHHhhh
Confidence              012233  7999999999999999999999997


No 23 
>PF05605 zf-Di19:  Drought induced 19 protein (Di19), zinc-binding;  InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins. Di19 has been found to be strongly expressed in both the roots and leaves of Arabidopsis thaliana during progressive drought [], whilst RING finger proteins are thought to play a role in spermatogenesis. The precise function is unknown.
Probab=98.65  E-value=7.7e-08  Score=47.02  Aligned_cols=48  Identities=25%  Similarity=0.566  Sum_probs=27.6

Q ss_pred             CCCCcccccccCHHHHHHHHHHHhhCCCcceecccccccccChHHHHHHHh
Q psy12196          1 MSCVPCDVLFHNKATLYKHLYLEHKATSLSIQCNMCSLVLDSKESLVTHIS   51 (150)
Q Consensus         1 ~~C~~C~~~f~~~~~l~~h~~~~~~~~~~~~~c~~c~~~f~~~~~l~~h~~   51 (150)
                      |.|++|++ --+...|..|....|....+.+.||.|...+.  ..|..|+.
T Consensus         3 f~CP~C~~-~~~~~~L~~H~~~~H~~~~~~v~CPiC~~~~~--~~l~~Hl~   50 (54)
T PF05605_consen    3 FTCPYCGK-GFSESSLVEHCEDEHRSESKNVVCPICSSRVT--DNLIRHLN   50 (54)
T ss_pred             cCCCCCCC-ccCHHHHHHHHHhHCcCCCCCccCCCchhhhh--hHHHHHHH
Confidence            55666666 34456666666666654445566666665433  25555553


No 24 
>PHA00616 hypothetical protein
Probab=98.64  E-value=1.7e-08  Score=46.25  Aligned_cols=32  Identities=22%  Similarity=0.504  Sum_probs=17.7

Q ss_pred             ccccCCCCcccCChHHHHHHHHhhcCCCcccC
Q psy12196         57 MFTCRRCPSTFLNSATLSKHVKMEHNSKSYQC   88 (150)
Q Consensus        57 ~~~c~~c~~~f~~~~~l~~h~~~~~~~~~~~c   88 (150)
                      ||+|+.||+.|.....+..|++.|+|++++.|
T Consensus         1 pYqC~~CG~~F~~~s~l~~H~r~~hg~~~~~~   32 (44)
T PHA00616          1 MYQCLRCGGIFRKKKEVIEHLLSVHKQNKLTL   32 (44)
T ss_pred             CCccchhhHHHhhHHHHHHHHHHhcCCCccce
Confidence            34555555555555555555555555555544


No 25 
>PHA00732 hypothetical protein
Probab=98.58  E-value=2.8e-08  Score=52.19  Aligned_cols=46  Identities=28%  Similarity=0.594  Sum_probs=34.4

Q ss_pred             ccccCCCCcccCChHHHHHHHHh-hcCCCcccCCCChhhhcchhHHhhHHhhh
Q psy12196         57 MFTCRRCPSTFLNSATLSKHVKM-EHNSKSYQCNECPESFERLNKLKRHKFQA  108 (150)
Q Consensus        57 ~~~c~~c~~~f~~~~~l~~h~~~-~~~~~~~~c~~c~~~~~~~~~l~~h~~~~  108 (150)
                      ||.|..|++.|.+...|..|++. |.+   +.|++|++.|..   +..|.++.
T Consensus         1 py~C~~Cgk~F~s~s~Lk~H~r~~H~~---~~C~~CgKsF~~---l~~H~~~~   47 (79)
T PHA00732          1 MFKCPICGFTTVTLFALKQHARRNHTL---TKCPVCNKSYRR---LNQHFYSQ   47 (79)
T ss_pred             CccCCCCCCccCCHHHHHHHhhcccCC---CccCCCCCEeCC---hhhhhccc
Confidence            57788888888888888888874 543   578888888873   56676443


No 26 
>PHA00732 hypothetical protein
Probab=98.46  E-value=1.6e-07  Score=49.37  Aligned_cols=37  Identities=22%  Similarity=0.578  Sum_probs=19.4

Q ss_pred             eecccccccccChHHHHHHHhccCCcccccCCCCcccC
Q psy12196         31 IQCNMCSLVLDSKESLVTHISQTHTLMFTCRRCPSTFL   68 (150)
Q Consensus        31 ~~c~~c~~~f~~~~~l~~h~~~~~~~~~~c~~c~~~f~   68 (150)
                      |.|..|++.|.+...|..|+...+. ++.|+.|++.|.
T Consensus         2 y~C~~Cgk~F~s~s~Lk~H~r~~H~-~~~C~~CgKsF~   38 (79)
T PHA00732          2 FKCPICGFTTVTLFALKQHARRNHT-LTKCPVCNKSYR   38 (79)
T ss_pred             ccCCCCCCccCCHHHHHHHhhcccC-CCccCCCCCEeC
Confidence            4555666666665556655422222 335556665554


No 27 
>PF00096 zf-C2H2:  Zinc finger, C2H2 type;  InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger: #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C], where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter []. This entry represents the classical C2H2 zinc finger domain.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0005622 intracellular; PDB: 2D9H_A 2EPC_A 1SP1_A 1VA3_A 2WBT_B 2ELR_A 2YTP_A 2YTT_A 1VA1_A 2ELO_A ....
Probab=98.42  E-value=9.1e-08  Score=38.23  Aligned_cols=23  Identities=35%  Similarity=0.700  Sum_probs=18.3

Q ss_pred             cCCcchhhhccCchHHHHHHHHh
Q psy12196        116 IQCPYCITDFSEDKNLIQHIVSV  138 (150)
Q Consensus       116 ~~C~~C~~~f~~~~~l~~H~~~~  138 (150)
                      |.|+.|++.|.....|..|++.|
T Consensus         1 y~C~~C~~~f~~~~~l~~H~~~H   23 (23)
T PF00096_consen    1 YKCPICGKSFSSKSNLKRHMRRH   23 (23)
T ss_dssp             EEETTTTEEESSHHHHHHHHHHH
T ss_pred             CCCCCCCCccCCHHHHHHHHhHC
Confidence            56888888888888888888763


No 28 
>PF13894 zf-C2H2_4:  C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A ....
Probab=98.30  E-value=3.6e-07  Score=36.76  Aligned_cols=24  Identities=38%  Similarity=0.757  Sum_probs=18.2

Q ss_pred             cCCcchhhhccCchHHHHHHHHhc
Q psy12196        116 IQCPYCITDFSEDKNLIQHIVSVH  139 (150)
Q Consensus       116 ~~C~~C~~~f~~~~~l~~H~~~~~  139 (150)
                      |.|+.|++.|.+...|..|+.++|
T Consensus         1 ~~C~~C~~~~~~~~~l~~H~~~~H   24 (24)
T PF13894_consen    1 FQCPICGKSFRSKSELRQHMRTHH   24 (24)
T ss_dssp             EE-SSTS-EESSHHHHHHHHHHHS
T ss_pred             CCCcCCCCcCCcHHHHHHHHHhhC
Confidence            568888888888888888888775


No 29 
>PF00096 zf-C2H2:  Zinc finger, C2H2 type;  InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger: #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C], where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter []. This entry represents the classical C2H2 zinc finger domain.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0005622 intracellular; PDB: 2D9H_A 2EPC_A 1SP1_A 1VA3_A 2WBT_B 2ELR_A 2YTP_A 2YTT_A 1VA1_A 2ELO_A ....
Probab=98.23  E-value=7.4e-07  Score=35.51  Aligned_cols=22  Identities=27%  Similarity=0.557  Sum_probs=17.5

Q ss_pred             CCCCcccccccCHHHHHHHHHH
Q psy12196          1 MSCVPCDVLFHNKATLYKHLYL   22 (150)
Q Consensus         1 ~~C~~C~~~f~~~~~l~~h~~~   22 (150)
                      |.|+.|++.|.+...|..|++.
T Consensus         1 y~C~~C~~~f~~~~~l~~H~~~   22 (23)
T PF00096_consen    1 YKCPICGKSFSSKSNLKRHMRR   22 (23)
T ss_dssp             EEETTTTEEESSHHHHHHHHHH
T ss_pred             CCCCCCCCccCCHHHHHHHHhH
Confidence            5688888888888888888765


No 30 
>PF12756 zf-C2H2_2:  C2H2 type zinc-finger (2 copies); PDB: 2DMI_A.
Probab=98.19  E-value=1.2e-06  Score=48.42  Aligned_cols=73  Identities=22%  Similarity=0.398  Sum_probs=19.5

Q ss_pred             CCCcccccccCHHHHHHHHHHHhhCCCcceecccccccccChHHHHHHHhccCCcccccCCCCcccCChHHHHHHHHhh
Q psy12196          2 SCVPCDVLFHNKATLYKHLYLEHKATSLSIQCNMCSLVLDSKESLVTHISQTHTLMFTCRRCPSTFLNSATLSKHVKME   80 (150)
Q Consensus         2 ~C~~C~~~f~~~~~l~~h~~~~~~~~~~~~~c~~c~~~f~~~~~l~~h~~~~~~~~~~c~~c~~~f~~~~~l~~h~~~~   80 (150)
                      +|..|+..|.+...|..|+...|....     + ....+.....+...+...-...+.|..|+..|.+...|..|+..+
T Consensus         1 ~C~~C~~~f~~~~~l~~H~~~~H~~~~-----~-~~~~l~~~~~~~~~~~~~~~~~~~C~~C~~~f~s~~~l~~Hm~~~   73 (100)
T PF12756_consen    1 QCLFCDESFSSVDDLLQHMKKKHGFDI-----P-DQKYLVDPNRLLNYLRKKVKESFRCPYCNKTFRSREALQEHMRSK   73 (100)
T ss_dssp             ------------------------------------------------------SSEEBSSSS-EESSHHHHHHHHHHT
T ss_pred             Ccccccccccccccccccccccccccc-----c-cccccccccccccccccccCCCCCCCccCCCCcCHHHHHHHHcCc
Confidence            588899999999999999877665211     1 111112233333333222224678888888888888888888864


No 31 
>PF13894 zf-C2H2_4:  C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A ....
Probab=98.11  E-value=2e-06  Score=34.46  Aligned_cols=24  Identities=29%  Similarity=0.628  Sum_probs=17.1

Q ss_pred             CCCCcccccccCHHHHHHHHHHHh
Q psy12196          1 MSCVPCDVLFHNKATLYKHLYLEH   24 (150)
Q Consensus         1 ~~C~~C~~~f~~~~~l~~h~~~~~   24 (150)
                      |+|+.|+..|.+...|..|+..+|
T Consensus         1 ~~C~~C~~~~~~~~~l~~H~~~~H   24 (24)
T PF13894_consen    1 FQCPICGKSFRSKSELRQHMRTHH   24 (24)
T ss_dssp             EE-SSTS-EESSHHHHHHHHHHHS
T ss_pred             CCCcCCCCcCCcHHHHHHHHHhhC
Confidence            568888888888888888877643


No 32 
>PF13912 zf-C2H2_6:  C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B.
Probab=98.08  E-value=6.7e-07  Score=37.15  Aligned_cols=25  Identities=28%  Similarity=0.361  Sum_probs=18.3

Q ss_pred             CcCCcchhhhccCchHHHHHHHHhc
Q psy12196        115 QIQCPYCITDFSEDKNLIQHIVSVH  139 (150)
Q Consensus       115 ~~~C~~C~~~f~~~~~l~~H~~~~~  139 (150)
                      +|.|..|++.|.+..+|..|++.|+
T Consensus         1 ~~~C~~C~~~F~~~~~l~~H~~~h~   25 (27)
T PF13912_consen    1 PFECDECGKTFSSLSALREHKRSHC   25 (27)
T ss_dssp             SEEETTTTEEESSHHHHHHHHCTTT
T ss_pred             CCCCCccCCccCChhHHHHHhHHhc
Confidence            4667777777777777777776664


No 33 
>PF09237 GAGA:  GAGA factor;  InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  Members of this entry bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 1YUI_A 1YUJ_A.
Probab=98.05  E-value=3.5e-06  Score=39.53  Aligned_cols=31  Identities=29%  Similarity=0.594  Sum_probs=22.7

Q ss_pred             CCcCCcchhhhccCchHHHHHHHHhcCCCCC
Q psy12196        114 HQIQCPYCITDFSEDKNLIQHIVSVHLGKEG  144 (150)
Q Consensus       114 ~~~~C~~C~~~f~~~~~l~~H~~~~~~~~~~  144 (150)
                      .|-.|++|+..+....+|.+|++..|+.+|.
T Consensus        23 ~PatCP~C~a~~~~srnLrRHle~~H~~k~~   53 (54)
T PF09237_consen   23 QPATCPICGAVIRQSRNLRRHLEIRHFKKPG   53 (54)
T ss_dssp             --EE-TTT--EESSHHHHHHHHHHHTTTS--
T ss_pred             CCCCCCcchhhccchhhHHHHHHHHhcccCC
Confidence            3788999999999999999999999988874


No 34 
>PF12756 zf-C2H2_2:  C2H2 type zinc-finger (2 copies); PDB: 2DMI_A.
Probab=97.99  E-value=2.8e-06  Score=46.96  Aligned_cols=73  Identities=23%  Similarity=0.408  Sum_probs=17.8

Q ss_pred             ccCCCCcccCChHHHHHHHHhhcCCCcccCCCChhhhcchhHHhhHHhhhcCCCCCCcCCcchhhhccCchHHHHHHHHh
Q psy12196         59 TCRRCPSTFLNSATLSKHVKMEHNSKSYQCNECPESFERLNKLKRHKFQAHNDSVHQIQCPYCITDFSEDKNLIQHIVSV  138 (150)
Q Consensus        59 ~c~~c~~~f~~~~~l~~h~~~~~~~~~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~~C~~C~~~f~~~~~l~~H~~~~  138 (150)
                      +|..|+..|.+...+..|+...++-..-..    ..+.....+..+.... -..  .+.|..|++.|.+...|..|+..+
T Consensus         1 ~C~~C~~~f~~~~~l~~H~~~~H~~~~~~~----~~l~~~~~~~~~~~~~-~~~--~~~C~~C~~~f~s~~~l~~Hm~~~   73 (100)
T PF12756_consen    1 QCLFCDESFSSVDDLLQHMKKKHGFDIPDQ----KYLVDPNRLLNYLRKK-VKE--SFRCPYCNKTFRSREALQEHMRSK   73 (100)
T ss_dssp             -----------------------------------------------------S--SEEBSSSS-EESSHHHHHHHHHHT
T ss_pred             Cccccccccccccccccccccccccccccc----cccccccccccccccc-cCC--CCCCCccCCCCcCHHHHHHHHcCc
Confidence            366677777777777777765544321100    1111222222222111 111  467888888888888888888765


No 35 
>smart00355 ZnF_C2H2 zinc finger.
Probab=97.78  E-value=2.6e-05  Score=31.63  Aligned_cols=23  Identities=26%  Similarity=0.560  Sum_probs=17.6

Q ss_pred             cCCcchhhhccCchHHHHHHHHh
Q psy12196        116 IQCPYCITDFSEDKNLIQHIVSV  138 (150)
Q Consensus       116 ~~C~~C~~~f~~~~~l~~H~~~~  138 (150)
                      |.|+.|++.|.....|..|+..|
T Consensus         1 ~~C~~C~~~f~~~~~l~~H~~~H   23 (26)
T smart00355        1 YRCPECGKVFKSKSALKEHMRTH   23 (26)
T ss_pred             CCCCCCcchhCCHHHHHHHHHHh
Confidence            46778888888888888887754


No 36 
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning]
Probab=97.71  E-value=1.1e-05  Score=52.67  Aligned_cols=69  Identities=17%  Similarity=0.296  Sum_probs=42.4

Q ss_pred             CcccccCC--CCcccCChHHHHHHHHhhc-CCCcccCCCChhhhcchhHHhhHHhhhcCCCCCCcCCcchhhhccCchHH
Q psy12196         55 TLMFTCRR--CPSTFLNSATLSKHVKMEH-NSKSYQCNECPESFERLNKLKRHKFQAHNDSVHQIQCPYCITDFSEDKNL  131 (150)
Q Consensus        55 ~~~~~c~~--c~~~f~~~~~l~~h~~~~~-~~~~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~~C~~C~~~f~~~~~l  131 (150)
                      ++||+|++  |+++|.+...|.-|+...+ ..+...-+          .-..+...  ..+.+||+|+.|+|.+...-.|
T Consensus       347 ~KpykCpV~gC~K~YknqnGLKYH~lhGH~~~~~~~~p----------~p~~~~~F--~~~~KPYrCevC~KRYKNlNGL  414 (423)
T COG5189         347 GKPYKCPVEGCNKKYKNQNGLKYHMLHGHQNQKLHENP----------SPEKMNIF--SAKDKPYRCEVCDKRYKNLNGL  414 (423)
T ss_pred             CceecCCCCCchhhhccccchhhhhhccccCcccCCCC----------Cccccccc--cccCCceeccccchhhccCccc
Confidence            38999988  9999999999999877533 22211100          00011111  2233478888888887777777


Q ss_pred             HHHH
Q psy12196        132 IQHI  135 (150)
Q Consensus       132 ~~H~  135 (150)
                      ..|.
T Consensus       415 KYHr  418 (423)
T COG5189         415 KYHR  418 (423)
T ss_pred             eecc
Confidence            6665


No 37 
>PF13909 zf-H2C2_5:  C2H2-type zinc-finger domain; PDB: 1X5W_A.
Probab=97.69  E-value=2.1e-05  Score=31.54  Aligned_cols=24  Identities=33%  Similarity=0.589  Sum_probs=17.7

Q ss_pred             cCCcchhhhccCchHHHHHHHHhcC
Q psy12196        116 IQCPYCITDFSEDKNLIQHIVSVHL  140 (150)
Q Consensus       116 ~~C~~C~~~f~~~~~l~~H~~~~~~  140 (150)
                      |+|+.|+.... ...|.+|++.+|+
T Consensus         1 y~C~~C~y~t~-~~~l~~H~~~~H~   24 (24)
T PF13909_consen    1 YKCPHCSYSTS-KSNLKRHLKRHHP   24 (24)
T ss_dssp             EE-SSSS-EES-HHHHHHHHHHHHS
T ss_pred             CCCCCCCCcCC-HHHHHHHHHhhCc
Confidence            57888888887 8888888888774


No 38 
>PF13912 zf-C2H2_6:  C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B.
Probab=97.65  E-value=3.2e-05  Score=31.95  Aligned_cols=19  Identities=32%  Similarity=0.679  Sum_probs=7.3

Q ss_pred             ccCCCCcccCChHHHHHHH
Q psy12196         59 TCRRCPSTFLNSATLSKHV   77 (150)
Q Consensus        59 ~c~~c~~~f~~~~~l~~h~   77 (150)
                      .|..|+..|.+...|..|+
T Consensus         3 ~C~~C~~~F~~~~~l~~H~   21 (27)
T PF13912_consen    3 ECDECGKTFSSLSALREHK   21 (27)
T ss_dssp             EETTTTEEESSHHHHHHHH
T ss_pred             CCCccCCccCChhHHHHHh
Confidence            3333333333333333333


No 39 
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning]
Probab=97.57  E-value=2.6e-05  Score=50.93  Aligned_cols=25  Identities=24%  Similarity=0.655  Sum_probs=16.7

Q ss_pred             CcCCcc--hhhhccCchHHHHHHHHhc
Q psy12196        115 QIQCPY--CITDFSEDKNLIQHIVSVH  139 (150)
Q Consensus       115 ~~~C~~--C~~~f~~~~~l~~H~~~~~  139 (150)
                      ||+|++  |+|.+...-.|..|+.-.|
T Consensus       349 pykCpV~gC~K~YknqnGLKYH~lhGH  375 (423)
T COG5189         349 PYKCPVEGCNKKYKNQNGLKYHMLHGH  375 (423)
T ss_pred             eecCCCCCchhhhccccchhhhhhccc
Confidence            777754  7777777777777765444


No 40 
>smart00355 ZnF_C2H2 zinc finger.
Probab=97.56  E-value=0.00012  Score=29.58  Aligned_cols=22  Identities=27%  Similarity=0.647  Sum_probs=18.7

Q ss_pred             CCCCcccccccCHHHHHHHHHH
Q psy12196          1 MSCVPCDVLFHNKATLYKHLYL   22 (150)
Q Consensus         1 ~~C~~C~~~f~~~~~l~~h~~~   22 (150)
                      |.|+.|++.|.....|..|++.
T Consensus         1 ~~C~~C~~~f~~~~~l~~H~~~   22 (26)
T smart00355        1 YRCPECGKVFKSKSALKEHMRT   22 (26)
T ss_pred             CCCCCCcchhCCHHHHHHHHHH
Confidence            5788899999999998888875


No 41 
>KOG2231|consensus
Probab=97.43  E-value=0.00063  Score=49.35  Aligned_cols=134  Identities=23%  Similarity=0.364  Sum_probs=82.3

Q ss_pred             CCCcccccc---------------cCHHHHHHHHHHHhhCCCcceecccccc---------cccChHHHHHHHhccCC--
Q psy12196          2 SCVPCDVLF---------------HNKATLYKHLYLEHKATSLSIQCNMCSL---------VLDSKESLVTHISQTHT--   55 (150)
Q Consensus         2 ~C~~C~~~f---------------~~~~~l~~h~~~~~~~~~~~~~c~~c~~---------~f~~~~~l~~h~~~~~~--   55 (150)
                      .|..|+..|               .....|+.|+...|.    .+-|..|..         .......|..|+ +.+.  
T Consensus       101 ~C~~C~~~~~~~~~~~~~~~c~~~~s~~~Lk~H~~~~H~----~~~c~lC~~~~kif~~e~k~Yt~~el~~h~-~~gd~d  175 (669)
T KOG2231|consen  101 SCHICDRRFRALYNKKECLHCTEFKSVENLKNHMRDQHK----LHLCSLCLQNLKIFINERKLYTRAELNLHL-MFGDPD  175 (669)
T ss_pred             hcCccccchhhhcccCCCccccchhHHHHHHHHHHHhhh----hhccccccccceeeeeeeehehHHHHHHHH-hcCCCc
Confidence            577777666               367889999877664    234555532         233456777776 2221  


Q ss_pred             -----cccccCCCCcccCChHHHHHHHHhhcCCCcccCCCCh------hhhcchhHHhhHHhhhcCCCC-CCcCCcchhh
Q psy12196         56 -----LMFTCRRCPSTFLNSATLSKHVKMEHNSKSYQCNECP------ESFERLNKLKRHKFQAHNDSV-HQIQCPYCIT  123 (150)
Q Consensus        56 -----~~~~c~~c~~~f~~~~~l~~h~~~~~~~~~~~c~~c~------~~~~~~~~l~~h~~~~~~~~~-~~~~C~~C~~  123 (150)
                           .--.|..|...|.....|..|++.++    |.|..|+      ..|....+|..|-+..|-.-+ -...+..+..
T Consensus       176 ~~s~rGhp~C~~C~~~fld~~el~rH~~~~h----~~chfC~~~~~~neyy~~~~dLe~HfR~~HflCE~~~C~~~~f~~  251 (669)
T KOG2231|consen  176 DESCRGHPLCKFCHERFLDDDELYRHLRFDH----EFCHFCDYKTGQNEYYNDYDDLEEHFRKGHFLCEEEFCRTKKFYV  251 (669)
T ss_pred             cccccCCccchhhhhhhccHHHHHHhhccce----eheeecCcccccchhcccchHHHHHhhhcCccccccccccceeee
Confidence                 22468889999999999999999876    5666663      445667788888776543221 0222334444


Q ss_pred             hccCchHHHHHHHHhcCCCCC
Q psy12196        124 DFSEDKNLIQHIVSVHLGKEG  144 (150)
Q Consensus       124 ~f~~~~~l~~H~~~~~~~~~~  144 (150)
                      +|.....|.+|-+.+..|+.|
T Consensus       252 ~~~~ei~lk~~~~~~~~e~~~  272 (669)
T KOG2231|consen  252 AFELEIELKAHNRFIQHEKCY  272 (669)
T ss_pred             hhHHHHHHHhhccccchheec
Confidence            555566666555444444444


No 42 
>PF12874 zf-met:  Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A.
Probab=97.40  E-value=3.8e-05  Score=31.06  Aligned_cols=23  Identities=35%  Similarity=0.639  Sum_probs=17.6

Q ss_pred             cCCcchhhhccCchHHHHHHHHh
Q psy12196        116 IQCPYCITDFSEDKNLIQHIVSV  138 (150)
Q Consensus       116 ~~C~~C~~~f~~~~~l~~H~~~~  138 (150)
                      |.|..|++.|.+...|..|++++
T Consensus         1 ~~C~~C~~~f~s~~~~~~H~~s~   23 (25)
T PF12874_consen    1 FYCDICNKSFSSENSLRQHLRSK   23 (25)
T ss_dssp             EEETTTTEEESSHHHHHHHHTTH
T ss_pred             CCCCCCCCCcCCHHHHHHHHCcC
Confidence            45778888888888888887654


No 43 
>PF13909 zf-H2C2_5:  C2H2-type zinc-finger domain; PDB: 1X5W_A.
Probab=97.35  E-value=0.00017  Score=28.84  Aligned_cols=23  Identities=30%  Similarity=0.528  Sum_probs=17.4

Q ss_pred             CCCCcccccccCHHHHHHHHHHHh
Q psy12196          1 MSCVPCDVLFHNKATLYKHLYLEH   24 (150)
Q Consensus         1 ~~C~~C~~~f~~~~~l~~h~~~~~   24 (150)
                      |+|+.|+.... ...|..|+..+|
T Consensus         1 y~C~~C~y~t~-~~~l~~H~~~~H   23 (24)
T PF13909_consen    1 YKCPHCSYSTS-KSNLKRHLKRHH   23 (24)
T ss_dssp             EE-SSSS-EES-HHHHHHHHHHHH
T ss_pred             CCCCCCCCcCC-HHHHHHHHHhhC
Confidence            67999998887 888999988765


No 44 
>PF09237 GAGA:  GAGA factor;  InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  Members of this entry bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 1YUI_A 1YUJ_A.
Probab=97.32  E-value=0.00029  Score=33.22  Aligned_cols=30  Identities=27%  Similarity=0.468  Sum_probs=16.6

Q ss_pred             cccccCCCCcccCChHHHHHHHHhhcCCCc
Q psy12196         56 LMFTCRRCPSTFLNSATLSKHVKMEHNSKS   85 (150)
Q Consensus        56 ~~~~c~~c~~~f~~~~~l~~h~~~~~~~~~   85 (150)
                      .|..||+|+..+..+.+|..|+...++.+|
T Consensus        23 ~PatCP~C~a~~~~srnLrRHle~~H~~k~   52 (54)
T PF09237_consen   23 QPATCPICGAVIRQSRNLRRHLEIRHFKKP   52 (54)
T ss_dssp             --EE-TTT--EESSHHHHHHHHHHHTTTS-
T ss_pred             CCCCCCcchhhccchhhHHHHHHHHhcccC
Confidence            566677777777777777777766666554


No 45 
>PF12171 zf-C2H2_jaz:  Zinc-finger double-stranded RNA-binding;  InterPro: IPR022755  This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length. The mammalian members of this group occur multiple times along the protein, joined by flexible linkers, and are referred to as JAZ - dsRNA-binding ZF protein - zinc-fingers. The JAZ proteins are expressed in all tissues tested and localise in the nucleus, particularly the nucleolus []. JAZ preferentially binds to double-stranded (ds) RNA or RNA/DNA hybrids rather than DNA. In addition to binding double-stranded RNA, these zinc-fingers are required for nucleolar localisation.   This entry represents the multiple-adjacent-C2H2 zinc finger, JAZ. ; PDB: 4DGW_A 1ZR9_A.
Probab=96.94  E-value=8.8e-05  Score=30.62  Aligned_cols=22  Identities=36%  Similarity=0.608  Sum_probs=14.2

Q ss_pred             cCCcchhhhccCchHHHHHHHH
Q psy12196        116 IQCPYCITDFSEDKNLIQHIVS  137 (150)
Q Consensus       116 ~~C~~C~~~f~~~~~l~~H~~~  137 (150)
                      |.|..|++.|.+...|..|+.+
T Consensus         2 ~~C~~C~k~f~~~~~~~~H~~s   23 (27)
T PF12171_consen    2 FYCDACDKYFSSENQLKQHMKS   23 (27)
T ss_dssp             CBBTTTTBBBSSHHHHHCCTTS
T ss_pred             CCcccCCCCcCCHHHHHHHHcc
Confidence            4566677777776666666644


No 46 
>PRK04860 hypothetical protein; Provisional
Probab=96.94  E-value=0.00047  Score=41.41  Aligned_cols=38  Identities=21%  Similarity=0.543  Sum_probs=26.0

Q ss_pred             cccCCCChhhhcchhHHhhHHhhhcCCCCCCcCCcchhhhccCc
Q psy12196         85 SYQCNECPESFERLNKLKRHKFQAHNDSVHQIQCPYCITDFSED  128 (150)
Q Consensus        85 ~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~~C~~C~~~f~~~  128 (150)
                      +|.|. |+.   ....+.+|.+++.+++  +|.|..|+..|...
T Consensus       119 ~Y~C~-C~~---~~~~~rrH~ri~~g~~--~YrC~~C~~~l~~~  156 (160)
T PRK04860        119 PYRCK-CQE---HQLTVRRHNRVVRGEA--VYRCRRCGETLVFK  156 (160)
T ss_pred             EEEcC-CCC---eeCHHHHHHHHhcCCc--cEECCCCCceeEEe
Confidence            47776 765   4556677777777766  77777777776654


No 47 
>PRK04860 hypothetical protein; Provisional
Probab=96.93  E-value=0.00036  Score=41.90  Aligned_cols=28  Identities=14%  Similarity=0.176  Sum_probs=13.3

Q ss_pred             CcCCcchhhhccCchHHHHHHHHhcCCCCCCC
Q psy12196        115 QIQCPYCITDFSEDKNLIQHIVSVHLGKEGTA  146 (150)
Q Consensus       115 ~~~C~~C~~~f~~~~~l~~H~~~~~~~~~~~~  146 (150)
                      +|.|. |++   ....+.+|.+++.++++|.|
T Consensus       119 ~Y~C~-C~~---~~~~~rrH~ri~~g~~~YrC  146 (160)
T PRK04860        119 PYRCK-CQE---HQLTVRRHNRVVRGEAVYRC  146 (160)
T ss_pred             EEEcC-CCC---eeCHHHHHHHHhcCCccEEC
Confidence            44454 443   33444455555555555444


No 48 
>PF12874 zf-met:  Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A.
Probab=96.77  E-value=0.0011  Score=26.64  Aligned_cols=19  Identities=26%  Similarity=0.772  Sum_probs=8.5

Q ss_pred             cCCCCcccCChHHHHHHHH
Q psy12196         60 CRRCPSTFLNSATLSKHVK   78 (150)
Q Consensus        60 c~~c~~~f~~~~~l~~h~~   78 (150)
                      |.+|+..|.+...+..|++
T Consensus         3 C~~C~~~f~s~~~~~~H~~   21 (25)
T PF12874_consen    3 CDICNKSFSSENSLRQHLR   21 (25)
T ss_dssp             ETTTTEEESSHHHHHHHHT
T ss_pred             CCCCCCCcCCHHHHHHHHC
Confidence            4444444444444444443


No 49 
>PF12171 zf-C2H2_jaz:  Zinc-finger double-stranded RNA-binding;  InterPro: IPR022755  This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length. The mammalian members of this group occur multiple times along the protein, joined by flexible linkers, and are referred to as JAZ - dsRNA-binding ZF protein - zinc-fingers. The JAZ proteins are expressed in all tissues tested and localise in the nucleus, particularly the nucleolus []. JAZ preferentially binds to double-stranded (ds) RNA or RNA/DNA hybrids rather than DNA. In addition to binding double-stranded RNA, these zinc-fingers are required for nucleolar localisation.   This entry represents the multiple-adjacent-C2H2 zinc finger, JAZ. ; PDB: 4DGW_A 1ZR9_A.
Probab=96.60  E-value=0.00082  Score=27.63  Aligned_cols=21  Identities=29%  Similarity=0.664  Sum_probs=15.7

Q ss_pred             CCCCcccccccCHHHHHHHHH
Q psy12196          1 MSCVPCDVLFHNKATLYKHLY   21 (150)
Q Consensus         1 ~~C~~C~~~f~~~~~l~~h~~   21 (150)
                      |-|..|++.|.+...+..|+.
T Consensus         2 ~~C~~C~k~f~~~~~~~~H~~   22 (27)
T PF12171_consen    2 FYCDACDKYFSSENQLKQHMK   22 (27)
T ss_dssp             CBBTTTTBBBSSHHHHHCCTT
T ss_pred             CCcccCCCCcCCHHHHHHHHc
Confidence            567788888888888777754


No 50 
>PF13913 zf-C2HC_2:  zinc-finger of a C2HC-type
Probab=96.23  E-value=0.0069  Score=24.39  Aligned_cols=19  Identities=37%  Similarity=0.532  Sum_probs=11.0

Q ss_pred             CCCcccccccCHHHHHHHHH
Q psy12196          2 SCVPCDVLFHNKATLYKHLY   21 (150)
Q Consensus         2 ~C~~C~~~f~~~~~l~~h~~   21 (150)
                      .|+.||+.| ....|..|+.
T Consensus         4 ~C~~CgR~F-~~~~l~~H~~   22 (25)
T PF13913_consen    4 PCPICGRKF-NPDRLEKHEK   22 (25)
T ss_pred             cCCCCCCEE-CHHHHHHHHH
Confidence            466666666 5555555543


No 51 
>KOG1146|consensus
Probab=96.12  E-value=0.0015  Score=50.64  Aligned_cols=51  Identities=25%  Similarity=0.479  Sum_probs=31.7

Q ss_pred             cccccCCCCcccCChHHHHHHHHhhc-------------------------CCCcccCCCChhhhcchhHHhhHHh
Q psy12196         56 LMFTCRRCPSTFLNSATLSKHVKMEH-------------------------NSKSYQCNECPESFERLNKLKRHKF  106 (150)
Q Consensus        56 ~~~~c~~c~~~f~~~~~l~~h~~~~~-------------------------~~~~~~c~~c~~~~~~~~~l~~h~~  106 (150)
                      +.+.|+.|+..|.....|..|+++.+                         +.++|.|..|...+....+|.+|++
T Consensus       464 kt~~cpkc~~~yk~a~~L~vhmRskhp~~~~~~c~~gq~~~~~arg~~~~~~~~p~~C~~C~~stttng~Lsihlq  539 (1406)
T KOG1146|consen  464 KTLKCPKCNWHYKLAQTLGVHMRSKHPESQSAYCKAGQNHPRLARGEVYRCPGKPYPCRACNYSTTTNGNLSIHLQ  539 (1406)
T ss_pred             ccccCCccchhhhhHHHhhhcccccccccchhHhHhccccccccccccccCCCCcccceeeeeeeecchHHHHHHH
Confidence            55666666666666666666666522                         2355666666666666666666654


No 52 
>smart00451 ZnF_U1 U1-like zinc finger. Family of C2H2-type zinc fingers, present in matrin, U1 small nuclear ribonucleoprotein C and other RNA-binding proteins.
Probab=95.74  E-value=0.0052  Score=26.78  Aligned_cols=24  Identities=17%  Similarity=0.491  Sum_probs=19.4

Q ss_pred             CcCCcchhhhccCchHHHHHHHHh
Q psy12196        115 QIQCPYCITDFSEDKNLIQHIVSV  138 (150)
Q Consensus       115 ~~~C~~C~~~f~~~~~l~~H~~~~  138 (150)
                      +|.|..|++.|.+...+..|+.+.
T Consensus         3 ~~~C~~C~~~~~~~~~~~~H~~gk   26 (35)
T smart00451        3 GFYCKLCNVTFTDEISVEAHLKGK   26 (35)
T ss_pred             CeEccccCCccCCHHHHHHHHChH
Confidence            577888999998888888887654


No 53 
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only]
Probab=95.62  E-value=0.022  Score=38.25  Aligned_cols=125  Identities=22%  Similarity=0.423  Sum_probs=80.4

Q ss_pred             CCCCc--ccccccCHHHHHHHHHHHhhCCCcceecccccc---ccc------ChHHHHHHHhccCC------cccccCCC
Q psy12196          1 MSCVP--CDVLFHNKATLYKHLYLEHKATSLSIQCNMCSL---VLD------SKESLVTHISQTHT------LMFTCRRC   63 (150)
Q Consensus         1 ~~C~~--C~~~f~~~~~l~~h~~~~~~~~~~~~~c~~c~~---~f~------~~~~l~~h~~~~~~------~~~~c~~c   63 (150)
                      |.|+.  |+........|..|.+..|.    -+.|..|..   .|.      ....|..|. ..+.      .--.|..|
T Consensus       152 F~CP~skc~~~C~~~k~lk~H~K~~H~----~~~C~~C~~nKk~F~~E~~lF~~~~Lr~H~-~~G~~e~GFKGHP~C~FC  226 (493)
T COG5236         152 FKCPKSKCHRRCGSLKELKKHYKAQHG----FVLCSECIGNKKDFWNEIRLFRSSTLRDHK-NGGLEEEGFKGHPLCIFC  226 (493)
T ss_pred             hcCCchhhhhhhhhHHHHHHHHHhhcC----cEEhHhhhcCcccCccceeeeecccccccc-cCCccccCcCCCchhhhc
Confidence            44554  67777778899999888664    245666632   232      334555564 2221      23469999


Q ss_pred             CcccCChHHHHHHHHhhcCCCcccCCCChh-------hhcchhHHhhHHhhhcCCCCCCcCCcc--hh----hhccCchH
Q psy12196         64 PSTFLNSATLSKHVKMEHNSKSYQCNECPE-------SFERLNKLKRHKFQAHNDSVHQIQCPY--CI----TDFSEDKN  130 (150)
Q Consensus        64 ~~~f~~~~~l~~h~~~~~~~~~~~c~~c~~-------~~~~~~~l~~h~~~~~~~~~~~~~C~~--C~----~~f~~~~~  130 (150)
                      ...|.+...|..|++..+.    .|-+|+.       .|.....|..|....      -|.|..  |.    ..|...-.
T Consensus       227 ~~~FYdDDEL~~HcR~~HE----~ChICD~v~p~~~QYFK~Y~~Le~HF~~~------hy~ct~qtc~~~k~~vf~~~~e  296 (493)
T COG5236         227 KIYFYDDDELRRHCRLRHE----ACHICDMVGPIRYQYFKSYEDLEAHFRNA------HYCCTFQTCRVGKCYVFPYHTE  296 (493)
T ss_pred             cceecChHHHHHHHHhhhh----hhhhhhccCccchhhhhCHHHHHHHhhcC------ceEEEEEEEecCcEEEeccHHH
Confidence            9999999999999997663    4555543       355666777775422      334422  21    36888999


Q ss_pred             HHHHHHHhcC
Q psy12196        131 LIQHIVSVHL  140 (150)
Q Consensus       131 l~~H~~~~~~  140 (150)
                      |+.|+...|+
T Consensus       297 l~~h~~~~h~  306 (493)
T COG5236         297 LLEHLTRFHK  306 (493)
T ss_pred             HHHHHHHHhh
Confidence            9999988774


No 54 
>TIGR00622 ssl1 transcription factor ssl1. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=95.45  E-value=0.02  Score=32.20  Aligned_cols=25  Identities=20%  Similarity=0.328  Sum_probs=18.3

Q ss_pred             CcCCcchhhhccCchHHHHHHHHhc
Q psy12196        115 QIQCPYCITDFSEDKNLIQHIVSVH  139 (150)
Q Consensus       115 ~~~C~~C~~~f~~~~~l~~H~~~~~  139 (150)
                      .|+|+.|...|...-++-.|-..|.
T Consensus        81 ~y~C~~C~~~FC~dCD~fiHe~Lh~  105 (112)
T TIGR00622        81 RYVCAVCKNVFCVDCDVFVHESLHC  105 (112)
T ss_pred             ceeCCCCCCccccccchhhhhhccC
Confidence            6778888888887777777765553


No 55 
>cd00350 rubredoxin_like Rubredoxin_like; nonheme iron binding domain containing a [Fe(SCys)4] center. The family includes rubredoxins, a small electron transfer protein, and a slightly smaller modular rubredoxin domain present in rubrerythrin and nigerythrin and detected either N- or C-terminal to such proteins as flavin reductase, NAD(P)H-nitrite reductase, and ferredoxin-thioredoxin reductase. In rubredoxin, the iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), but iron can also be replaced by cobalt, nickel or zinc and believed to be involved in electron transfer.  Rubrerythrins and nigerythrins are small homodimeric proteins, generally consisting of 2 domains: a rubredoxin domain C-terminal to a non-sulfur, oxo-bridged diiron site in the N-terminal rubrerythrin domain.  Rubrerythrins and nigerythrins have putative peroxide activity.
Probab=94.90  E-value=0.012  Score=25.39  Aligned_cols=9  Identities=33%  Similarity=0.818  Sum_probs=5.9

Q ss_pred             CcCCcchhh
Q psy12196        115 QIQCPYCIT  123 (150)
Q Consensus       115 ~~~C~~C~~  123 (150)
                      ++.||.|+.
T Consensus        17 ~~~CP~Cg~   25 (33)
T cd00350          17 PWVCPVCGA   25 (33)
T ss_pred             CCcCcCCCC
Confidence            667777763


No 56 
>KOG2482|consensus
Probab=94.77  E-value=0.11  Score=35.07  Aligned_cols=51  Identities=25%  Similarity=0.438  Sum_probs=29.3

Q ss_pred             cCCCChhhhcchhHHhhHHhhhcC--------C-----------------CCCCcCCcchhhhccCchHHHHHHHH
Q psy12196         87 QCNECPESFERLNKLKRHKFQAHN--------D-----------------SVHQIQCPYCITDFSEDKNLIQHIVS  137 (150)
Q Consensus        87 ~c~~c~~~~~~~~~l~~h~~~~~~--------~-----------------~~~~~~C~~C~~~f~~~~~l~~H~~~  137 (150)
                      +|-.|.....+...|..|+.+.+.        +                 ..+...|-.|.-.|-....|..||.-
T Consensus       281 ~CLfC~~~~en~~~l~eHmk~vHe~Dl~Ki~sd~~Ln~YqrvrviNyiRkq~~~~~c~~cd~~F~~e~~l~~hm~e  356 (423)
T KOG2482|consen  281 VCLFCTNFYENPVFLFEHMKIVHEFDLLKIQSDYSLNFYQRVRVINYIRKQKKKSRCAECDLSFWKEPGLLIHMVE  356 (423)
T ss_pred             EEEeeccchhhHHHHHHHHHHHHHhhHHhhccccccchhhhhhHHHHHHHHhhccccccccccccCcchhhhhccc
Confidence            566666666666666666654331        0                 01223466677677777777777643


No 57 
>KOG1146|consensus
Probab=94.60  E-value=0.016  Score=45.31  Aligned_cols=58  Identities=21%  Similarity=0.317  Sum_probs=47.6

Q ss_pred             cCCCcccCCCChhhhcchhHHhhHHhhhcCC-----------------------CCCCcCCcchhhhccCchHHHHHHHH
Q psy12196         81 HNSKSYQCNECPESFERLNKLKRHKFQAHND-----------------------SVHQIQCPYCITDFSEDKNLIQHIVS  137 (150)
Q Consensus        81 ~~~~~~~c~~c~~~~~~~~~l~~h~~~~~~~-----------------------~~~~~~C~~C~~~f~~~~~l~~H~~~  137 (150)
                      .-.+.+.|.+|+..|.....|..|++..+.+                       ..++|.|..|...++...+|..|+.+
T Consensus       461 S~~kt~~cpkc~~~yk~a~~L~vhmRskhp~~~~~~c~~gq~~~~~arg~~~~~~~~p~~C~~C~~stttng~LsihlqS  540 (1406)
T KOG1146|consen  461 SFFKTLKCPKCNWHYKLAQTLGVHMRSKHPESQSAYCKAGQNHPRLARGEVYRCPGKPYPCRACNYSTTTNGNLSIHLQS  540 (1406)
T ss_pred             cccccccCCccchhhhhHHHhhhcccccccccchhHhHhccccccccccccccCCCCcccceeeeeeeecchHHHHHHHH
Confidence            3457899999999999999999999874311                       12578999999999999999999865


Q ss_pred             h
Q psy12196        138 V  138 (150)
Q Consensus       138 ~  138 (150)
                      -
T Consensus       541 ~  541 (1406)
T KOG1146|consen  541 D  541 (1406)
T ss_pred             H
Confidence            3


No 58 
>COG4049 Uncharacterized protein containing archaeal-type C2H2 Zn-finger [General function prediction only]
Probab=94.54  E-value=0.029  Score=27.00  Aligned_cols=25  Identities=32%  Similarity=0.712  Sum_probs=21.2

Q ss_pred             CcCCcchhhhccCchHHHHHHHHhc
Q psy12196        115 QIQCPYCITDFSEDKNLIQHIVSVH  139 (150)
Q Consensus       115 ~~~C~~C~~~f~~~~~l~~H~~~~~  139 (150)
                      -+.||.|+..|....++.+|...-|
T Consensus        17 ~lrCPRC~~~FR~~K~Y~RHVNKaH   41 (65)
T COG4049          17 FLRCPRCGMVFRRRKDYIRHVNKAH   41 (65)
T ss_pred             eeeCCchhHHHHHhHHHHHHhhHHh
Confidence            7889999999999999999975555


No 59 
>KOG2231|consensus
Probab=93.53  E-value=0.15  Score=37.69  Aligned_cols=98  Identities=23%  Similarity=0.367  Sum_probs=61.1

Q ss_pred             ccccChHHHHHHHhccCCcccccCCC---C------cccCChHHHHHHHHhhcC-CC----cccCCCChhhhcchhHHhh
Q psy12196         38 LVLDSKESLVTHISQTHTLMFTCRRC---P------STFLNSATLSKHVKMEHN-SK----SYQCNECPESFERLNKLKR  103 (150)
Q Consensus        38 ~~f~~~~~l~~h~~~~~~~~~~c~~c---~------~~f~~~~~l~~h~~~~~~-~~----~~~c~~c~~~~~~~~~l~~  103 (150)
                      ..|.....|..|+...|+. +.|.+|   .      ........|..|+...-. ++    ...|..|...|.....|.+
T Consensus       122 ~~~~s~~~Lk~H~~~~H~~-~~c~lC~~~~kif~~e~k~Yt~~el~~h~~~gd~d~~s~rGhp~C~~C~~~fld~~el~r  200 (669)
T KOG2231|consen  122 TEFKSVENLKNHMRDQHKL-HLCSLCLQNLKIFINERKLYTRAELNLHLMFGDPDDESCRGHPLCKFCHERFLDDDELYR  200 (669)
T ss_pred             cchhHHHHHHHHHHHhhhh-hccccccccceeeeeeeehehHHHHHHHHhcCCCccccccCCccchhhhhhhccHHHHHH
Confidence            3344678888887555542 233333   1      222345566666654322 21    2468889999999999999


Q ss_pred             HHhhhcCCCCCCcCC---cchhhhccCchHHHHHHHHhc
Q psy12196        104 HKFQAHNDSVHQIQC---PYCITDFSEDKNLIQHIVSVH  139 (150)
Q Consensus       104 h~~~~~~~~~~~~~C---~~C~~~f~~~~~l~~H~~~~~  139 (150)
                      |++..+..-  -| |   +.++.-|....+|..|.+..|
T Consensus       201 H~~~~h~~c--hf-C~~~~~~neyy~~~~dLe~HfR~~H  236 (669)
T KOG2231|consen  201 HLRFDHEFC--HF-CDYKTGQNEYYNDYDDLEEHFRKGH  236 (669)
T ss_pred             hhccceehe--ee-cCcccccchhcccchHHHHHhhhcC
Confidence            987654432  22 3   345566888899999998887


No 60 
>KOG2893|consensus
Probab=93.07  E-value=0.03  Score=35.68  Aligned_cols=40  Identities=25%  Similarity=0.519  Sum_probs=19.9

Q ss_pred             cCCCCcccCChHHHHHHHHhhcCCCcccCCCChhhhcchhHHhh
Q psy12196         60 CRRCPSTFLNSATLSKHVKMEHNSKSYQCNECPESFERLNKLKR  103 (150)
Q Consensus        60 c~~c~~~f~~~~~l~~h~~~~~~~~~~~c~~c~~~~~~~~~l~~  103 (150)
                      |..|++.|.....|.+|++..+    |+|.+|-+..-+-..|..
T Consensus        13 cwycnrefddekiliqhqkakh----fkchichkkl~sgpglsi   52 (341)
T KOG2893|consen   13 CWYCNREFDDEKILIQHQKAKH----FKCHICHKKLFSGPGLSI   52 (341)
T ss_pred             eeecccccchhhhhhhhhhhcc----ceeeeehhhhccCCCcee
Confidence            4455555555555555544332    555555544433333333


No 61 
>KOG4173|consensus
Probab=92.48  E-value=0.061  Score=33.49  Aligned_cols=79  Identities=23%  Similarity=0.516  Sum_probs=41.8

Q ss_pred             cccCC--CCcccCChHHHHHHHHhhcCCCcccCCCChhhhcchhHHhhHHhhhcC--------CCCCCcCC--cchhhhc
Q psy12196         58 FTCRR--CPSTFLNSATLSKHVKMEHNSKSYQCNECPESFERLNKLKRHKFQAHN--------DSVHQIQC--PYCITDF  125 (150)
Q Consensus        58 ~~c~~--c~~~f~~~~~l~~h~~~~~~~~~~~c~~c~~~~~~~~~l~~h~~~~~~--------~~~~~~~C--~~C~~~f  125 (150)
                      +.|++  |...|.+-.....|+..-++.   .|.+|.+.|.+.--|..|+..-+.        .+.-.|+|  ..|+-.|
T Consensus        80 ~~cqvagc~~~~d~lD~~E~hY~~~h~~---sCs~C~r~~Pt~hLLd~HI~E~HDs~Fqa~veRG~dMy~ClvEgCt~KF  156 (253)
T KOG4173|consen   80 FACQVAGCCQVFDALDDYEHHYHTLHGN---SCSFCKRAFPTGHLLDAHILEWHDSLFQALVERGQDMYQCLVEGCTEKF  156 (253)
T ss_pred             ccccccchHHHHhhhhhHHHhhhhcccc---hhHHHHHhCCchhhhhHHHHHHHHHHHHHHHHcCccHHHHHHHhhhhhh
Confidence            44554  445555555555555443332   566666666665555555433221        11114555  3477777


Q ss_pred             cCchHHHHHHHHhc
Q psy12196        126 SEDKNLIQHIVSVH  139 (150)
Q Consensus       126 ~~~~~l~~H~~~~~  139 (150)
                      .+..+-..|+-..|
T Consensus       157 kT~r~RkdH~I~~H  170 (253)
T KOG4173|consen  157 KTSRDRKDHMIRMH  170 (253)
T ss_pred             hhhhhhhhHHHHhc
Confidence            77777767765554


No 62 
>KOG2482|consensus
Probab=92.08  E-value=0.3  Score=33.08  Aligned_cols=50  Identities=30%  Similarity=0.508  Sum_probs=36.9

Q ss_pred             cccCCCCcccCChHHHHHHHHhhcC---------------------------CCcccCCCChhhhcchhHHhhHHhh
Q psy12196         58 FTCRRCPSTFLNSATLSKHVKMEHN---------------------------SKSYQCNECPESFERLNKLKRHKFQ  107 (150)
Q Consensus        58 ~~c~~c~~~f~~~~~l~~h~~~~~~---------------------------~~~~~c~~c~~~~~~~~~l~~h~~~  107 (150)
                      ..|-.|...+.+...|..||...+.                           ...-.|.+|.-.|-....|..|+..
T Consensus       280 v~CLfC~~~~en~~~l~eHmk~vHe~Dl~Ki~sd~~Ln~YqrvrviNyiRkq~~~~~c~~cd~~F~~e~~l~~hm~e  356 (423)
T KOG2482|consen  280 VVCLFCTNFYENPVFLFEHMKIVHEFDLLKIQSDYSLNFYQRVRVINYIRKQKKKSRCAECDLSFWKEPGLLIHMVE  356 (423)
T ss_pred             eEEEeeccchhhHHHHHHHHHHHHHhhHHhhccccccchhhhhhHHHHHHHHhhccccccccccccCcchhhhhccc
Confidence            4677788777778888888876441                           1224688888889999999998754


No 63 
>KOG2186|consensus
Probab=91.54  E-value=0.13  Score=33.21  Aligned_cols=45  Identities=18%  Similarity=0.335  Sum_probs=26.0

Q ss_pred             CCCCcccccccCHHHHHHHHHHHhhCCCcceecccccccccChHHHHHHH
Q psy12196          1 MSCVPCDVLFHNKATLYKHLYLEHKATSLSIQCNMCSLVLDSKESLVTHI   50 (150)
Q Consensus         1 ~~C~~C~~~f~~~~~l~~h~~~~~~~~~~~~~c~~c~~~f~~~~~l~~h~   50 (150)
                      |.|+.||........ ..|+.+.+.   .-|.|-.|+++|.. ..+..|.
T Consensus         4 FtCnvCgEsvKKp~v-ekH~srCrn---~~fSCIDC~k~F~~-~sYknH~   48 (276)
T KOG2186|consen    4 FTCNVCGESVKKPQV-EKHMSRCRN---AYFSCIDCGKTFER-VSYKNHT   48 (276)
T ss_pred             Eehhhhhhhccccch-HHHHHhccC---CeeEEeeccccccc-chhhhhh
Confidence            456667666654433 336655433   23667777777766 5566665


No 64 
>KOG4173|consensus
Probab=91.18  E-value=0.13  Score=32.08  Aligned_cols=77  Identities=27%  Similarity=0.553  Sum_probs=50.0

Q ss_pred             eeccc--ccccccChHHHHHHHhccCCcccccCCCCcccCChHHHHHHHHhhc----------CCCcccCCC--Chhhhc
Q psy12196         31 IQCNM--CSLVLDSKESLVTHISQTHTLMFTCRRCPSTFLNSATLSKHVKMEH----------NSKSYQCNE--CPESFE   96 (150)
Q Consensus        31 ~~c~~--c~~~f~~~~~l~~h~~~~~~~~~~c~~c~~~f~~~~~l~~h~~~~~----------~~~~~~c~~--c~~~~~   96 (150)
                      +.|+.  |...|..-.....|-...|..  .|..|.+.|.+...|..|+...+          |.-.|.|-+  |+..|.
T Consensus        80 ~~cqvagc~~~~d~lD~~E~hY~~~h~~--sCs~C~r~~Pt~hLLd~HI~E~HDs~Fqa~veRG~dMy~ClvEgCt~KFk  157 (253)
T KOG4173|consen   80 FACQVAGCCQVFDALDDYEHHYHTLHGN--SCSFCKRAFPTGHLLDAHILEWHDSLFQALVERGQDMYQCLVEGCTEKFK  157 (253)
T ss_pred             ccccccchHHHHhhhhhHHHhhhhcccc--hhHHHHHhCCchhhhhHHHHHHHHHHHHHHHHcCccHHHHHHHhhhhhhh
Confidence            45654  556666555555553233332  58888888888888888877644          455688844  888888


Q ss_pred             chhHHhhHHhhhc
Q psy12196         97 RLNKLKRHKFQAH  109 (150)
Q Consensus        97 ~~~~l~~h~~~~~  109 (150)
                      +...-..|+-..+
T Consensus       158 T~r~RkdH~I~~H  170 (253)
T KOG4173|consen  158 TSRDRKDHMIRMH  170 (253)
T ss_pred             hhhhhhhHHHHhc
Confidence            7777677765433


No 65 
>PF10571 UPF0547:  Uncharacterised protein family UPF0547;  InterPro: IPR018886  This domain may well be a type of zinc-finger as it carries two pairs of highly conserved cysteine residues though with no accompanying histidines. Several members are annotated as putative helicases. 
Probab=91.10  E-value=0.13  Score=20.87  Aligned_cols=9  Identities=33%  Similarity=0.888  Sum_probs=5.1

Q ss_pred             ccCCCCccc
Q psy12196         59 TCRRCPSTF   67 (150)
Q Consensus        59 ~c~~c~~~f   67 (150)
                      .|+.||..|
T Consensus        16 ~Cp~CG~~F   24 (26)
T PF10571_consen   16 FCPHCGYDF   24 (26)
T ss_pred             cCCCCCCCC
Confidence            456666555


No 66 
>COG4049 Uncharacterized protein containing archaeal-type C2H2 Zn-finger [General function prediction only]
Probab=91.05  E-value=0.16  Score=24.55  Aligned_cols=21  Identities=19%  Similarity=0.637  Sum_probs=12.7

Q ss_pred             CCCcccccccCHHHHHHHHHH
Q psy12196          2 SCVPCDVLFHNKATLYKHLYL   22 (150)
Q Consensus         2 ~C~~C~~~f~~~~~l~~h~~~   22 (150)
                      .|+-||..|....+..+|...
T Consensus        19 rCPRC~~~FR~~K~Y~RHVNK   39 (65)
T COG4049          19 RCPRCGMVFRRRKDYIRHVNK   39 (65)
T ss_pred             eCCchhHHHHHhHHHHHHhhH
Confidence            466666666666666666544


No 67 
>COG5048 FOG: Zn-finger [General function prediction only]
Probab=90.77  E-value=0.045  Score=38.13  Aligned_cols=58  Identities=26%  Similarity=0.437  Sum_probs=37.1

Q ss_pred             cccCCCChhhhcchhHHhhHHh--hhcCC--CCCCcCCc--chhhhccCchHHHHHHHHhcCCCCC
Q psy12196         85 SYQCNECPESFERLNKLKRHKF--QAHND--SVHQIQCP--YCITDFSEDKNLIQHIVSVHLGKEG  144 (150)
Q Consensus        85 ~~~c~~c~~~~~~~~~l~~h~~--~~~~~--~~~~~~C~--~C~~~f~~~~~l~~H~~~~~~~~~~  144 (150)
                      ++.|..|...|.....|..|..  .|.++  .  ++.|+  .|++.|.....+..|...+.+-.+.
T Consensus       289 ~~~~~~~~~~~s~~~~l~~~~~~~~h~~~~~~--~~~~p~~~~~~~~~~~~~~~~~~~~~~~~~~~  352 (467)
T COG5048         289 PIKSKQCNISFSRSSPLTRHLRSVNHSGESLK--PFSCPYSLCGKLFSRNDALKRHILLHTSISPA  352 (467)
T ss_pred             CCCCccccCCccccccccccccccccccccCC--ceeeeccCCCccccccccccCCcccccCCCcc
Confidence            4566666666666666666666  45555  4  66666  5777777777676666666655544


No 68 
>PF12907 zf-met2:  Zinc-binding
Probab=90.16  E-value=0.24  Score=22.42  Aligned_cols=33  Identities=21%  Similarity=0.367  Sum_probs=23.1

Q ss_pred             cCCcchhhhcc---CchHHHHHHHHhcCCCC-CCCCC
Q psy12196        116 IQCPYCITDFS---EDKNLIQHIVSVHLGKE-GTAPA  148 (150)
Q Consensus       116 ~~C~~C~~~f~---~~~~l~~H~~~~~~~~~-~~~~~  148 (150)
                      ++|.+|-..|.   ....|..|....|.... .+|.+
T Consensus         2 i~C~iC~qtF~~t~~~~~L~eH~enKHpK~~~~~CFP   38 (40)
T PF12907_consen    2 IICKICRQTFMQTTNEPQLKEHAENKHPKNTFEECFP   38 (40)
T ss_pred             cCcHHhhHHHHhcCCHHHHHHHHHccCCCCCHHHcCC
Confidence            57888886655   44679999988887763 35543


No 69 
>KOG2893|consensus
Probab=89.99  E-value=0.075  Score=33.94  Aligned_cols=49  Identities=22%  Similarity=0.430  Sum_probs=36.8

Q ss_pred             cCCCChhhhcchhHHhhHHhhhcCCCCCCcCCcchhhhccCchHHHHHHHHhcCC
Q psy12196         87 QCNECPESFERLNKLKRHKFQAHNDSVHQIQCPYCITDFSEDKNLIQHIVSVHLG  141 (150)
Q Consensus        87 ~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~~C~~C~~~f~~~~~l~~H~~~~~~~  141 (150)
                      =|..|.+.|.....|..|+..      +-|+|-+|-|...+--.|..|-...|.|
T Consensus        12 wcwycnrefddekiliqhqka------khfkchichkkl~sgpglsihcmqvhke   60 (341)
T KOG2893|consen   12 WCWYCNREFDDEKILIQHQKA------KHFKCHICHKKLFSGPGLSIHCMQVHKE   60 (341)
T ss_pred             eeeecccccchhhhhhhhhhh------ccceeeeehhhhccCCCceeehhhhhhh
Confidence            388899999999999888653      3789999998877666666664444433


No 70 
>PF05443 ROS_MUCR:  ROS/MUCR transcriptional regulator protein;  InterPro: IPR008807 This family consists of several ROS/MUCR transcriptional regulator proteins. The ros chromosomal gene is present in octopine and nopaline strains of Agrobacterium tumefaciens as well as in Rhizobium meliloti (Sinorhizobium meliloti). This gene encodes a 15.5 kDa protein that specifically represses the virC and virD operons in the virulence region of the Ti plasmid [] and is necessary for succinoglycan production []. S. meliloti can produce two types of acidic exopolysaccharides, succinoglycan and galactoglucan, that are interchangeable for infection of Medicago sativa (Alfalfa) nodules. MucR from S. meliloti acts as a transcriptional repressor that blocks the expression of the exp genes responsible for galactoglucan production therefore allowing the exclusive production of succinoglycan [].; GO: 0003677 DNA binding, 0008270 zinc ion binding, 0006355 regulation of transcription, DNA-dependent; PDB: 2JSP_A.
Probab=89.88  E-value=0.21  Score=29.15  Aligned_cols=26  Identities=27%  Similarity=0.360  Sum_probs=16.4

Q ss_pred             CcCCcchhhhccCchHHHHHHHHhcCCCC
Q psy12196        115 QIQCPYCITDFSEDKNLIQHIVSVHLGKE  143 (150)
Q Consensus       115 ~~~C~~C~~~f~~~~~l~~H~~~~~~~~~  143 (150)
                      ...|-+||+.|..   |.+|+..|||-.|
T Consensus        72 ~i~clecGk~~k~---LkrHL~~~~gltp   97 (132)
T PF05443_consen   72 YIICLECGKKFKT---LKRHLRTHHGLTP   97 (132)
T ss_dssp             -EE-TBT--EESB---HHHHHHHTT-S-H
T ss_pred             eeEEccCCcccch---HHHHHHHccCCCH
Confidence            4579999999887   6899999986543


No 71 
>PF09538 FYDLN_acid:  Protein of unknown function (FYDLN_acid);  InterPro: IPR012644 Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues. The function of members of this family is unknown.
Probab=89.70  E-value=0.26  Score=27.72  Aligned_cols=29  Identities=17%  Similarity=0.464  Sum_probs=15.2

Q ss_pred             ecccccccccChHHHHHHHhccCCcccccCCCCcccCCh
Q psy12196         32 QCNMCSLVLDSKESLVTHISQTHTLMFTCRRCPSTFLNS   70 (150)
Q Consensus        32 ~c~~c~~~f~~~~~l~~h~~~~~~~~~~c~~c~~~f~~~   70 (150)
                      .|+.||+.|..-          ...|..||.||..|...
T Consensus        11 ~Cp~CG~kFYDL----------nk~PivCP~CG~~~~~~   39 (108)
T PF09538_consen   11 TCPSCGAKFYDL----------NKDPIVCPKCGTEFPPE   39 (108)
T ss_pred             cCCCCcchhccC----------CCCCccCCCCCCccCcc
Confidence            566666666421          11344566666665544


No 72 
>COG1592 Rubrerythrin [Energy production and conversion]
Probab=89.64  E-value=0.2  Score=30.41  Aligned_cols=24  Identities=25%  Similarity=0.653  Sum_probs=17.3

Q ss_pred             CcccCCCChhhhcchhHHhhHHhhhcCCCCCCcCCcchh
Q psy12196         84 KSYQCNECPESFERLNKLKRHKFQAHNDSVHQIQCPYCI  122 (150)
Q Consensus        84 ~~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~~C~~C~  122 (150)
                      +.|.|.+||..             +.++.  |.+||+|+
T Consensus       133 ~~~vC~vCGy~-------------~~ge~--P~~CPiCg  156 (166)
T COG1592         133 KVWVCPVCGYT-------------HEGEA--PEVCPICG  156 (166)
T ss_pred             CEEEcCCCCCc-------------ccCCC--CCcCCCCC
Confidence            36999999863             23333  78899998


No 73 
>cd00729 rubredoxin_SM Rubredoxin, Small Modular nonheme iron binding domain containing a [Fe(SCys)4] center, present in rubrerythrin and nigerythrin and detected either N- or C-terminal to such proteins as flavin reductase, NAD(P)H-nitrite reductase, and ferredoxin-thioredoxin reductase. In rubredoxin, the iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), and  believed to be involved in electron transfer. Rubrerythrins and nigerythrins are small homodimeric proteins, generally consisting of 2 domains: a rubredoxin domain C-terminal to a non-sulfur, oxo-bridged diiron site in the N-terminal rubrerythrin domain. Rubrerythrins and nigerythrins have putative peroxide activity.
Probab=89.59  E-value=0.18  Score=21.88  Aligned_cols=10  Identities=20%  Similarity=0.554  Sum_probs=6.1

Q ss_pred             ccCCCChhhh
Q psy12196         86 YQCNECPESF   95 (150)
Q Consensus        86 ~~c~~c~~~~   95 (150)
                      |.|.+||..+
T Consensus         3 ~~C~~CG~i~   12 (34)
T cd00729           3 WVCPVCGYIH   12 (34)
T ss_pred             EECCCCCCEe
Confidence            5666676543


No 74 
>PF15269 zf-C2H2_7:  Zinc-finger
Probab=89.55  E-value=0.28  Score=22.56  Aligned_cols=29  Identities=17%  Similarity=0.317  Sum_probs=22.6

Q ss_pred             CCCCCCcCCcchhhhccCchHHHHHHHHh
Q psy12196        110 NDSVHQIQCPYCITDFSEDKNLIQHIVSV  138 (150)
Q Consensus       110 ~~~~~~~~C~~C~~~f~~~~~l~~H~~~~  138 (150)
                      ..++..|+|-+|......++.|..||+-.
T Consensus        15 ~gkp~~ykcfqcpftc~~kshl~nhmky~   43 (54)
T PF15269_consen   15 PGKPFKYKCFQCPFTCNEKSHLFNHMKYS   43 (54)
T ss_pred             CCCCccceeecCCcccchHHHHHHHHHHH
Confidence            34455678999999999999999998643


No 75 
>TIGR02098 MJ0042_CXXC MJ0042 family finger-like domain. This domain contains a CXXCX(19)CXXC motif suggestive of both zinc fingers and thioredoxin, usually found at the N-terminus of prokaryotic proteins. One partially characterized gene, agmX, is among a large set in Myxococcus whose interruption affects adventurous gliding motility.
Probab=89.39  E-value=0.15  Score=22.56  Aligned_cols=32  Identities=19%  Similarity=0.467  Sum_probs=14.5

Q ss_pred             ecccccccccChHHHHHHHhccCCcccccCCCCccc
Q psy12196         32 QCNMCSLVLDSKESLVTHISQTHTLMFTCRRCPSTF   67 (150)
Q Consensus        32 ~c~~c~~~f~~~~~l~~h~~~~~~~~~~c~~c~~~f   67 (150)
                      .|+.|+..|.-......    .......|+.|+..|
T Consensus         4 ~CP~C~~~~~v~~~~~~----~~~~~v~C~~C~~~~   35 (38)
T TIGR02098         4 QCPNCKTSFRVVDSQLG----ANGGKVRCGKCGHVW   35 (38)
T ss_pred             ECCCCCCEEEeCHHHcC----CCCCEEECCCCCCEE
Confidence            46666665554333111    111234566666544


No 76 
>COG2888 Predicted Zn-ribbon RNA-binding protein with a function in translation [Translation, ribosomal structure and biogenesis]
Probab=89.36  E-value=0.18  Score=24.75  Aligned_cols=9  Identities=33%  Similarity=1.047  Sum_probs=4.5

Q ss_pred             cccccCCCC
Q psy12196         56 LMFTCRRCP   64 (150)
Q Consensus        56 ~~~~c~~c~   64 (150)
                      ..|.||.||
T Consensus        26 v~F~CPnCG   34 (61)
T COG2888          26 VKFPCPNCG   34 (61)
T ss_pred             eEeeCCCCC
Confidence            344555555


No 77 
>PF12013 DUF3505:  Protein of unknown function (DUF3505);  InterPro: IPR022698  This family of proteins is functionally uncharacterised. This protein is found in eukaryotes. Proteins in this family are typically between 247 to 1018 amino acids in length. This region contains two segments that are likely to be C2H2 zinc binding domains. 
Probab=89.16  E-value=1.1  Score=25.22  Aligned_cols=26  Identities=23%  Similarity=0.308  Sum_probs=23.4

Q ss_pred             CcCC----cchhhhccCchHHHHHHHHhcC
Q psy12196        115 QIQC----PYCITDFSEDKNLIQHIVSVHL  140 (150)
Q Consensus       115 ~~~C----~~C~~~f~~~~~l~~H~~~~~~  140 (150)
                      -|.|    +.|+..+.+...+..|+..+||
T Consensus        80 G~~C~~~~~~C~y~~~~~~~m~~H~~~~Hg  109 (109)
T PF12013_consen   80 GYRCQCDPPHCGYITRSKKTMRKHWRKEHG  109 (109)
T ss_pred             CeeeecCCCCCCcEeccHHHHHHHHHHhcC
Confidence            3789    9999999999999999999885


No 78 
>smart00734 ZnF_Rad18 Rad18-like CCHC zinc finger. Yeast Rad18p functions with Rad5p in error-free post-replicative DNA repair. This zinc finger is likely to bind nucleic-acids.
Probab=88.72  E-value=0.36  Score=19.52  Aligned_cols=20  Identities=30%  Similarity=0.735  Sum_probs=15.0

Q ss_pred             CCcchhhhccCchHHHHHHHH
Q psy12196        117 QCPYCITDFSEDKNLIQHIVS  137 (150)
Q Consensus       117 ~C~~C~~~f~~~~~l~~H~~~  137 (150)
                      .||+|++.+ ....+.+|+..
T Consensus         3 ~CPiC~~~v-~~~~in~HLD~   22 (26)
T smart00734        3 QCPVCFREV-PENLINSHLDS   22 (26)
T ss_pred             cCCCCcCcc-cHHHHHHHHHH
Confidence            588998888 55677788753


No 79 
>PF12013 DUF3505:  Protein of unknown function (DUF3505);  InterPro: IPR022698  This family of proteins is functionally uncharacterised. This protein is found in eukaryotes. Proteins in this family are typically between 247 to 1018 amino acids in length. This region contains two segments that are likely to be C2H2 zinc binding domains. 
Probab=88.72  E-value=0.3  Score=27.45  Aligned_cols=26  Identities=19%  Similarity=0.492  Sum_probs=22.4

Q ss_pred             cccC----CCChhhhcchhHHhhHHhhhcC
Q psy12196         85 SYQC----NECPESFERLNKLKRHKFQAHN  110 (150)
Q Consensus        85 ~~~c----~~c~~~~~~~~~l~~h~~~~~~  110 (150)
                      .|.|    ..|++.......+..|.+..++
T Consensus        80 G~~C~~~~~~C~y~~~~~~~m~~H~~~~Hg  109 (109)
T PF12013_consen   80 GYRCQCDPPHCGYITRSKKTMRKHWRKEHG  109 (109)
T ss_pred             CeeeecCCCCCCcEeccHHHHHHHHHHhcC
Confidence            3899    9999999999999999887653


No 80 
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only]
Probab=88.71  E-value=1.4  Score=30.12  Aligned_cols=22  Identities=32%  Similarity=0.772  Sum_probs=11.2

Q ss_pred             CCcccccccCHHHHHHHHHHHh
Q psy12196          3 CVPCDVLFHNKATLYKHLYLEH   24 (150)
Q Consensus         3 C~~C~~~f~~~~~l~~h~~~~~   24 (150)
                      |..|...|-+-..|..|++..|
T Consensus       223 C~FC~~~FYdDDEL~~HcR~~H  244 (493)
T COG5236         223 CIFCKIYFYDDDELRRHCRLRH  244 (493)
T ss_pred             hhhccceecChHHHHHHHHhhh
Confidence            4445555555555555554433


No 81 
>PHA00626 hypothetical protein
Probab=88.62  E-value=0.081  Score=25.58  Aligned_cols=11  Identities=27%  Similarity=0.682  Sum_probs=5.3

Q ss_pred             ccCCCChhhhc
Q psy12196         86 YQCNECPESFE   96 (150)
Q Consensus        86 ~~c~~c~~~~~   96 (150)
                      |.|..||..|+
T Consensus        24 YkCkdCGY~ft   34 (59)
T PHA00626         24 YVCCDCGYNDS   34 (59)
T ss_pred             eEcCCCCCeec
Confidence            45555544443


No 82 
>smart00614 ZnF_BED BED zinc finger. DNA-binding domain in chromatin-boundary-element-binding proteins and transposases
Probab=88.60  E-value=0.37  Score=22.88  Aligned_cols=24  Identities=33%  Similarity=0.695  Sum_probs=16.3

Q ss_pred             cCCcchhhhccCc-----hHHHHHHHHhc
Q psy12196        116 IQCPYCITDFSED-----KNLIQHIVSVH  139 (150)
Q Consensus       116 ~~C~~C~~~f~~~-----~~l~~H~~~~~  139 (150)
                      -.|..|++.+...     +.|.+|+...+
T Consensus        19 a~C~~C~~~l~~~~~~gTs~L~rHl~~~h   47 (50)
T smart00614       19 AKCKYCGKKLSRSSKGGTSNLRRHLRRKH   47 (50)
T ss_pred             EEecCCCCEeeeCCCCCcHHHHHHHHhHC
Confidence            4577777776554     68888887543


No 83 
>PF09986 DUF2225:  Uncharacterized protein conserved in bacteria (DUF2225);  InterPro: IPR018708 This conserved bacterial family has no known function.
Probab=88.54  E-value=0.063  Score=34.16  Aligned_cols=13  Identities=31%  Similarity=0.503  Sum_probs=10.2

Q ss_pred             cCCcchhhhccCc
Q psy12196        116 IQCPYCITDFSED  128 (150)
Q Consensus       116 ~~C~~C~~~f~~~  128 (150)
                      ..||.||.++...
T Consensus        49 ~vCP~CgyA~~~~   61 (214)
T PF09986_consen   49 WVCPHCGYAAFEE   61 (214)
T ss_pred             EECCCCCCccccc
Confidence            4699999887754


No 84 
>TIGR02605 CxxC_CxxC_SSSS putative regulatory protein, FmdB family. This model represents a region of about 50 amino acids found in a number of small proteins in a wide range of bacteria. The region begins usually with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One member of this family is has been noted as a putative regulatory protein, designated FmdB (PubMed:8841393). Most members of this family have a C-terminal region containing highly degenerate sequence, such as SSTSESTKSSGSSGSSGSSESKASGSTEKSTSSTTAAAAV in Mycobacterium tuberculosis and VAVGGSAPAPSPAPRAGGGGGGCCGGGCCG in Streptomyces avermitilis. These low complexity regions, which are not included in the model, resemble low-complexity C-terminal regions of some heterocycle-containing bacteriocin precursors.
Probab=88.31  E-value=0.13  Score=24.59  Aligned_cols=29  Identities=38%  Similarity=0.893  Sum_probs=16.3

Q ss_pred             ccCCCChhhhcchhHHhhHHhhhcCCCCCCcCCcchhh
Q psy12196         86 YQCNECPESFERLNKLKRHKFQAHNDSVHQIQCPYCIT  123 (150)
Q Consensus        86 ~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~~C~~C~~  123 (150)
                      |.|..||..|.....+       ..+.  ...|+.|+.
T Consensus         6 y~C~~Cg~~fe~~~~~-------~~~~--~~~CP~Cg~   34 (52)
T TIGR02605         6 YRCTACGHRFEVLQKM-------SDDP--LATCPECGG   34 (52)
T ss_pred             EEeCCCCCEeEEEEec-------CCCC--CCCCCCCCC
Confidence            6777787777653211       1122  446777774


No 85 
>smart00659 RPOLCX RNA polymerase subunit CX. present in RNA polymerase I, II and III
Probab=87.71  E-value=0.26  Score=22.82  Aligned_cols=11  Identities=45%  Similarity=0.981  Sum_probs=6.2

Q ss_pred             ccCCCChhhhc
Q psy12196         86 YQCNECPESFE   96 (150)
Q Consensus        86 ~~c~~c~~~~~   96 (150)
                      |.|..||..+.
T Consensus         3 Y~C~~Cg~~~~   13 (44)
T smart00659        3 YICGECGRENE   13 (44)
T ss_pred             EECCCCCCEee
Confidence            55666665444


No 86 
>TIGR00373 conserved hypothetical protein TIGR00373. This family of proteins is, so far, restricted to archaeal genomes. The family appears to be distantly related to the N-terminal region of the eukaryotic transcription initiation factor IIE alpha chain.
Probab=87.25  E-value=0.76  Score=27.84  Aligned_cols=34  Identities=18%  Similarity=0.377  Sum_probs=23.1

Q ss_pred             CCCcccCCCChhhhcchhHHhhHHhhhcCCCCCCcCCcchhhhcc
Q psy12196         82 NSKSYQCNECPESFERLNKLKRHKFQAHNDSVHQIQCPYCITDFS  126 (150)
Q Consensus        82 ~~~~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~~C~~C~~~f~  126 (150)
                      +..-|.|+.|+..|+....+.         .  .|.||.||....
T Consensus       106 ~~~~Y~Cp~c~~r~tf~eA~~---------~--~F~Cp~Cg~~L~  139 (158)
T TIGR00373       106 NNMFFICPNMCVRFTFNEAME---------L--NFTCPRCGAMLD  139 (158)
T ss_pred             CCCeEECCCCCcEeeHHHHHH---------c--CCcCCCCCCEee
Confidence            445678888887777766553         1  678888886643


No 87 
>smart00834 CxxC_CXXC_SSSS Putative regulatory protein. CxxC_CXXC_SSSS represents a region of about 41 amino acids found in a number of small proteins in a wide range of bacteria. The region usually begins with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One protein in this entry has been noted as a putative regulatory protein, designated FmdB. Most proteins in this entry have a C-terminal region containing highly degenerate sequence.
Probab=86.92  E-value=0.18  Score=22.66  Aligned_cols=29  Identities=38%  Similarity=0.948  Sum_probs=16.7

Q ss_pred             ccCCCChhhhcchhHHhhHHhhhcCCCCCCcCCcchhh
Q psy12196         86 YQCNECPESFERLNKLKRHKFQAHNDSVHQIQCPYCIT  123 (150)
Q Consensus        86 ~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~~C~~C~~  123 (150)
                      |.|..||..|......       ....  ...|+.||.
T Consensus         6 y~C~~Cg~~fe~~~~~-------~~~~--~~~CP~Cg~   34 (41)
T smart00834        6 YRCEDCGHTFEVLQKI-------SDDP--LATCPECGG   34 (41)
T ss_pred             EEcCCCCCEEEEEEec-------CCCC--CCCCCCCCC
Confidence            6777788776654322       1122  446888775


No 88 
>COG5048 FOG: Zn-finger [General function prediction only]
Probab=86.31  E-value=0.16  Score=35.36  Aligned_cols=56  Identities=27%  Similarity=0.536  Sum_probs=41.3

Q ss_pred             ccccCCCCcccCChHHHHHHHH--hhcCC--CcccCC--CChhhhcchhHHhhHHhhhcCCC
Q psy12196         57 MFTCRRCPSTFLNSATLSKHVK--MEHNS--KSYQCN--ECPESFERLNKLKRHKFQAHNDS  112 (150)
Q Consensus        57 ~~~c~~c~~~f~~~~~l~~h~~--~~~~~--~~~~c~--~c~~~~~~~~~l~~h~~~~~~~~  112 (150)
                      ++.|..|...|.....+..|..  .|.++  +++.|.  .|++.|.....+..|...+.+..
T Consensus       289 ~~~~~~~~~~~s~~~~l~~~~~~~~h~~~~~~~~~~p~~~~~~~~~~~~~~~~~~~~~~~~~  350 (467)
T COG5048         289 PIKSKQCNISFSRSSPLTRHLRSVNHSGESLKPFSCPYSLCGKLFSRNDALKRHILLHTSIS  350 (467)
T ss_pred             CCCCccccCCccccccccccccccccccccCCceeeeccCCCccccccccccCCcccccCCC
Confidence            5667777777777777777777  67777  777777  67777777777777766666544


No 89 
>PF13717 zinc_ribbon_4:  zinc-ribbon domain
Probab=86.12  E-value=0.75  Score=20.22  Aligned_cols=9  Identities=22%  Similarity=0.737  Sum_probs=4.1

Q ss_pred             ccccccccc
Q psy12196         33 CNMCSLVLD   41 (150)
Q Consensus        33 c~~c~~~f~   41 (150)
                      |+.|...|.
T Consensus         5 Cp~C~~~y~   13 (36)
T PF13717_consen    5 CPNCQAKYE   13 (36)
T ss_pred             CCCCCCEEe
Confidence            444444443


No 90 
>KOG2186|consensus
Probab=85.87  E-value=0.31  Score=31.54  Aligned_cols=49  Identities=24%  Similarity=0.555  Sum_probs=36.0

Q ss_pred             eecccccccccChHHHHHHHhccCCcccccCCCCcccCChHHHHHHHHhhc
Q psy12196         31 IQCNMCSLVLDSKESLVTHISQTHTLMFTCRRCPSTFLNSATLSKHVKMEH   81 (150)
Q Consensus        31 ~~c~~c~~~f~~~~~l~~h~~~~~~~~~~c~~c~~~f~~~~~l~~h~~~~~   81 (150)
                      |.|..|+....-+ .+..|+.+.+...|.|..|+..|.. .+...|...-+
T Consensus         4 FtCnvCgEsvKKp-~vekH~srCrn~~fSCIDC~k~F~~-~sYknH~kCIT   52 (276)
T KOG2186|consen    4 FTCNVCGESVKKP-QVEKHMSRCRNAYFSCIDCGKTFER-VSYKNHTKCIT   52 (276)
T ss_pred             Eehhhhhhhcccc-chHHHHHhccCCeeEEeeccccccc-chhhhhhhhcc
Confidence            6788888877643 5566887777788889889999887 56666655444


No 91 
>PF04959 ARS2:  Arsenite-resistance protein 2;  InterPro: IPR007042 This entry represents Arsenite-resistance protein 2 (also known as Serrate RNA effector molecule homolog) which is thought to play a role in arsenite resistance [], although does not directly confer arsenite resistance but rather modulates arsenic sensitivity []. Arsenite is a carcinogenic compound which can act as a comutagen by inhibiting DNA repair. It is also involved in cell cycle progression at S phase. ; PDB: 3AX1_A.
Probab=85.80  E-value=0.19  Score=31.97  Aligned_cols=29  Identities=28%  Similarity=0.504  Sum_probs=21.0

Q ss_pred             CCcCCcchhhhccCchHHHHHHHHhcCCC
Q psy12196        114 HQIQCPYCITDFSEDKNLIQHIVSVHLGK  142 (150)
Q Consensus       114 ~~~~C~~C~~~f~~~~~l~~H~~~~~~~~  142 (150)
                      ..|.|+.|+|.|.-..-+..|+...|+++
T Consensus        76 ~K~~C~lc~KlFkg~eFV~KHI~nKH~e~  104 (214)
T PF04959_consen   76 DKWRCPLCGKLFKGPEFVRKHIFNKHPEK  104 (214)
T ss_dssp             EEEEE-SSS-EESSHHHHHHHHHHH-HHH
T ss_pred             CEECCCCCCcccCChHHHHHHHhhcCHHH
Confidence            36888889998888888888888888653


No 92 
>PF02892 zf-BED:  BED zinc finger;  InterPro: IPR003656 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents predicted BED-type zinc finger domains. The BED finger which was named after the Drosophila proteins BEAF and DREF, is found in one or more copies in cellular regulatory factors and transposases from plants, animals and fungi. The BED finger is an about 50 to 60 amino acid residues domain that contains a characteristic motif with two highly conserved aromatic positions, as well as a shared pattern of cysteines and histidines that is predicted to form a zinc finger. As diverse BED fingers are able to bind DNA, it has been suggested that DNA-binding is the general function of this domain []. Some proteins known to contain a BED domain include animal, plant and fungi AC1 and Hobo-like transposases; Caenorhabditis elegans Dpy-20 protein, a predicted cuticular gene transcriptional regulator; Drosophila BEAF (boundary element-associated factor), thought to be involved in chromatin insulation; Drosophila DREF, a transcriptional regulator for S-phase genes; and tobacco 3AF1 and tomato E4/E8-BP1, light- and ethylene-regulated DNA binding proteins that contain two BED fingers. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003677 DNA binding; PDB: 2DJR_A 2CT5_A.
Probab=85.79  E-value=0.34  Score=22.30  Aligned_cols=24  Identities=25%  Similarity=0.505  Sum_probs=12.9

Q ss_pred             CcCCcchhhhccC----chHHHHHHHHh
Q psy12196        115 QIQCPYCITDFSE----DKNLIQHIVSV  138 (150)
Q Consensus       115 ~~~C~~C~~~f~~----~~~l~~H~~~~  138 (150)
                      ...|..|++.+..    .+.|.+|++..
T Consensus        16 ~a~C~~C~~~~~~~~~~ts~l~~HL~~~   43 (45)
T PF02892_consen   16 KAKCKYCGKVIKYSSGGTSNLKRHLKKK   43 (45)
T ss_dssp             -EEETTTTEE-----SSTHHHHHHHHHT
T ss_pred             eEEeCCCCeEEeeCCCcHHHHHHhhhhh
Confidence            4567777766654    36777777543


No 93 
>PRK06266 transcription initiation factor E subunit alpha; Validated
Probab=83.90  E-value=1.1  Score=27.73  Aligned_cols=33  Identities=18%  Similarity=0.460  Sum_probs=21.2

Q ss_pred             CCcccCCCChhhhcchhHHhhHHhhhcCCCCCCcCCcchhhhcc
Q psy12196         83 SKSYQCNECPESFERLNKLKRHKFQAHNDSVHQIQCPYCITDFS  126 (150)
Q Consensus        83 ~~~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~~C~~C~~~f~  126 (150)
                      ..-|.|+.|+..|+....+.         .  .|.|+.||....
T Consensus       115 ~~~Y~Cp~C~~rytf~eA~~---------~--~F~Cp~Cg~~L~  147 (178)
T PRK06266        115 NMFFFCPNCHIRFTFDEAME---------Y--GFRCPQCGEMLE  147 (178)
T ss_pred             CCEEECCCCCcEEeHHHHhh---------c--CCcCCCCCCCCe
Confidence            34577877877777665431         1  677888876543


No 94 
>PF09723 Zn-ribbon_8:  Zinc ribbon domain;  InterPro: IPR013429  This entry represents a region of about 41 amino acids found in a number of small proteins in a wide range of bacteria. The region usually begins with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One protein in this entry has been noted as a putative regulatory protein, designated FmdB []. Most proteins in this entry have a C-terminal region containing highly degenerate sequence.
Probab=83.86  E-value=0.39  Score=21.93  Aligned_cols=31  Identities=19%  Similarity=0.475  Sum_probs=17.3

Q ss_pred             cceecccccccccChHHHHHHHhccCCcccccCCCCc
Q psy12196         29 LSIQCNMCSLVLDSKESLVTHISQTHTLMFTCRRCPS   65 (150)
Q Consensus        29 ~~~~c~~c~~~f~~~~~l~~h~~~~~~~~~~c~~c~~   65 (150)
                      +.|.|..|+..|.....+.      ......|+.|+.
T Consensus         4 Yey~C~~Cg~~fe~~~~~~------~~~~~~CP~Cg~   34 (42)
T PF09723_consen    4 YEYRCEECGHEFEVLQSIS------EDDPVPCPECGS   34 (42)
T ss_pred             EEEEeCCCCCEEEEEEEcC------CCCCCcCCCCCC
Confidence            3477777777765332211      134556777775


No 95 
>PRK14890 putative Zn-ribbon RNA-binding protein; Provisional
Probab=83.11  E-value=0.51  Score=23.26  Aligned_cols=8  Identities=38%  Similarity=0.962  Sum_probs=4.4

Q ss_pred             CcCCcchh
Q psy12196        115 QIQCPYCI  122 (150)
Q Consensus       115 ~~~C~~C~  122 (150)
                      +|.|+.||
T Consensus        48 ~Y~CP~CG   55 (59)
T PRK14890         48 PYTCPKCG   55 (59)
T ss_pred             ceECCCCC
Confidence            55555554


No 96 
>smart00531 TFIIE Transcription initiation factor IIE.
Probab=82.08  E-value=1.3  Score=26.42  Aligned_cols=39  Identities=23%  Similarity=0.595  Sum_probs=22.0

Q ss_pred             CCCcccCCCChhhhcchhHHhhHHhhhcCCCCCCcCCcchhhhcc
Q psy12196         82 NSKSYQCNECPESFERLNKLKRHKFQAHNDSVHQIQCPYCITDFS  126 (150)
Q Consensus        82 ~~~~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~~C~~C~~~f~  126 (150)
                      +..-|.|+.|+..|.....+..    ...++  .|.||.||....
T Consensus        96 ~~~~Y~Cp~C~~~y~~~ea~~~----~d~~~--~f~Cp~Cg~~l~  134 (147)
T smart00531       96 NNAYYKCPNCQSKYTFLEANQL----LDMDG--TFTCPRCGEELE  134 (147)
T ss_pred             CCcEEECcCCCCEeeHHHHHHh----cCCCC--cEECCCCCCEEE
Confidence            3445778888777765433221    01133  578888876643


No 97 
>PF04780 DUF629:  Protein of unknown function (DUF629);  InterPro: IPR006865 This domain represents a region of several plant proteins of unknown function. A C2H2 zinc finger is predicted in this region in some family members, but the spacing between the cysteine residues is not conserved throughout the family.
Probab=81.70  E-value=0.96  Score=32.33  Aligned_cols=29  Identities=24%  Similarity=0.480  Sum_probs=24.8

Q ss_pred             CcCCcchhhhccCchHHHHHHHHhcCCCC
Q psy12196        115 QIQCPYCITDFSEDKNLIQHIVSVHLGKE  143 (150)
Q Consensus       115 ~~~C~~C~~~f~~~~~l~~H~~~~~~~~~  143 (150)
                      -|.|+.|.+.|.+...+..|+...|.++-
T Consensus        57 FWiCp~CskkF~d~~~~~~H~~~eH~~~l   85 (466)
T PF04780_consen   57 FWICPRCSKKFSDAESCLSHMEQEHPAGL   85 (466)
T ss_pred             EeeCCcccceeCCHHHHHHHHHHhhhhhc
Confidence            46899999999999999999998885543


No 98 
>PRK00398 rpoP DNA-directed RNA polymerase subunit P; Provisional
Probab=81.12  E-value=1.2  Score=20.71  Aligned_cols=10  Identities=20%  Similarity=0.663  Sum_probs=5.6

Q ss_pred             eecccccccc
Q psy12196         31 IQCNMCSLVL   40 (150)
Q Consensus        31 ~~c~~c~~~f   40 (150)
                      |.|+.|+..|
T Consensus         4 y~C~~CG~~~   13 (46)
T PRK00398          4 YKCARCGREV   13 (46)
T ss_pred             EECCCCCCEE
Confidence            5555555554


No 99 
>PF14353 CpXC:  CpXC protein
Probab=81.06  E-value=2.4  Score=24.59  Aligned_cols=21  Identities=24%  Similarity=0.494  Sum_probs=12.0

Q ss_pred             cceecccccccccChHHHHHH
Q psy12196         29 LSIQCNMCSLVLDSKESLVTH   49 (150)
Q Consensus        29 ~~~~c~~c~~~f~~~~~l~~h   49 (150)
                      ..+.|+.||..|.-...+..|
T Consensus        37 ~~~~CP~Cg~~~~~~~p~lY~   57 (128)
T PF14353_consen   37 FSFTCPSCGHKFRLEYPLLYH   57 (128)
T ss_pred             CEEECCCCCCceecCCCEEEE
Confidence            346677777766554444444


No 100
>TIGR02300 FYDLN_acid conserved hypothetical protein TIGR02300. Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues. The function of members of this family is unknown.
Probab=80.61  E-value=1.3  Score=25.60  Aligned_cols=30  Identities=7%  Similarity=-0.084  Sum_probs=16.0

Q ss_pred             eecccccccccChHHHHHHHhccCCcccccCCCCcccCCh
Q psy12196         31 IQCNMCSLVLDSKESLVTHISQTHTLMFTCRRCPSTFLNS   70 (150)
Q Consensus        31 ~~c~~c~~~f~~~~~l~~h~~~~~~~~~~c~~c~~~f~~~   70 (150)
                      ..|+.|++.|..          ....|..||.||..|...
T Consensus        10 r~Cp~cg~kFYD----------Lnk~p~vcP~cg~~~~~~   39 (129)
T TIGR02300        10 RICPNTGSKFYD----------LNRRPAVSPYTGEQFPPE   39 (129)
T ss_pred             ccCCCcCccccc----------cCCCCccCCCcCCccCcc
Confidence            356666666642          112445566666665444


No 101
>KOG2785|consensus
Probab=80.60  E-value=3.4  Score=28.69  Aligned_cols=24  Identities=25%  Similarity=0.448  Sum_probs=15.7

Q ss_pred             CcCCcchhhhccCchHHHHHHHHh
Q psy12196        115 QIQCPYCITDFSEDKNLIQHIVSV  138 (150)
Q Consensus       115 ~~~C~~C~~~f~~~~~l~~H~~~~  138 (150)
                      ++.|..|.+.|....+...|+.+.
T Consensus        68 ~~~c~~c~k~~~s~~a~~~hl~Sk   91 (390)
T KOG2785|consen   68 VVYCEACNKSFASPKAHENHLKSK   91 (390)
T ss_pred             ceehHHhhccccChhhHHHHHHHh
Confidence            556777777777666666666554


No 102
>KOG1842|consensus
Probab=79.75  E-value=1.3  Score=31.27  Aligned_cols=29  Identities=24%  Similarity=0.573  Sum_probs=21.2

Q ss_pred             CcCCcchhhhccCchHHHHHHHHhcCCCC
Q psy12196        115 QIQCPYCITDFSEDKNLIQHIVSVHLGKE  143 (150)
Q Consensus       115 ~~~C~~C~~~f~~~~~l~~H~~~~~~~~~  143 (150)
                      -|.||+|...|.+...|..|+..-|++..
T Consensus        15 gflCPiC~~dl~~~~~L~~H~d~eH~~ed   43 (505)
T KOG1842|consen   15 GFLCPICLLDLPNLSALNDHLDVEHFEED   43 (505)
T ss_pred             cccCchHhhhhhhHHHHHHHHhhhccccc
Confidence            56777777777777777777777776554


No 103
>KOG4118|consensus
Probab=79.23  E-value=1.7  Score=21.81  Aligned_cols=31  Identities=19%  Similarity=0.426  Sum_probs=26.5

Q ss_pred             CcCCcchhhhccCchHHHHHHHHhcCCCCCC
Q psy12196        115 QIQCPYCITDFSEDKNLIQHIVSVHLGKEGT  145 (150)
Q Consensus       115 ~~~C~~C~~~f~~~~~l~~H~~~~~~~~~~~  145 (150)
                      -|+|..|.-.....-.+..|+...|+..|.+
T Consensus        38 ~~kCtVC~~~mpdpktfkqhfe~kHpk~~~P   68 (74)
T KOG4118|consen   38 HHKCTVCMVQMPDPKTFKQHFENKHPKEPLP   68 (74)
T ss_pred             HhhhHhhHhhCCCCchHHHHHhhcCCCCCCC
Confidence            4679999988888889999999999888765


No 104
>KOG4167|consensus
Probab=79.14  E-value=0.66  Score=34.81  Aligned_cols=26  Identities=19%  Similarity=0.217  Sum_probs=23.7

Q ss_pred             CcCCcchhhhccCchHHHHHHHHhcC
Q psy12196        115 QIQCPYCITDFSEDKNLIQHIVSVHL  140 (150)
Q Consensus       115 ~~~C~~C~~~f~~~~~l~~H~~~~~~  140 (150)
                      .|-|..|+|.|.-..++..||++|-.
T Consensus       792 iFpCreC~kvF~KiKSrNAHMK~Hr~  817 (907)
T KOG4167|consen  792 IFPCRECGKVFFKIKSRNAHMKTHRQ  817 (907)
T ss_pred             eeehHHHHHHHHHHhhhhHHHHHHHH
Confidence            58899999999999999999999963


No 105
>PRK00464 nrdR transcriptional regulator NrdR; Validated
Probab=76.35  E-value=0.35  Score=29.09  Aligned_cols=15  Identities=20%  Similarity=0.410  Sum_probs=9.8

Q ss_pred             cccCCCCcccCChHH
Q psy12196         58 FTCRRCPSTFLNSAT   72 (150)
Q Consensus        58 ~~c~~c~~~f~~~~~   72 (150)
                      ++|+.||..|.....
T Consensus        29 ~~c~~c~~~f~~~e~   43 (154)
T PRK00464         29 RECLACGKRFTTFER   43 (154)
T ss_pred             eeccccCCcceEeEe
Confidence            667777777765433


No 106
>KOG3408|consensus
Probab=76.31  E-value=1.9  Score=24.69  Aligned_cols=24  Identities=29%  Similarity=0.465  Sum_probs=19.5

Q ss_pred             CcCCcchhhhccCchHHHHHHHHh
Q psy12196        115 QIQCPYCITDFSEDKNLIQHIVSV  138 (150)
Q Consensus       115 ~~~C~~C~~~f~~~~~l~~H~~~~  138 (150)
                      .|-|-.|.+-|.+...|..|+++.
T Consensus        57 qfyCi~CaRyFi~~~~l~~H~ktK   80 (129)
T KOG3408|consen   57 QFYCIECARYFIDAKALKTHFKTK   80 (129)
T ss_pred             eeehhhhhhhhcchHHHHHHHhcc
Confidence            677888888888888888887665


No 107
>PF09845 DUF2072:  Zn-ribbon containing protein (DUF2072);  InterPro: IPR018645  This archaeal Zinc-ribbon containing proteins have no known function. 
Probab=75.48  E-value=1.5  Score=25.52  Aligned_cols=11  Identities=36%  Similarity=0.957  Sum_probs=4.9

Q ss_pred             ecccccccccC
Q psy12196         32 QCNMCSLVLDS   42 (150)
Q Consensus        32 ~c~~c~~~f~~   42 (150)
                      +|..|++.|..
T Consensus         3 ~Ct~Cg~~f~d   13 (131)
T PF09845_consen    3 QCTKCGRVFED   13 (131)
T ss_pred             ccCcCCCCcCC
Confidence            34444444443


No 108
>COG2879 Uncharacterized small protein [Function unknown]
Probab=75.20  E-value=3.5  Score=20.61  Aligned_cols=19  Identities=21%  Similarity=0.338  Sum_probs=15.4

Q ss_pred             cCchHHHHHHHHhcCCCCC
Q psy12196        126 SEDKNLIQHIVSVHLGKEG  144 (150)
Q Consensus       126 ~~~~~l~~H~~~~~~~~~~  144 (150)
                      ++..+...||+.+|+++|+
T Consensus        23 pdYdnYVehmr~~hPd~p~   41 (65)
T COG2879          23 PDYDNYVEHMRKKHPDKPP   41 (65)
T ss_pred             CcHHHHHHHHHHhCcCCCc
Confidence            4557888999999988875


No 109
>PF08274 PhnA_Zn_Ribbon:  PhnA Zinc-Ribbon ;  InterPro: IPR013987 The PhnA protein family includes the uncharacterised Escherichia coli protein PhnA and its homologues. The E. coli phnA gene is part of a large operon associated with alkylphosphonate uptake and carbon-phosphorus bond cleavage []. The protein is not related to the characterised phosphonoacetate hydrolase designated PhnA []. This entry represents the N-terminal domain of PhnA, which is predicted to form a zinc-ribbon.; PDB: 2AKL_A.
Probab=74.92  E-value=1.1  Score=18.92  Aligned_cols=6  Identities=50%  Similarity=1.619  Sum_probs=2.3

Q ss_pred             cCCcch
Q psy12196        116 IQCPYC  121 (150)
Q Consensus       116 ~~C~~C  121 (150)
                      +.|+.|
T Consensus        20 ~vCp~C   25 (30)
T PF08274_consen   20 LVCPEC   25 (30)
T ss_dssp             EEETTT
T ss_pred             EeCCcc
Confidence            334433


No 110
>KOG1280|consensus
Probab=74.62  E-value=3.4  Score=28.32  Aligned_cols=37  Identities=22%  Similarity=0.584  Sum_probs=19.2

Q ss_pred             CCCCcccccccCHHHHHHHHHHHhhCCCcceeccccc
Q psy12196          1 MSCVPCDVLFHNKATLYKHLYLEHKATSLSIQCNMCS   37 (150)
Q Consensus         1 ~~C~~C~~~f~~~~~l~~h~~~~~~~~~~~~~c~~c~   37 (150)
                      |.|++|+..=-+...|.-|+...|.+......|+.|.
T Consensus        80 ftCPyC~~~Gfte~~f~~Hv~s~Hpda~~~~icp~c~  116 (381)
T KOG1280|consen   80 FTCPYCGIMGFTERQFGTHVLSQHPEASTSVICPLCA  116 (381)
T ss_pred             ccCCcccccccchhHHHHHhhhcCcccCcceeeeccc
Confidence            4556665554455555555555554444444455553


No 111
>PF00301 Rubredoxin:  Rubredoxin;  InterPro: IPR004039 Rubredoxin is a low molecular weight iron-containing bacterial protein involved in electron transfer [, ], sometimes replacing ferredoxin as an electron carrier []. The 3-D structures of a number of rubredoxins have been solved [, ]. The fold belongs to the alpha+beta class, with 2 alpha-helices and 2-3 beta-strands. Its active site contains an iron ion which is co-ordinated by the sulphurs of four conserved cysteine residues forming an almost regular tetrahedron. The conserved cysteines reside on two loops, which are the most conserved regions of the protein. In addition, a ring of acidic residues in the proximity of the [Fe(Cys)4] centre is also well-conserved []. ; GO: 0009055 electron carrier activity, 0046872 metal ion binding; PDB: 2RDV_C 1RDV_A 1S24_A 1T9O_B 1B2J_A 1SMW_A 2PVE_B 1BFY_A 1T9P_C 1C09_C ....
Probab=74.29  E-value=0.59  Score=22.01  Aligned_cols=13  Identities=31%  Similarity=0.756  Sum_probs=7.9

Q ss_pred             ccCCCChhhhcch
Q psy12196         86 YQCNECPESFERL   98 (150)
Q Consensus        86 ~~c~~c~~~~~~~   98 (150)
                      |+|.+|+..+...
T Consensus         2 y~C~~CgyvYd~~   14 (47)
T PF00301_consen    2 YQCPVCGYVYDPE   14 (47)
T ss_dssp             EEETTTSBEEETT
T ss_pred             cCCCCCCEEEcCC
Confidence            5677777665543


No 112
>COG4957 Predicted transcriptional regulator [Transcription]
Probab=74.28  E-value=1.1  Score=26.14  Aligned_cols=23  Identities=22%  Similarity=0.140  Sum_probs=18.2

Q ss_pred             cCCcchhhhccCchHHHHHHHHhcCC
Q psy12196        116 IQCPYCITDFSEDKNLIQHIVSVHLG  141 (150)
Q Consensus       116 ~~C~~C~~~f~~~~~l~~H~~~~~~~  141 (150)
                      ..|-++|+.|.+   |.+|+.+|++=
T Consensus        77 IicLEDGkkfKS---LKRHL~t~~gm   99 (148)
T COG4957          77 IICLEDGKKFKS---LKRHLTTHYGL   99 (148)
T ss_pred             EEEeccCcchHH---HHHHHhcccCC
Confidence            468889988865   88999888753


No 113
>PF07754 DUF1610:  Domain of unknown function (DUF1610);  InterPro: IPR011668 This domain is found in archaeal species. It is likely to bind zinc via its four well-conserved cysteine residues.
Probab=74.16  E-value=1  Score=17.85  Aligned_cols=9  Identities=33%  Similarity=0.855  Sum_probs=6.0

Q ss_pred             CcCCcchhh
Q psy12196        115 QIQCPYCIT  123 (150)
Q Consensus       115 ~~~C~~C~~  123 (150)
                      .|.||.||+
T Consensus        16 ~f~CPnCG~   24 (24)
T PF07754_consen   16 PFPCPNCGF   24 (24)
T ss_pred             eEeCCCCCC
Confidence            677777763


No 114
>PF13451 zf-trcl:  Probable zinc-binding domain
Probab=73.27  E-value=3.6  Score=19.56  Aligned_cols=17  Identities=24%  Similarity=0.569  Sum_probs=9.7

Q ss_pred             CcccCCCChhhhcchhH
Q psy12196         84 KSYQCNECPESFERLNK  100 (150)
Q Consensus        84 ~~~~c~~c~~~~~~~~~  100 (150)
                      +.+.|..||..|.....
T Consensus         3 k~l~C~dCg~~FvfTa~   19 (49)
T PF13451_consen    3 KTLTCKDCGAEFVFTAG   19 (49)
T ss_pred             eeEEcccCCCeEEEehh
Confidence            34566666666655443


No 115
>KOG2807|consensus
Probab=72.46  E-value=5.8  Score=27.08  Aligned_cols=24  Identities=21%  Similarity=0.361  Sum_probs=19.7

Q ss_pred             CcCCcchhhhccCchHHHHHHHHh
Q psy12196        115 QIQCPYCITDFSEDKNLIQHIVSV  138 (150)
Q Consensus       115 ~~~C~~C~~~f~~~~~l~~H~~~~  138 (150)
                      -|+|..|...|....+...|-..|
T Consensus       345 ~y~C~~Ck~~FCldCDv~iHesLh  368 (378)
T KOG2807|consen  345 RYRCESCKNVFCLDCDVFIHESLH  368 (378)
T ss_pred             cEEchhccceeeccchHHHHhhhh
Confidence            688999999999888888776655


No 116
>PF03604 DNA_RNApol_7kD:  DNA directed RNA polymerase, 7 kDa subunit;  InterPro: IPR006591 DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Each class of RNA polymerase is assembled from 9 to 15 different polypeptides. Rbp10 (RNA polymerase CX) is a domain found in RNA polymerase subunit 10; present in RNA polymerase I, II and III.; GO: 0003677 DNA binding, 0003899 DNA-directed RNA polymerase activity, 0006351 transcription, DNA-dependent; PDB: 2PMZ_Z 3HKZ_X 2NVX_L 3S1Q_L 2JA6_L 3S17_L 3HOW_L 3HOV_L 3PO2_L 3HOZ_L ....
Probab=72.02  E-value=3.9  Score=17.47  Aligned_cols=6  Identities=33%  Similarity=1.149  Sum_probs=2.4

Q ss_pred             ccCCCC
Q psy12196         59 TCRRCP   64 (150)
Q Consensus        59 ~c~~c~   64 (150)
                      .|+.||
T Consensus        19 rC~~CG   24 (32)
T PF03604_consen   19 RCPECG   24 (32)
T ss_dssp             SBSSSS
T ss_pred             ECCcCC
Confidence            344443


No 117
>PRK09678 DNA-binding transcriptional regulator; Provisional
Probab=71.60  E-value=1.2  Score=23.15  Aligned_cols=41  Identities=24%  Similarity=0.365  Sum_probs=19.8

Q ss_pred             CCCCcccccccCHHHHHHHHHHHhhCCCcceecc--cccccccChHH
Q psy12196          1 MSCVPCDVLFHNKATLYKHLYLEHKATSLSIQCN--MCSLVLDSKES   45 (150)
Q Consensus         1 ~~C~~C~~~f~~~~~l~~h~~~~~~~~~~~~~c~--~c~~~f~~~~~   45 (150)
                      +.|+.||.......+-......    ...-++|.  .|+.+|.....
T Consensus         2 m~CP~Cg~~a~irtSr~~s~~~----~~~Y~qC~N~eCg~tF~t~es   44 (72)
T PRK09678          2 FHCPLCQHAAHARTSRYITDTT----KERYHQCQNVNCSATFITYES   44 (72)
T ss_pred             ccCCCCCCccEEEEChhcChhh----heeeeecCCCCCCCEEEEEEE
Confidence            4577777655333332222111    22235666  67777765433


No 118
>COG3364 Zn-ribbon containing protein [General function prediction only]
Probab=71.41  E-value=2.4  Score=23.44  Aligned_cols=11  Identities=45%  Similarity=0.990  Sum_probs=5.7

Q ss_pred             ecccccccccC
Q psy12196         32 QCNMCSLVLDS   42 (150)
Q Consensus        32 ~c~~c~~~f~~   42 (150)
                      +|..||..|..
T Consensus         4 ~CtrCG~vf~~   14 (112)
T COG3364           4 QCTRCGEVFDD   14 (112)
T ss_pred             eeccccccccc
Confidence            45555555554


No 119
>PF04959 ARS2:  Arsenite-resistance protein 2;  InterPro: IPR007042 This entry represents Arsenite-resistance protein 2 (also known as Serrate RNA effector molecule homolog) which is thought to play a role in arsenite resistance [], although does not directly confer arsenite resistance but rather modulates arsenic sensitivity []. Arsenite is a carcinogenic compound which can act as a comutagen by inhibiting DNA repair. It is also involved in cell cycle progression at S phase. ; PDB: 3AX1_A.
Probab=70.01  E-value=3.2  Score=26.56  Aligned_cols=25  Identities=28%  Similarity=0.614  Sum_probs=18.7

Q ss_pred             CCCCcccccccCHHHHHHHHHHHhh
Q psy12196          1 MSCVPCDVLFHNKATLYKHLYLEHK   25 (150)
Q Consensus         1 ~~C~~C~~~f~~~~~l~~h~~~~~~   25 (150)
                      |.|..|++.|.....+..|+...|.
T Consensus        78 ~~C~lc~KlFkg~eFV~KHI~nKH~  102 (214)
T PF04959_consen   78 WRCPLCGKLFKGPEFVRKHIFNKHP  102 (214)
T ss_dssp             EEE-SSS-EESSHHHHHHHHHHH-H
T ss_pred             ECCCCCCcccCChHHHHHHHhhcCH
Confidence            4588899999999999999888776


No 120
>KOG4167|consensus
Probab=69.71  E-value=1.2  Score=33.49  Aligned_cols=24  Identities=17%  Similarity=0.443  Sum_probs=21.2

Q ss_pred             CCCCcccccccCHHHHHHHHHHHh
Q psy12196          1 MSCVPCDVLFHNKATLYKHLYLEH   24 (150)
Q Consensus         1 ~~C~~C~~~f~~~~~l~~h~~~~~   24 (150)
                      |.|..|++.|-...++..||+.|.
T Consensus       793 FpCreC~kvF~KiKSrNAHMK~Hr  816 (907)
T KOG4167|consen  793 FPCRECGKVFFKIKSRNAHMKTHR  816 (907)
T ss_pred             eehHHHHHHHHHHhhhhHHHHHHH
Confidence            679999999999999999998853


No 121
>COG5151 SSL1 RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, subunit SSL1 [Transcription / DNA replication, recombination, and repair]
Probab=68.64  E-value=3.7  Score=27.74  Aligned_cols=24  Identities=25%  Similarity=0.513  Sum_probs=20.8

Q ss_pred             CcCCcchhhhccCchHHHHHHHHh
Q psy12196        115 QIQCPYCITDFSEDKNLIQHIVSV  138 (150)
Q Consensus       115 ~~~C~~C~~~f~~~~~l~~H~~~~  138 (150)
                      .|+|+.|...|....+.-.|-..|
T Consensus       388 rY~Ce~CK~~FC~dCdvfiHe~Lh  411 (421)
T COG5151         388 RYQCELCKSTFCSDCDVFIHETLH  411 (421)
T ss_pred             ceechhhhhhhhhhhHHHHHHHHh
Confidence            799999999999999888887665


No 122
>KOG2785|consensus
Probab=67.75  E-value=10  Score=26.52  Aligned_cols=23  Identities=30%  Similarity=0.564  Sum_probs=13.8

Q ss_pred             CCcccccccCHHHHHHHHHHHhh
Q psy12196          3 CVPCDVLFHNKATLYKHLYLEHK   25 (150)
Q Consensus         3 C~~C~~~f~~~~~l~~h~~~~~~   25 (150)
                      |-.|+..+.+...-..||..+|+
T Consensus       169 CLfC~~~~k~~e~~~~HM~~~Hg  191 (390)
T KOG2785|consen  169 CLFCDKKSKSLEENLKHMFKEHG  191 (390)
T ss_pred             eeecCCCcccHHHHHHHHhhccC
Confidence            55566666666666666655443


No 123
>PF06524 NOA36:  NOA36 protein;  InterPro: IPR010531 This family consists of several NOA36 proteins which contain 29 highly conserved cysteine residues. The function of this protein is unknown.; GO: 0008270 zinc ion binding, 0005634 nucleus
Probab=67.65  E-value=1.9  Score=28.28  Aligned_cols=77  Identities=18%  Similarity=0.349  Sum_probs=35.3

Q ss_pred             CCcceecccccccccChHHHHHHHh---ccCCcccccCCCCcccCChHH------HHHHHHh----hcCCCcccCCCChh
Q psy12196         27 TSLSIQCNMCSLVLDSKESLVTHIS---QTHTLMFTCRRCPSTFLNSAT------LSKHVKM----EHNSKSYQCNECPE   93 (150)
Q Consensus        27 ~~~~~~c~~c~~~f~~~~~l~~h~~---~~~~~~~~c~~c~~~f~~~~~------l~~h~~~----~~~~~~~~c~~c~~   93 (150)
                      +...|.|.+|..-.- .-.-..|+.   ......|+|..|++.-..+-.      -..|.+.    ....+++.|+.||.
T Consensus       139 GGrif~CsfC~~flC-EDDQFEHQAsCQvLe~E~~KC~SCNrlGq~sCLRCK~cfCddHvrrKg~ky~k~k~~PCPKCg~  217 (314)
T PF06524_consen  139 GGRIFKCSFCDNFLC-EDDQFEHQASCQVLESETFKCQSCNRLGQYSCLRCKICFCDDHVRRKGFKYEKGKPIPCPKCGY  217 (314)
T ss_pred             CCeEEEeecCCCeee-ccchhhhhhhhhhhhcccccccccccccchhhhheeeeehhhhhhhcccccccCCCCCCCCCCC
Confidence            455688888876432 222223331   222255666666533221110      0122221    12235666777776


Q ss_pred             hhcchhHHhhH
Q psy12196         94 SFERLNKLKRH  104 (150)
Q Consensus        94 ~~~~~~~l~~h  104 (150)
                      .......|...
T Consensus       218 et~eTkdLSmS  228 (314)
T PF06524_consen  218 ETQETKDLSMS  228 (314)
T ss_pred             cccccccceee
Confidence            66655555443


No 124
>KOG2593|consensus
Probab=67.43  E-value=4.3  Score=28.73  Aligned_cols=36  Identities=22%  Similarity=0.620  Sum_probs=17.6

Q ss_pred             CCCcccCCCChhhhcchhHHhhHHhhhcCCCCCCcCCcchh
Q psy12196         82 NSKSYQCNECPESFERLNKLKRHKFQAHNDSVHQIQCPYCI  122 (150)
Q Consensus        82 ~~~~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~~C~~C~  122 (150)
                      ....|.|+.|.+.|+....++-   .-..++  .|.|..|+
T Consensus       125 ~~~~Y~Cp~C~kkyt~Lea~~L---~~~~~~--~F~C~~C~  160 (436)
T KOG2593|consen  125 NVAGYVCPNCQKKYTSLEALQL---LDNETG--EFHCENCG  160 (436)
T ss_pred             ccccccCCccccchhhhHHHHh---hcccCc--eEEEecCC
Confidence            3444666666666555444321   222233  55665555


No 125
>COG1996 RPC10 DNA-directed RNA polymerase, subunit RPC10 (contains C4-type Zn-finger) [Transcription]
Probab=67.21  E-value=3  Score=19.84  Aligned_cols=10  Identities=30%  Similarity=1.049  Sum_probs=4.1

Q ss_pred             ccCCCChhhh
Q psy12196         86 YQCNECPESF   95 (150)
Q Consensus        86 ~~c~~c~~~~   95 (150)
                      |.|..||+.+
T Consensus         7 Y~C~~Cg~~~   16 (49)
T COG1996           7 YKCARCGREV   16 (49)
T ss_pred             EEhhhcCCee
Confidence            3444444433


No 126
>PRK03824 hypA hydrogenase nickel incorporation protein; Provisional
Probab=66.01  E-value=2.3  Score=25.02  Aligned_cols=13  Identities=15%  Similarity=0.662  Sum_probs=8.0

Q ss_pred             cccCCCChhhhcc
Q psy12196         85 SYQCNECPESFER   97 (150)
Q Consensus        85 ~~~c~~c~~~~~~   97 (150)
                      .+.|..||..|..
T Consensus        70 ~~~C~~CG~~~~~   82 (135)
T PRK03824         70 VLKCRNCGNEWSL   82 (135)
T ss_pred             EEECCCCCCEEec
Confidence            3667777765554


No 127
>COG1997 RPL43A Ribosomal protein L37AE/L43A [Translation, ribosomal structure and biogenesis]
Probab=65.98  E-value=3.7  Score=22.07  Aligned_cols=11  Identities=27%  Similarity=1.078  Sum_probs=5.2

Q ss_pred             ccCCCChhhhc
Q psy12196         86 YQCNECPESFE   96 (150)
Q Consensus        86 ~~c~~c~~~~~   96 (150)
                      |.|..||..|.
T Consensus        54 W~C~kCg~~fA   64 (89)
T COG1997          54 WKCRKCGAKFA   64 (89)
T ss_pred             EEcCCCCCeec
Confidence            44444544443


No 128
>PTZ00255 60S ribosomal protein L37a; Provisional
Probab=63.92  E-value=7.8  Score=21.10  Aligned_cols=14  Identities=21%  Similarity=0.645  Sum_probs=7.6

Q ss_pred             CcccccCCCCcccC
Q psy12196         55 TLMFTCRRCPSTFL   68 (150)
Q Consensus        55 ~~~~~c~~c~~~f~   68 (150)
                      ...+.|..|++.|.
T Consensus        52 ~GIW~C~~C~~~~A   65 (90)
T PTZ00255         52 VGIWRCKGCKKTVA   65 (90)
T ss_pred             eEEEEcCCCCCEEe
Confidence            34555666655553


No 129
>COG0068 HypF Hydrogenase maturation factor [Posttranslational modification, protein turnover, chaperones]
Probab=63.08  E-value=0.66  Score=34.73  Aligned_cols=57  Identities=18%  Similarity=0.385  Sum_probs=27.6

Q ss_pred             cccCCCCcccCChHHHHHHHHhhcCCCc-ccCCCChhhhcchhHHhhHHhhhcCCCCCCcCCcchhh
Q psy12196         58 FTCRRCPSTFLNSATLSKHVKMEHNSKS-YQCNECPESFERLNKLKRHKFQAHNDSVHQIQCPYCIT  123 (150)
Q Consensus        58 ~~c~~c~~~f~~~~~l~~h~~~~~~~~~-~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~~C~~C~~  123 (150)
                      ..|..||-+|.-...|.- -+..+.=.. --|..|.+.+....+-+    .|..    +..|+.||=
T Consensus       124 ~~CT~CGPRfTIi~alPY-DR~nTsM~~F~lC~~C~~EY~dP~nRR----fHAQ----p~aCp~CGP  181 (750)
T COG0068         124 INCTNCGPRFTIIEALPY-DRENTSMADFPLCPFCDKEYKDPLNRR----FHAQ----PIACPKCGP  181 (750)
T ss_pred             cccCCCCcceeeeccCCC-CcccCccccCcCCHHHHHHhcCccccc----cccc----cccCcccCC
Confidence            357777777654433221 122222111 24777777666554322    2222    556777774


No 130
>PF13453 zf-TFIIB:  Transcription factor zinc-finger
Probab=62.76  E-value=6.9  Score=17.57  Aligned_cols=18  Identities=17%  Similarity=0.206  Sum_probs=9.6

Q ss_pred             eecccccccccChHHHHH
Q psy12196         31 IQCNMCSLVLDSKESLVT   48 (150)
Q Consensus        31 ~~c~~c~~~f~~~~~l~~   48 (150)
                      ..|+.|+-.|.....+..
T Consensus        20 d~C~~C~G~W~d~~el~~   37 (41)
T PF13453_consen   20 DVCPSCGGIWFDAGELEK   37 (41)
T ss_pred             EECCCCCeEEccHHHHHH
Confidence            446666655555554443


No 131
>PF05290 Baculo_IE-1:  Baculovirus immediate-early protein (IE-0);  InterPro: IPR007954 This entry contains the Baculovirus immediate-early protein IE-0.
Probab=61.41  E-value=5.6  Score=23.35  Aligned_cols=13  Identities=38%  Similarity=0.943  Sum_probs=8.9

Q ss_pred             CCcchhhhccCch
Q psy12196        117 QCPYCITDFSEDK  129 (150)
Q Consensus       117 ~C~~C~~~f~~~~  129 (150)
                      +||.|.-+|.+.+
T Consensus       123 vCPvCkTSFKss~  135 (140)
T PF05290_consen  123 VCPVCKTSFKSSS  135 (140)
T ss_pred             CCCcccccccccc
Confidence            5777777776654


No 132
>TIGR00280 L37a ribosomal protein L37a. This model finds eukaryotic ribosomal protein L37a and its archaeal orthologs. The nomeclature is tricky because eukaryotes have proteins called both L37 and L37a.
Probab=60.88  E-value=8.1  Score=21.08  Aligned_cols=29  Identities=28%  Similarity=0.721  Sum_probs=15.6

Q ss_pred             eecccccccccChHHHHHHHhccCCcccccCCCCcccC
Q psy12196         31 IQCNMCSLVLDSKESLVTHISQTHTLMFTCRRCPSTFL   68 (150)
Q Consensus        31 ~~c~~c~~~f~~~~~l~~h~~~~~~~~~~c~~c~~~f~   68 (150)
                      |.|+.|++.-         +.+.....+.|..|++.|.
T Consensus        36 y~CpfCgk~~---------vkR~a~GIW~C~~C~~~~A   64 (91)
T TIGR00280        36 YVCPFCGKKT---------VKRGSTGIWTCRKCGAKFA   64 (91)
T ss_pred             ccCCCCCCCc---------eEEEeeEEEEcCCCCCEEe
Confidence            5666666531         1233445566666666553


No 133
>PRK04023 DNA polymerase II large subunit; Validated
Probab=60.43  E-value=11  Score=30.08  Aligned_cols=10  Identities=20%  Similarity=0.601  Sum_probs=5.7

Q ss_pred             CcCCcchhhh
Q psy12196        115 QIQCPYCITD  124 (150)
Q Consensus       115 ~~~C~~C~~~  124 (150)
                      ++.|+.|+..
T Consensus       663 ~y~CPKCG~E  672 (1121)
T PRK04023        663 EDECEKCGRE  672 (1121)
T ss_pred             CCcCCCCCCC
Confidence            4556666643


No 134
>PF04780 DUF629:  Protein of unknown function (DUF629);  InterPro: IPR006865 This domain represents a region of several plant proteins of unknown function. A C2H2 zinc finger is predicted in this region in some family members, but the spacing between the cysteine residues is not conserved throughout the family.
Probab=60.05  E-value=9  Score=27.73  Aligned_cols=24  Identities=25%  Similarity=0.520  Sum_probs=19.0

Q ss_pred             CCCcccccccCHHHHHHHHHHHhh
Q psy12196          2 SCVPCDVLFHNKATLYKHLYLEHK   25 (150)
Q Consensus         2 ~C~~C~~~f~~~~~l~~h~~~~~~   25 (150)
                      .|+.|++.|.+...++.|+...|.
T Consensus        59 iCp~CskkF~d~~~~~~H~~~eH~   82 (466)
T PF04780_consen   59 ICPRCSKKFSDAESCLSHMEQEHP   82 (466)
T ss_pred             eCCcccceeCCHHHHHHHHHHhhh
Confidence            578888888888888888877665


No 135
>PF07503 zf-HYPF:  HypF finger;  InterPro: IPR011125 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  Proteins of the HypF family are involved in the maturation and regulation of hydrogenase []. In the N terminus they appear to have two zinc finger domains that are similar to those found in the DnaJ chaperone []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 3TTD_A 3TSQ_A 3TTC_A 3TSP_A 3TTF_A 3TSU_A.
Probab=59.29  E-value=3.1  Score=18.22  Aligned_cols=12  Identities=17%  Similarity=0.814  Sum_probs=4.8

Q ss_pred             cccccCCCCccc
Q psy12196         56 LMFTCRRCPSTF   67 (150)
Q Consensus        56 ~~~~c~~c~~~f   67 (150)
                      .+..|+.||-.+
T Consensus        20 ~~isC~~CGPr~   31 (35)
T PF07503_consen   20 QFISCTNCGPRY   31 (35)
T ss_dssp             TT--BTTCC-SC
T ss_pred             cCccCCCCCCCE
Confidence            444566665443


No 136
>COG0068 HypF Hydrogenase maturation factor [Posttranslational modification, protein turnover, chaperones]
Probab=59.22  E-value=1.7  Score=32.80  Aligned_cols=28  Identities=18%  Similarity=0.543  Sum_probs=12.7

Q ss_pred             cccccccccChHHHHHHHhccCCcccccCCCCc
Q psy12196         33 CNMCSLVLDSKESLVTHISQTHTLMFTCRRCPS   65 (150)
Q Consensus        33 c~~c~~~f~~~~~l~~h~~~~~~~~~~c~~c~~   65 (150)
                      |+.|.+.+.++..     ++-|..|..|+.||-
T Consensus       154 C~~C~~EY~dP~n-----RRfHAQp~aCp~CGP  181 (750)
T COG0068         154 CPFCDKEYKDPLN-----RRFHAQPIACPKCGP  181 (750)
T ss_pred             CHHHHHHhcCccc-----cccccccccCcccCC
Confidence            5555554444433     223334445555553


No 137
>PF01780 Ribosomal_L37ae:  Ribosomal L37ae protein family;  InterPro: IPR002674 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms. The codons of the mRNA are exposed on the ribosome to allow tRNA binding. This leads to the incorporation of amino acids into the growing polypeptide chain in accordance with the genetic information. Incoming amino acid monomers enter the ribosomal A site in the form of aminoacyl-tRNAs complexed with elongation factor Tu (EF-Tu) and GTP. The growing polypeptide chain, situated in the P site as peptidyl-tRNA, is then transferred to aminoacyl-tRNA and the new peptidyl-tRNA, extended by one residue, is translocated to the P site with the aid the elongation factor G (EF-G) and GTP as the deacylated tRNA is released from the ribosome through one or more exit sites [, ]. About 2/3 of the mass of the ribosome consists of RNA and 1/3 of protein. The proteins are named in accordance with the subunit of the ribosome which they belong to - the small (S1 to S31) and the large (L1 to L44). Usually they decorate the rRNA cores of the subunits.  Many ribosomal proteins, particularly those of the large subunit, are composed of a globular, surfaced-exposed domain with long finger-like projections that extend into the rRNA core to stabilise its structure. Most of the proteins interact with multiple RNA elements, often from different domains. In the large subunit, about 1/3 of the 23S rRNA nucleotides are at least in van der Waal's contact with protein, and L22 interacts with all six domains of the 23S rRNA. Proteins S4 and S7, which initiate assembly of the 16S rRNA, are located at junctions of five and four RNA helices, respectively. In this way proteins serve to organise and stabilise the rRNA tertiary structure. While the crucial activities of decoding and peptide transfer are RNA based, proteins play an active role in functions that may have evolved to streamline the process of protein synthesis. In addition to their function in the ribosome, many ribosomal proteins have some function 'outside' the ribosome [, ]. This ribosomal protein is found in archaebacteria and eukaryotes []. Ribosomal protein L37 has a single zinc finger-like motif of the C2-C2 type [].; GO: 0003735 structural constituent of ribosome, 0006412 translation, 0005622 intracellular, 0005840 ribosome; PDB: 4A1E_Y 4A17_Y 4A1C_Y 4A1A_Y 3O58_g 3IZS_m 3O5H_g 1S1I_9 3IZR_m 1YSH_D ....
Probab=58.68  E-value=4.4  Score=22.03  Aligned_cols=28  Identities=21%  Similarity=0.660  Sum_probs=14.7

Q ss_pred             eecccccccccChHHHHHHHhccCCcccccCCCCccc
Q psy12196         31 IQCNMCSLVLDSKESLVTHISQTHTLMFTCRRCPSTF   67 (150)
Q Consensus        31 ~~c~~c~~~f~~~~~l~~h~~~~~~~~~~c~~c~~~f   67 (150)
                      |.|+.|++.--         .+....-|.|..|++.|
T Consensus        36 y~Cp~Cgk~~v---------kR~a~GIW~C~~C~~~~   63 (90)
T PF01780_consen   36 YTCPFCGKTSV---------KRVATGIWKCKKCGKKF   63 (90)
T ss_dssp             BEESSSSSSEE---------EEEETTEEEETTTTEEE
T ss_pred             CcCCCCCCcee---------EEeeeEEeecCCCCCEE
Confidence            56666666421         13333446666666555


No 138
>PRK03976 rpl37ae 50S ribosomal protein L37Ae; Reviewed
Probab=57.39  E-value=9.8  Score=20.72  Aligned_cols=29  Identities=24%  Similarity=0.661  Sum_probs=15.2

Q ss_pred             eecccccccccChHHHHHHHhccCCcccccCCCCcccC
Q psy12196         31 IQCNMCSLVLDSKESLVTHISQTHTLMFTCRRCPSTFL   68 (150)
Q Consensus        31 ~~c~~c~~~f~~~~~l~~h~~~~~~~~~~c~~c~~~f~   68 (150)
                      |.|+.|++.-         +.+.....+.|..|++.|.
T Consensus        37 y~CpfCgk~~---------vkR~a~GIW~C~~C~~~~A   65 (90)
T PRK03976         37 HVCPVCGRPK---------VKRVGTGIWECRKCGAKFA   65 (90)
T ss_pred             ccCCCCCCCc---------eEEEEEEEEEcCCCCCEEe
Confidence            5666665431         1233345566666665553


No 139
>smart00440 ZnF_C2C2 C2C2 Zinc finger. Nucleic-acid-binding motif in transcriptional elongation factor TFIIS and RNA polymerases.
Probab=56.76  E-value=0.89  Score=20.52  Aligned_cols=12  Identities=17%  Similarity=0.404  Sum_probs=8.1

Q ss_pred             CcCCcchhhhcc
Q psy12196        115 QIQCPYCITDFS  126 (150)
Q Consensus       115 ~~~C~~C~~~f~  126 (150)
                      -|.|..|+..+.
T Consensus        28 fy~C~~C~~~w~   39 (40)
T smart00440       28 FYVCTKCGHRWR   39 (40)
T ss_pred             EEEeCCCCCEeC
Confidence            477877876654


No 140
>KOG2593|consensus
Probab=56.62  E-value=8.7  Score=27.33  Aligned_cols=38  Identities=24%  Similarity=0.399  Sum_probs=23.5

Q ss_pred             CcceecccccccccChHHHHHHHhccCCcccccCCCCccc
Q psy12196         28 SLSIQCNMCSLVLDSKESLVTHISQTHTLMFTCRRCPSTF   67 (150)
Q Consensus        28 ~~~~~c~~c~~~f~~~~~l~~h~~~~~~~~~~c~~c~~~f   67 (150)
                      ...|.|+.|.+.|..-..+..-  ......|.|..|+...
T Consensus       126 ~~~Y~Cp~C~kkyt~Lea~~L~--~~~~~~F~C~~C~gel  163 (436)
T KOG2593|consen  126 VAGYVCPNCQKKYTSLEALQLL--DNETGEFHCENCGGEL  163 (436)
T ss_pred             cccccCCccccchhhhHHHHhh--cccCceEEEecCCCch
Confidence            4568899999888754333321  2234577888886544


No 141
>COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair]
Probab=55.02  E-value=5.1  Score=30.73  Aligned_cols=10  Identities=30%  Similarity=0.856  Sum_probs=6.9

Q ss_pred             CcCCcchhhh
Q psy12196        115 QIQCPYCITD  124 (150)
Q Consensus       115 ~~~C~~C~~~  124 (150)
                      |..|+.||..
T Consensus       475 p~~Cp~Cgs~  484 (730)
T COG1198         475 PQSCPECGSE  484 (730)
T ss_pred             CCCCCCCCCC
Confidence            6677777744


No 142
>PF13878 zf-C2H2_3:  zinc-finger of acetyl-transferase ESCO
Probab=54.80  E-value=20  Score=16.16  Aligned_cols=23  Identities=22%  Similarity=0.365  Sum_probs=11.6

Q ss_pred             cccCCCCcccC--ChHHHHHHHHhh
Q psy12196         58 FTCRRCPSTFL--NSATLSKHVKME   80 (150)
Q Consensus        58 ~~c~~c~~~f~--~~~~l~~h~~~~   80 (150)
                      ..|+.||..|.  ...+...|.+-|
T Consensus        14 ~~C~~CgM~Y~~~~~eD~~~H~~yH   38 (41)
T PF13878_consen   14 TTCPTCGMLYSPGSPEDEKLHKKYH   38 (41)
T ss_pred             cCCCCCCCEECCCCHHHHHHHHHHH
Confidence            35666665554  234444554444


No 143
>PF15135 UPF0515:  Uncharacterised protein UPF0515
Probab=54.53  E-value=7.3  Score=25.52  Aligned_cols=13  Identities=31%  Similarity=0.971  Sum_probs=6.8

Q ss_pred             CcCCcchhhhccC
Q psy12196        115 QIQCPYCITDFSE  127 (150)
Q Consensus       115 ~~~C~~C~~~f~~  127 (150)
                      .|.|+.|+..|+.
T Consensus       155 ef~C~~C~h~F~G  167 (278)
T PF15135_consen  155 EFHCPKCRHNFRG  167 (278)
T ss_pred             eeecccccccchh
Confidence            4555555555543


No 144
>PF12760 Zn_Tnp_IS1595:  Transposase zinc-ribbon domain;  InterPro: IPR024442 This zinc binding domain is found in a range of transposase proteins such as ISSPO8, ISSOD11, ISRSSP2 etc. It may be a zinc-binding beta ribbon domain that could bind DNA.
Probab=52.93  E-value=13  Score=17.13  Aligned_cols=8  Identities=25%  Similarity=0.837  Sum_probs=3.9

Q ss_pred             CcCCcchh
Q psy12196        115 QIQCPYCI  122 (150)
Q Consensus       115 ~~~C~~C~  122 (150)
                      .|+|..|.
T Consensus        37 ~~~C~~C~   44 (46)
T PF12760_consen   37 RYRCKACR   44 (46)
T ss_pred             eEECCCCC
Confidence            44555543


No 145
>KOG2636|consensus
Probab=50.98  E-value=13  Score=26.69  Aligned_cols=21  Identities=19%  Similarity=0.444  Sum_probs=19.1

Q ss_pred             CcCCcchh-hhccCchHHHHHH
Q psy12196        115 QIQCPYCI-TDFSEDKNLIQHI  135 (150)
Q Consensus       115 ~~~C~~C~-~~f~~~~~l~~H~  135 (150)
                      .|.|.+|| +++.-..+|.+|+
T Consensus       401 ey~CEICGNy~Y~GrkaF~RHF  422 (497)
T KOG2636|consen  401 EYNCEICGNYVYKGRKAFDRHF  422 (497)
T ss_pred             ccceeeccCccccCcHHHHHHh
Confidence            78999999 8888999999997


No 146
>TIGR00595 priA primosomal protein N'. All proteins in this family for which functions are known are components of the primosome which is involved in replication, repair, and recombination.This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=49.84  E-value=7.8  Score=28.40  Aligned_cols=9  Identities=33%  Similarity=0.873  Sum_probs=4.9

Q ss_pred             CcCCcchhh
Q psy12196        115 QIQCPYCIT  123 (150)
Q Consensus       115 ~~~C~~C~~  123 (150)
                      +..|+.|+.
T Consensus       253 ~~~Cp~C~s  261 (505)
T TIGR00595       253 PKTCPQCGS  261 (505)
T ss_pred             CCCCCCCCC
Confidence            445666653


No 147
>COG4530 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=49.67  E-value=6.4  Score=22.18  Aligned_cols=11  Identities=9%  Similarity=0.036  Sum_probs=4.9

Q ss_pred             cccCCCChhhh
Q psy12196         85 SYQCNECPESF   95 (150)
Q Consensus        85 ~~~c~~c~~~~   95 (150)
                      |..|+.||++|
T Consensus        26 PiVsPytG~s~   36 (129)
T COG4530          26 PIVSPYTGKSY   36 (129)
T ss_pred             ccccCcccccc
Confidence            34444444444


No 148
>COG1675 TFA1 Transcription initiation factor IIE, alpha subunit [Transcription]
Probab=49.57  E-value=28  Score=21.72  Aligned_cols=33  Identities=21%  Similarity=0.564  Sum_probs=18.1

Q ss_pred             cCCCcccCCCChhhhcchhHHhhHHhhhcCCCCCCcCCcchhhh
Q psy12196         81 HNSKSYQCNECPESFERLNKLKRHKFQAHNDSVHQIQCPYCITD  124 (150)
Q Consensus        81 ~~~~~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~~C~~C~~~  124 (150)
                      .+..-|.|+.|...++...+...           .|.||.||-.
T Consensus       109 ~~~~~y~C~~~~~r~sfdeA~~~-----------~F~Cp~Cg~~  141 (176)
T COG1675         109 TENNYYVCPNCHVKYSFDEAMEL-----------GFTCPKCGED  141 (176)
T ss_pred             ccCCceeCCCCCCcccHHHHHHh-----------CCCCCCCCch
Confidence            34556777666655544332210           3677777754


No 149
>PRK00432 30S ribosomal protein S27ae; Validated
Probab=48.62  E-value=13  Score=17.77  Aligned_cols=9  Identities=22%  Similarity=1.003  Sum_probs=4.9

Q ss_pred             ccCCCChhh
Q psy12196         86 YQCNECPES   94 (150)
Q Consensus        86 ~~c~~c~~~   94 (150)
                      +.|..||..
T Consensus        38 ~~C~~Cgyt   46 (50)
T PRK00432         38 WHCGKCGYT   46 (50)
T ss_pred             EECCCcCCE
Confidence            556666543


No 150
>KOG2272|consensus
Probab=48.35  E-value=11  Score=24.79  Aligned_cols=19  Identities=11%  Similarity=0.373  Sum_probs=10.6

Q ss_pred             CCCCcccccccCHHHHHHH
Q psy12196          1 MSCVPCDVLFHNKATLYKH   19 (150)
Q Consensus         1 ~~C~~C~~~f~~~~~l~~h   19 (150)
                      |.|+.|.+.+.+...++..
T Consensus       100 F~Cd~Cn~~Lad~gf~rnq  118 (332)
T KOG2272|consen  100 FRCDLCNKHLADQGFYRNQ  118 (332)
T ss_pred             chhHHHHHHHhhhhhHhhc
Confidence            3456666666665555543


No 151
>PLN03238 probable histone acetyltransferase MYST; Provisional
Probab=48.15  E-value=15  Score=24.73  Aligned_cols=25  Identities=24%  Similarity=0.681  Sum_probs=18.5

Q ss_pred             CcCCcchhhhccCchHHHHHHHHhc
Q psy12196        115 QIQCPYCITDFSEDKNLIQHIVSVH  139 (150)
Q Consensus       115 ~~~C~~C~~~f~~~~~l~~H~~~~~  139 (150)
                      -|.|..|-+-|.+...|.+|+....
T Consensus        48 lyiCe~Clky~~~~~~l~~H~~~C~   72 (290)
T PLN03238         48 LYICEYCLKYMRKKKSLLRHLAKCD   72 (290)
T ss_pred             EEEcCCCcchhCCHHHHHHHHHhCC
Confidence            6777778877778778888876543


No 152
>COG1655 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=44.86  E-value=4.8  Score=26.01  Aligned_cols=6  Identities=33%  Similarity=0.822  Sum_probs=3.3

Q ss_pred             cCCCCh
Q psy12196         87 QCNECP   92 (150)
Q Consensus        87 ~c~~c~   92 (150)
                      .|+.|.
T Consensus        64 vCP~C~   69 (267)
T COG1655          64 VCPICY   69 (267)
T ss_pred             Ecchhh
Confidence            455554


No 153
>KOG2907|consensus
Probab=44.32  E-value=9.6  Score=21.64  Aligned_cols=40  Identities=23%  Similarity=0.443  Sum_probs=21.9

Q ss_pred             ccCCCChhhhcchhHHhhHHhhhcCCCCCCcCCcchhhhccC
Q psy12196         86 YQCNECPESFERLNKLKRHKFQAHNDSVHQIQCPYCITDFSE  127 (150)
Q Consensus        86 ~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~~C~~C~~~f~~  127 (150)
                      .+|+.||-.-.....|+  ++........-|.|+.|++.|..
T Consensus        75 ~kCpkCghe~m~Y~T~Q--lRSADEGQTVFYTC~kC~~k~~e  114 (116)
T KOG2907|consen   75 HKCPKCGHEEMSYHTLQ--LRSADEGQTVFYTCPKCKYKFTE  114 (116)
T ss_pred             ccCcccCCchhhhhhhh--cccccCCceEEEEcCccceeeec
Confidence            46888875433333332  12222222335889999888765


No 154
>PF08790 zf-LYAR:  LYAR-type C2HC zinc finger ;  InterPro: IPR014898 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This C2HC zinc finger domain is found in LYAR proteins such as Q08288 from SWISSPROT, which are involved in cell growth regulation.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 1WJV_A.
Probab=44.22  E-value=6.5  Score=16.25  Aligned_cols=8  Identities=38%  Similarity=1.331  Sum_probs=3.3

Q ss_pred             CCCChhhh
Q psy12196         88 CNECPESF   95 (150)
Q Consensus        88 c~~c~~~~   95 (150)
                      |-.|++.|
T Consensus         3 CiDC~~~F   10 (28)
T PF08790_consen    3 CIDCSKDF   10 (28)
T ss_dssp             ETTTTEEE
T ss_pred             eecCCCCc
Confidence            33344444


No 155
>TIGR00100 hypA hydrogenase nickel insertion protein HypA. In Hpylori, hypA mutant abolished hydrogenase activity and decrease in urease activity. Nickel supplementation in media restored urease activity and partial hydrogenase activity. HypA probably involved in inserting Ni in enzymes.
Probab=44.07  E-value=8.7  Score=21.93  Aligned_cols=10  Identities=20%  Similarity=0.760  Sum_probs=4.4

Q ss_pred             cccCCCCccc
Q psy12196         58 FTCRRCPSTF   67 (150)
Q Consensus        58 ~~c~~c~~~f   67 (150)
                      ..|..|+..|
T Consensus        71 ~~C~~Cg~~~   80 (115)
T TIGR00100        71 CECEDCSEEV   80 (115)
T ss_pred             EEcccCCCEE
Confidence            3444444443


No 156
>COG5112 UFD2 U1-like Zn-finger-containing protein [General function prediction only]
Probab=43.50  E-value=12  Score=20.90  Aligned_cols=24  Identities=29%  Similarity=0.452  Sum_probs=17.6

Q ss_pred             CcCCcchhhhccCchHHHHHHHHh
Q psy12196        115 QIQCPYCITDFSEDKNLIQHIVSV  138 (150)
Q Consensus       115 ~~~C~~C~~~f~~~~~l~~H~~~~  138 (150)
                      .+-|-.|.+-|-+...|..|.+..
T Consensus        55 qhYCieCaryf~t~~aL~~Hkkgk   78 (126)
T COG5112          55 QHYCIECARYFITEKALMEHKKGK   78 (126)
T ss_pred             eeeeehhHHHHHHHHHHHHHhccc
Confidence            556777888888888888877543


No 157
>PLN02294 cytochrome c oxidase subunit Vb
Probab=42.65  E-value=12  Score=23.11  Aligned_cols=15  Identities=27%  Similarity=0.815  Sum_probs=12.5

Q ss_pred             CCcCCcchhhhccCc
Q psy12196        114 HQIQCPYCITDFSED  128 (150)
Q Consensus       114 ~~~~C~~C~~~f~~~  128 (150)
                      ++..|++||..|..+
T Consensus       140 kp~RCpeCG~~fkL~  154 (174)
T PLN02294        140 KSFECPVCTQYFELE  154 (174)
T ss_pred             CceeCCCCCCEEEEE
Confidence            388999999998754


No 158
>smart00154 ZnF_AN1 AN1-like Zinc finger. Zinc finger at the C-terminus of An1, a ubiquitin-like protein in Xenopus laevis.
Probab=42.60  E-value=9  Score=17.13  Aligned_cols=14  Identities=21%  Similarity=0.534  Sum_probs=11.6

Q ss_pred             CcCCcchhhhccCc
Q psy12196        115 QIQCPYCITDFSED  128 (150)
Q Consensus       115 ~~~C~~C~~~f~~~  128 (150)
                      ++.|..|++.|-..
T Consensus        12 ~f~C~~C~~~FC~~   25 (39)
T smart00154       12 GFKCRHCGNLFCGE   25 (39)
T ss_pred             CeECCccCCccccc
Confidence            77899999888765


No 159
>KOG1280|consensus
Probab=42.35  E-value=22  Score=24.71  Aligned_cols=38  Identities=21%  Similarity=0.496  Sum_probs=25.0

Q ss_pred             cccCCCChhhhcchhHHhhHHhhhcCCCCCCcCCcchh
Q psy12196         85 SYQCNECPESFERLNKLKRHKFQAHNDSVHQIQCPYCI  122 (150)
Q Consensus        85 ~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~~C~~C~  122 (150)
                      -|.|..|+..-.+...|..|....+.+......|+.|+
T Consensus        79 SftCPyC~~~Gfte~~f~~Hv~s~Hpda~~~~icp~c~  116 (381)
T KOG1280|consen   79 SFTCPYCGIMGFTERQFGTHVLSQHPEASTSVICPLCA  116 (381)
T ss_pred             cccCCcccccccchhHHHHHhhhcCcccCcceeeeccc
Confidence            47777777666666677777766665554445666665


No 160
>cd00924 Cyt_c_Oxidase_Vb Cytochrome c oxidase subunit Vb.  Cytochrome c oxidase (CcO), the terminal oxidase in the respiratory chains of eukaryotes and most bacteria, is a multi-chain transmembrane protein located in the inner membrane of mitochondria and the cell membrane of prokaryotes.  It catalyzes the reduction of O2 and simultaneously pumps protons across the membrane.  The number of subunits varies from three to five in bacteria and up to 13 in mammalian mitochondria. Subunits I, II, and III of mammalian CcO are encoded within the mitochondrial genome and the remaining 10 subunits are encoded within the nuclear genome.  Found only in eukaryotes, subunit Vb is one of three mammalian subunits that lacks a transmembrane region.  Subunit Vb is located on the matrix side of the membrane and binds the regulatory subunit of protein kinase A.  The abnormally extended conformation is stable only in the CcO assembly.
Probab=42.23  E-value=11  Score=20.86  Aligned_cols=13  Identities=31%  Similarity=0.608  Sum_probs=11.1

Q ss_pred             CcCCcchhhhccC
Q psy12196        115 QIQCPYCITDFSE  127 (150)
Q Consensus       115 ~~~C~~C~~~f~~  127 (150)
                      +.+|+.||..|..
T Consensus        79 ~~rC~eCG~~fkL   91 (97)
T cd00924          79 PKRCPECGHVFKL   91 (97)
T ss_pred             ceeCCCCCcEEEE
Confidence            8899999988864


No 161
>PF08209 Sgf11:  Sgf11 (transcriptional regulation protein);  InterPro: IPR013246 The Sgf11 family is a SAGA complex subunit in Saccharomyces cerevisiae (Baker's yeast). The SAGA complex is a multisubunit protein complex involved in transcriptional regulation. SAGA combines proteins involved in interactions with DNA-bound activators and TATA-binding protein (TBP), as well as enzymes for histone acetylation and deubiquitylation [].; PDB: 3M99_B 2LO2_A 3MHH_C 3MHS_C.
Probab=42.16  E-value=21  Score=15.36  Aligned_cols=22  Identities=18%  Similarity=0.585  Sum_probs=10.8

Q ss_pred             cCCcchhhhccCchHHHHHHHHh
Q psy12196        116 IQCPYCITDFSEDKNLIQHIVSV  138 (150)
Q Consensus       116 ~~C~~C~~~f~~~~~l~~H~~~~  138 (150)
                      +.|+.|++.+... -+..|+...
T Consensus         5 ~~C~nC~R~v~a~-RfA~HLekC   26 (33)
T PF08209_consen    5 VECPNCGRPVAAS-RFAPHLEKC   26 (33)
T ss_dssp             EE-TTTSSEEEGG-GHHHHHHHH
T ss_pred             EECCCCcCCcchh-hhHHHHHHH
Confidence            4566666554442 355555443


No 162
>PF04423 Rad50_zn_hook:  Rad50 zinc hook motif;  InterPro: IPR007517 The Mre11 complex (Mre11 Rad50 Nbs1) is central to chromosomal maintenance and functions in homologous recombination, telomere maintenance and sister chromatid association. The Rad50 coiled-coil region contains a dimer interface at the apex of the coiled coils in which pairs of conserved Cys-X-X-Cys motifs form interlocking hooks that bind one Zn ion. This alignment includes the zinc hook motif and a short stretch of coiled-coil on either side.; GO: 0004518 nuclease activity, 0005524 ATP binding, 0008270 zinc ion binding, 0006281 DNA repair; PDB: 1L8D_B.
Probab=41.86  E-value=8.2  Score=18.54  Aligned_cols=21  Identities=33%  Similarity=0.649  Sum_probs=10.8

Q ss_pred             CCcchhhhccC--chHHHHHHHH
Q psy12196        117 QCPYCITDFSE--DKNLIQHIVS  137 (150)
Q Consensus       117 ~C~~C~~~f~~--~~~l~~H~~~  137 (150)
                      .||.|++.|..  ...|..++..
T Consensus        22 ~CPlC~r~l~~e~~~~li~~~~~   44 (54)
T PF04423_consen   22 CCPLCGRPLDEEHRQELIKKYKS   44 (54)
T ss_dssp             E-TTT--EE-HHHHHHHHHHHHH
T ss_pred             cCCCCCCCCCHHHHHHHHHHHHH
Confidence            79999999885  3455555443


No 163
>KOG1842|consensus
Probab=41.38  E-value=20  Score=25.84  Aligned_cols=28  Identities=29%  Similarity=0.418  Sum_probs=24.3

Q ss_pred             CCCCcccccccCHHHHHHHHHHHhhCCC
Q psy12196          1 MSCVPCDVLFHNKATLYKHLYLEHKATS   28 (150)
Q Consensus         1 ~~C~~C~~~f~~~~~l~~h~~~~~~~~~   28 (150)
                      |.|+.|...|.+...|..|.-..|.++.
T Consensus        16 flCPiC~~dl~~~~~L~~H~d~eH~~ed   43 (505)
T KOG1842|consen   16 FLCPICLLDLPNLSALNDHLDVEHFEED   43 (505)
T ss_pred             ccCchHhhhhhhHHHHHHHHhhhccccc
Confidence            5799999999999999999988876443


No 164
>PF06397 Desulfoferrod_N:  Desulfoferrodoxin, N-terminal domain;  InterPro: IPR004462 This domain is found as essentially the full length of desulforedoxin, a 37-residue homodimeric non-haem iron protein. It is also found as the N-terminal domain of desulfoferrodoxin (rbo), a homodimeric non-haem iron protein with 2 Fe atoms per monomer in different oxidation states. This domain binds the ferric rather than the ferrous Fe of desulfoferrodoxin. Neelaredoxin, a monomeric blue non-haem iron protein, lacks this domain.; GO: 0005506 iron ion binding; PDB: 1DFX_A 1VZI_B 2JI2_D 1VZH_B 2JI3_C 2JI1_C 1VZG_A 1CFW_A 2LK5_B 1DHG_B ....
Probab=41.23  E-value=6.9  Score=17.26  Aligned_cols=6  Identities=33%  Similarity=1.121  Sum_probs=1.6

Q ss_pred             CCCccc
Q psy12196          2 SCVPCD    7 (150)
Q Consensus         2 ~C~~C~    7 (150)
                      +|..||
T Consensus         8 kC~~CG   13 (36)
T PF06397_consen    8 KCEHCG   13 (36)
T ss_dssp             E-TTT-
T ss_pred             EccCCC
Confidence            344443


No 165
>PRK05978 hypothetical protein; Provisional
Probab=41.16  E-value=7.6  Score=23.34  Aligned_cols=10  Identities=30%  Similarity=0.859  Sum_probs=5.6

Q ss_pred             ccCCCCcccC
Q psy12196         59 TCRRCPSTFL   68 (150)
Q Consensus        59 ~c~~c~~~f~   68 (150)
                      .|+.||..|.
T Consensus        54 ~C~~CG~~~~   63 (148)
T PRK05978         54 HCAACGEDFT   63 (148)
T ss_pred             CccccCCccc
Confidence            4666665553


No 166
>PF10013 DUF2256:  Uncharacterized protein conserved in bacteria (DUF2256);  InterPro: IPR017136 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function.
Probab=41.10  E-value=16  Score=16.77  Aligned_cols=16  Identities=25%  Similarity=0.491  Sum_probs=11.8

Q ss_pred             cCCCChhhhcchhHHh
Q psy12196         87 QCNECPESFERLNKLK  102 (150)
Q Consensus        87 ~c~~c~~~~~~~~~l~  102 (150)
                      .|.+|++.|+....+.
T Consensus        10 ~C~~C~rpf~WRKKW~   25 (42)
T PF10013_consen   10 ICPVCGRPFTWRKKWA   25 (42)
T ss_pred             cCcccCCcchHHHHHH
Confidence            6888888888765544


No 167
>COG1594 RPB9 DNA-directed RNA polymerase, subunit M/Transcription elongation factor TFIIS [Transcription]
Probab=40.99  E-value=4.1  Score=23.22  Aligned_cols=40  Identities=18%  Similarity=0.331  Sum_probs=22.0

Q ss_pred             ccCCCChhhhcchhHHhhHHhhhcCCCCCCcCCcchhhhccC
Q psy12196         86 YQCNECPESFERLNKLKRHKFQAHNDSVHQIQCPYCITDFSE  127 (150)
Q Consensus        86 ~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~~C~~C~~~f~~  127 (150)
                      ..|+.||..-.....|+.  +........-|.|..||..|+.
T Consensus        73 ~~CpkCg~~ea~y~~~Qt--RsaDEp~T~Fy~C~~Cg~~wre  112 (113)
T COG1594          73 EKCPKCGNKEAYYWQLQT--RSADEPETRFYKCTRCGYRWRE  112 (113)
T ss_pred             ccCCCCCCceeEEEeeeh--hccCCCceEEEEecccCCEeec
Confidence            568888765444333322  2222222234889999987764


No 168
>PF02891 zf-MIZ:  MIZ/SP-RING zinc finger;  InterPro: IPR004181 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents MIZ-type zinc finger domains. Miz1 (Msx-interacting-zinc finger) is a zinc finger-containing protein with homology to the yeast protein, Nfi-1. Miz1 is a sequence specific DNA binding protein that can function as a positive-acting transcription factor. Miz1 binds to the homeobox protein Msx2, enhancing the specific DNA-binding ability of Msx2 []. Other proteins containing this domain include the human pias family (protein inhibitor of activated STAT protein). More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 3I2D_A.
Probab=40.92  E-value=9.6  Score=18.10  Aligned_cols=9  Identities=33%  Similarity=1.051  Sum_probs=3.1

Q ss_pred             CcCCcchhh
Q psy12196        115 QIQCPYCIT  123 (150)
Q Consensus       115 ~~~C~~C~~  123 (150)
                      .|+|++|++
T Consensus        41 ~W~CPiC~~   49 (50)
T PF02891_consen   41 KWKCPICNK   49 (50)
T ss_dssp             --B-TTT--
T ss_pred             CeECcCCcC
Confidence            467777764


No 169
>PRK11823 DNA repair protein RadA; Provisional
Probab=40.80  E-value=12  Score=26.99  Aligned_cols=8  Identities=50%  Similarity=1.331  Sum_probs=4.3

Q ss_pred             ccCCCChh
Q psy12196         86 YQCNECPE   93 (150)
Q Consensus        86 ~~c~~c~~   93 (150)
                      |.|..||.
T Consensus         8 y~C~~Cg~   15 (446)
T PRK11823          8 YVCQECGA   15 (446)
T ss_pred             EECCcCCC
Confidence            55555554


No 170
>PRK12380 hydrogenase nickel incorporation protein HybF; Provisional
Probab=40.42  E-value=22  Score=20.22  Aligned_cols=10  Identities=20%  Similarity=0.534  Sum_probs=4.9

Q ss_pred             cccCCCCccc
Q psy12196         58 FTCRRCPSTF   67 (150)
Q Consensus        58 ~~c~~c~~~f   67 (150)
                      ..|..|+..|
T Consensus        71 ~~C~~Cg~~~   80 (113)
T PRK12380         71 AWCWDCSQVV   80 (113)
T ss_pred             EEcccCCCEE
Confidence            4455555444


No 171
>TIGR00416 sms DNA repair protein RadA. The gene protuct codes for a probable ATP-dependent protease involved in both DNA repair and degradation of proteins, peptides, glycopeptides. Also known as sms. Residues 11-28 of the SEED alignment contain a putative Zn binding domain. Residues 110-117 of the seed contain a putative ATP binding site both documented in Haemophilus and in Listeria monocytogenes. for E.coli see ( J. BACTERIOL. 178:5045-5048(1996)).
Probab=40.13  E-value=11  Score=27.17  Aligned_cols=9  Identities=22%  Similarity=0.984  Sum_probs=4.9

Q ss_pred             ccCCCChhh
Q psy12196         86 YQCNECPES   94 (150)
Q Consensus        86 ~~c~~c~~~   94 (150)
                      |.|..||..
T Consensus         8 y~C~~Cg~~   16 (454)
T TIGR00416         8 FVCQHCGAD   16 (454)
T ss_pred             EECCcCCCC
Confidence            555555543


No 172
>PF07800 DUF1644:  Protein of unknown function (DUF1644);  InterPro: IPR012866 This family consists of sequences found in a number of hypothetical plant proteins of unknown function. The region of interest contains nine highly conserved cysteine residues and is approximately 160 amino acids in length, which probably represent a zinc-binding domain. 
Probab=39.05  E-value=93  Score=19.13  Aligned_cols=53  Identities=19%  Similarity=0.225  Sum_probs=28.0

Q ss_pred             ccCCCChhhhcchhHHhhHHhhhcCCCCCCcCCcchhhhcc-CchHHHHHHHHhcCC
Q psy12196         86 YQCNECPESFERLNKLKRHKFQAHNDSVHQIQCPYCITDFS-EDKNLIQHIVSVHLG  141 (150)
Q Consensus        86 ~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~~C~~C~~~f~-~~~~l~~H~~~~~~~  141 (150)
                      ..|+.|.-...... .....+...+.+.+......|.  |. +...|.+|.+..|+.
T Consensus        81 L~CPLCRG~V~GWt-vve~AR~~LN~K~RsC~~e~C~--F~GtY~eLrKHar~~HP~  134 (162)
T PF07800_consen   81 LACPLCRGEVKGWT-VVEPARRFLNAKKRSCSQESCS--FSGTYSELRKHARSEHPS  134 (162)
T ss_pred             ccCccccCceeceE-EchHHHHHhccCCccCcccccc--cccCHHHHHHHHHhhCCC
Confidence            56777754332221 1122333445553333334454  43 578899999888843


No 173
>PRK14714 DNA polymerase II large subunit; Provisional
Probab=37.70  E-value=42  Score=27.90  Aligned_cols=10  Identities=30%  Similarity=0.956  Sum_probs=5.6

Q ss_pred             cccCCCChhh
Q psy12196         85 SYQCNECPES   94 (150)
Q Consensus        85 ~~~c~~c~~~   94 (150)
                      .|.|+.||..
T Consensus       692 vy~CPsCGae  701 (1337)
T PRK14714        692 VYVCPDCGAE  701 (1337)
T ss_pred             ceeCccCCCc
Confidence            3566666653


No 174
>COG3677 Transposase and inactivated derivatives [DNA replication, recombination, and repair]
Probab=37.25  E-value=13  Score=21.72  Aligned_cols=14  Identities=21%  Similarity=0.693  Sum_probs=11.0

Q ss_pred             CcCCcchhhhccCc
Q psy12196        115 QIQCPYCITDFSED  128 (150)
Q Consensus       115 ~~~C~~C~~~f~~~  128 (150)
                      .|+|+.|++.|...
T Consensus        53 RyrC~~C~~tf~~~   66 (129)
T COG3677          53 RYKCKSCGSTFTVE   66 (129)
T ss_pred             ccccCCcCcceeee
Confidence            67888888888753


No 175
>COG3357 Predicted transcriptional regulator containing an HTH domain fused to a Zn-ribbon [Transcription]
Probab=37.21  E-value=13  Score=20.22  Aligned_cols=14  Identities=21%  Similarity=0.641  Sum_probs=11.3

Q ss_pred             CCcCCcchhhhccC
Q psy12196        114 HQIQCPYCITDFSE  127 (150)
Q Consensus       114 ~~~~C~~C~~~f~~  127 (150)
                      .|-+|..||..|..
T Consensus        57 ~Pa~CkkCGfef~~   70 (97)
T COG3357          57 RPARCKKCGFEFRD   70 (97)
T ss_pred             cChhhcccCccccc
Confidence            36789999988877


No 176
>PRK14873 primosome assembly protein PriA; Provisional
Probab=36.67  E-value=16  Score=27.99  Aligned_cols=10  Identities=40%  Similarity=1.036  Sum_probs=6.2

Q ss_pred             CcCCcchhhh
Q psy12196        115 QIQCPYCITD  124 (150)
Q Consensus       115 ~~~C~~C~~~  124 (150)
                      ++.|+.|+..
T Consensus       422 p~~Cp~Cgs~  431 (665)
T PRK14873        422 DWRCPRCGSD  431 (665)
T ss_pred             CccCCCCcCC
Confidence            5567777643


No 177
>COG5152 Uncharacterized conserved protein, contains RING and CCCH-type Zn-fingers [General function prediction only]
Probab=35.72  E-value=33  Score=21.81  Aligned_cols=15  Identities=20%  Similarity=0.640  Sum_probs=10.6

Q ss_pred             cccccCCCCcccCCh
Q psy12196         56 LMFTCRRCPSTFLNS   70 (150)
Q Consensus        56 ~~~~c~~c~~~f~~~   70 (150)
                      .||.|.+|-+.|.++
T Consensus       195 IPF~C~iCKkdy~sp  209 (259)
T COG5152         195 IPFLCGICKKDYESP  209 (259)
T ss_pred             Cceeehhchhhccch
Confidence            577777777777654


No 178
>COG5188 PRP9 Splicing factor 3a, subunit 3 [RNA processing and modification]
Probab=35.69  E-value=22  Score=24.73  Aligned_cols=24  Identities=25%  Similarity=0.477  Sum_probs=20.7

Q ss_pred             CcCCcchhhhccCchHHHHHHHHh
Q psy12196        115 QIQCPYCITDFSEDKNLIQHIVSV  138 (150)
Q Consensus       115 ~~~C~~C~~~f~~~~~l~~H~~~~  138 (150)
                      .+-|+.|++.|....-+..|+...
T Consensus       238 ~~YC~~C~r~f~~~~VFe~Hl~gK  261 (470)
T COG5188         238 KVYCVKCGREFSRSKVFEYHLEGK  261 (470)
T ss_pred             ceeeHhhhhHhhhhHHHHHHHhhh
Confidence            455999999999999999998665


No 179
>PF14255 Cys_rich_CPXG:  Cysteine-rich CPXCG
Probab=35.63  E-value=20  Score=17.32  Aligned_cols=8  Identities=25%  Similarity=0.592  Sum_probs=3.7

Q ss_pred             CCCccccc
Q psy12196          2 SCVPCDVL    9 (150)
Q Consensus         2 ~C~~C~~~    9 (150)
                      .|++||..
T Consensus         2 ~CPyCge~    9 (52)
T PF14255_consen    2 QCPYCGEP    9 (52)
T ss_pred             CCCCCCCe
Confidence            34555443


No 180
>TIGR01562 FdhE formate dehydrogenase accessory protein FdhE. The only sequence scoring between trusted and noise is that from Aquifex aeolicus, which shows certain structural differences from the proteobacterial forms in the alignment. However it is notable that A. aeolicus also has a sequence scoring above trusted to the alpha subunit of formate dehydrogenase (TIGR01553).
Probab=35.53  E-value=28  Score=23.81  Aligned_cols=8  Identities=38%  Similarity=1.157  Sum_probs=4.8

Q ss_pred             ccCCCChh
Q psy12196         86 YQCNECPE   93 (150)
Q Consensus        86 ~~c~~c~~   93 (150)
                      ..|..||.
T Consensus       225 ~~C~~Cg~  232 (305)
T TIGR01562       225 VKCSHCEE  232 (305)
T ss_pred             ccCCCCCC
Confidence            35666664


No 181
>PF14311 DUF4379:  Domain of unknown function (DUF4379)
Probab=35.16  E-value=36  Score=16.33  Aligned_cols=6  Identities=33%  Similarity=1.287  Sum_probs=2.3

Q ss_pred             cCCCCh
Q psy12196         87 QCNECP   92 (150)
Q Consensus        87 ~c~~c~   92 (150)
                      +|..||
T Consensus        30 ~C~~Cg   35 (55)
T PF14311_consen   30 KCPKCG   35 (55)
T ss_pred             ECCCCC
Confidence            344443


No 182
>PF07975 C1_4:  TFIIH C1-like domain;  InterPro: IPR004595 All proteins in this domain for which functions are known are components of the TFIIH complex which is involved in the initiation of transcription and nucleotide excision repair. It includes the yeast transcription factor Ssl1 (Suppressor of stem-loop protein 1) that is essential for translation initiation and affects UV resistance. The C-terminal region is essential for transcription activity. This regions binds three zinc atoms through two independent domain. The first contains a C4 zinc finger motif, whereas the second is characterised by a CX(2)CX(2-4)FCADCD motif. The solution structure of the second C-terminal domain revealed homology with the regulatory domain of protein kinase C [].; GO: 0006281 DNA repair, 0005634 nucleus; PDB: 1Z60_A.
Probab=34.99  E-value=16  Score=17.60  Aligned_cols=23  Identities=22%  Similarity=0.436  Sum_probs=12.2

Q ss_pred             CcccCCCChhhhcchhHHhhHHh
Q psy12196         84 KSYQCNECPESFERLNKLKRHKF  106 (150)
Q Consensus        84 ~~~~c~~c~~~~~~~~~l~~h~~  106 (150)
                      ..|.|+.|...|=..-++..|..
T Consensus        20 ~~y~C~~C~~~FC~dCD~fiHE~   42 (51)
T PF07975_consen   20 SRYRCPKCKNHFCIDCDVFIHET   42 (51)
T ss_dssp             EEE--TTTT--B-HHHHHTTTTT
T ss_pred             CeEECCCCCCccccCcChhhhcc
Confidence            45778888777777777666643


No 183
>PLN00104 MYST -like histone acetyltransferase; Provisional
Probab=34.75  E-value=26  Score=25.36  Aligned_cols=25  Identities=16%  Similarity=0.488  Sum_probs=22.1

Q ss_pred             CcCCcchhhhccCchHHHHHHHHhc
Q psy12196        115 QIQCPYCITDFSEDKNLIQHIVSVH  139 (150)
Q Consensus       115 ~~~C~~C~~~f~~~~~l~~H~~~~~  139 (150)
                      -|.|..|-+-|.+...|.+|+....
T Consensus       198 lyiCe~Cl~y~~~~~~~~~H~~~C~  222 (450)
T PLN00104        198 LYFCEFCLKFMKRKEQLQRHMKKCD  222 (450)
T ss_pred             EEEchhhhhhhcCHHHHHHHHhcCC
Confidence            6889999999999999999997554


No 184
>PTZ00064 histone acetyltransferase; Provisional
Probab=34.67  E-value=29  Score=25.54  Aligned_cols=25  Identities=28%  Similarity=0.638  Sum_probs=22.1

Q ss_pred             CcCCcchhhhccCchHHHHHHHHhc
Q psy12196        115 QIQCPYCITDFSEDKNLIQHIVSVH  139 (150)
Q Consensus       115 ~~~C~~C~~~f~~~~~l~~H~~~~~  139 (150)
                      -|.|..|-+-|.....|.+|+....
T Consensus       280 LYICEfCLkY~~s~~~l~rH~~~C~  304 (552)
T PTZ00064        280 LHFCEYCLDFFCFEDELIRHLSRCQ  304 (552)
T ss_pred             EEEccchhhhhCCHHHHHHHHhcCC
Confidence            5789999999999999999998654


No 185
>PF11931 DUF3449:  Domain of unknown function (DUF3449);  InterPro: IPR024598 This presumed domain is functionally uncharacterised. It has two conserved sequence motifs: PIP and CEICG and contains a zinc-finger of the C2H2-type.; PDB: 4DGW_A.
Probab=34.55  E-value=13  Score=23.53  Aligned_cols=21  Identities=19%  Similarity=0.572  Sum_probs=0.0

Q ss_pred             CcCCcchhhh-ccCchHHHHHH
Q psy12196        115 QIQCPYCITD-FSEDKNLIQHI  135 (150)
Q Consensus       115 ~~~C~~C~~~-f~~~~~l~~H~  135 (150)
                      .|.|.+||-. +.-+.+|.+|+
T Consensus       101 ey~CEICGN~~Y~GrkaFekHF  122 (196)
T PF11931_consen  101 EYKCEICGNQSYKGRKAFEKHF  122 (196)
T ss_dssp             ----------------------
T ss_pred             eeeeEeCCCcceecHHHHHHhc
Confidence            7889999844 44677788886


No 186
>PF04606 Ogr_Delta:  Ogr/Delta-like zinc finger;  InterPro: IPR007684 This entry is represented by Bacteriophage P2, Ogr. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches. This is a viral family of phage zinc-binding transcriptional activators, which also contains cryptic members in some bacterial genomes []. The P4 phage delta protein contains two such domains attached covalently, while the P2 phage Ogr proteins possess one domain but function as dimers. All the members of this family have the following consensus sequence: C-X(2)-C-X(3)-A-(X)2-R-X(15)-C-X(4)-C-X(3)-F [].; GO: 0006355 regulation of transcription, DNA-dependent
Probab=34.32  E-value=6.2  Score=18.42  Aligned_cols=12  Identities=17%  Similarity=0.443  Sum_probs=6.0

Q ss_pred             CCcccccccCHH
Q psy12196          3 CVPCDVLFHNKA   14 (150)
Q Consensus         3 C~~C~~~f~~~~   14 (150)
                      |+.||.......
T Consensus         2 CP~Cg~~a~ir~   13 (47)
T PF04606_consen    2 CPHCGSKARIRT   13 (47)
T ss_pred             cCCCCCeeEEEE
Confidence            566665444333


No 187
>COG1773 Rubredoxin [Energy production and conversion]
Probab=33.85  E-value=13  Score=18.24  Aligned_cols=13  Identities=15%  Similarity=0.496  Sum_probs=8.1

Q ss_pred             CcCCcchhhhccC
Q psy12196        115 QIQCPYCITDFSE  127 (150)
Q Consensus       115 ~~~C~~C~~~f~~  127 (150)
                      .|+|..||..|.-
T Consensus         3 ~~~C~~CG~vYd~   15 (55)
T COG1773           3 RWRCSVCGYVYDP   15 (55)
T ss_pred             ceEecCCceEecc
Confidence            4667777766543


No 188
>PF04328 DUF466:  Protein of unknown function (DUF466);  InterPro: IPR007423 This is a small bacterial protein of unknown function.
Probab=33.81  E-value=38  Score=17.18  Aligned_cols=16  Identities=13%  Similarity=0.283  Sum_probs=11.6

Q ss_pred             hHHHHHHHHhcCCCCC
Q psy12196        129 KNLIQHIVSVHLGKEG  144 (150)
Q Consensus       129 ~~l~~H~~~~~~~~~~  144 (150)
                      ..+..|++.+|++.|.
T Consensus        26 e~Yv~H~~~~HP~~p~   41 (65)
T PF04328_consen   26 ERYVEHMRRHHPDEPP   41 (65)
T ss_pred             HHHHHHHHHHCcCCCC
Confidence            4566788888877764


No 189
>PF07282 OrfB_Zn_ribbon:  Putative transposase DNA-binding domain;  InterPro: IPR010095 This entry represents a region of a sequence similarity between a family of putative transposases of Thermoanaerobacter tengcongensis, smaller related proteins from Bacillus anthracis, putative transposes described by IPR001959 from INTERPRO, and other proteins. More information about these proteins can be found at Protein of the Month: Transposase [].
Probab=33.75  E-value=69  Score=16.04  Aligned_cols=31  Identities=19%  Similarity=0.429  Sum_probs=20.1

Q ss_pred             ecccccccccChHHHHHHHhccCCcccccCCCCcccCChH
Q psy12196         32 QCNMCSLVLDSKESLVTHISQTHTLMFTCRRCPSTFLNSA   71 (150)
Q Consensus        32 ~c~~c~~~f~~~~~l~~h~~~~~~~~~~c~~c~~~f~~~~   71 (150)
                      .|+.|+.....         ......+.|+.||.......
T Consensus        30 ~C~~CG~~~~~---------~~~~r~~~C~~Cg~~~~rD~   60 (69)
T PF07282_consen   30 TCPRCGHRNKK---------RRSGRVFTCPNCGFEMDRDV   60 (69)
T ss_pred             CccCccccccc---------ccccceEEcCCCCCEECcHH
Confidence            47888876543         23335678999987765443


No 190
>PF01428 zf-AN1:  AN1-like Zinc finger;  InterPro: IPR000058 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents the AN1-type zinc finger domain, which has a dimetal (zinc)-bound alpha/beta fold. This domain was first identified as a zinc finger at the C terminus of AN1 Q91889 from SWISSPROT, a ubiquitin-like protein in Xenopus laevis []. The AN1-type zinc finger contains six conserved cysteines and two histidines that could potentially coordinate 2 zinc atoms. Certain stress-associated proteins (SAP) contain AN1 domain, often in combination with A20 zinc finger domains (SAP8) or C2H2 domains (SAP16) []. For example, the human protein Znf216 has an A20 zinc-finger at the N terminus and an AN1 zinc-finger at the C terminus, acting to negatively regulate the NFkappaB activation pathway and to interact with components of the immune response like RIP, IKKgamma and TRAF6. The interact of Znf216 with IKK-gamma and RIP is mediated by the A20 zinc-finger domain, while its interaction with TRAF6 is mediated by the AN1 zinc-finger domain; therefore, both zinc-finger domains are involved in regulating the immune response []. The AN1 zinc finger domain is also found in proteins containing a ubiquitin-like domain, which are involved in the ubiquitination pathway []. Proteins containing an AN1-type zinc finger include:   Ascidian posterior end mark 6 (pem-6) protein []. Human AWP1 protein (associated with PRK1), which is expressed during early embryogenesis []. Human immunoglobulin mu binding protein 2 (SMUBP-2), mutations in which cause muscular atrophy with respiratory distress type 1 [].   More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 1WFP_A 1WYS_A 1WG2_A 1WFH_A 1X4W_A 1WFE_A 1WFL_A 1X4V_A.
Probab=33.52  E-value=19  Score=16.33  Aligned_cols=14  Identities=21%  Similarity=0.558  Sum_probs=7.9

Q ss_pred             cceecccccccccC
Q psy12196         29 LSIQCNMCSLVLDS   42 (150)
Q Consensus        29 ~~~~c~~c~~~f~~   42 (150)
                      .++.|..|++.|=.
T Consensus        12 ~~~~C~~C~~~FC~   25 (43)
T PF01428_consen   12 LPFKCKHCGKSFCL   25 (43)
T ss_dssp             SHEE-TTTS-EE-T
T ss_pred             CCeECCCCCcccCc
Confidence            56778888887753


No 191
>KOG0717|consensus
Probab=33.44  E-value=27  Score=25.38  Aligned_cols=21  Identities=29%  Similarity=0.521  Sum_probs=18.5

Q ss_pred             CCCcccccccCHHHHHHHHHH
Q psy12196          2 SCVPCDVLFHNKATLYKHLYL   22 (150)
Q Consensus         2 ~C~~C~~~f~~~~~l~~h~~~   22 (150)
                      -|..|++.|.+...|..|...
T Consensus       294 yC~vCnKsFKseKq~kNHEnS  314 (508)
T KOG0717|consen  294 YCVVCNKSFKSEKQLKNHENS  314 (508)
T ss_pred             EEeeccccccchHHHHhhHHH
Confidence            489999999999999999765


No 192
>PTZ00448 hypothetical protein; Provisional
Probab=32.84  E-value=38  Score=23.84  Aligned_cols=22  Identities=14%  Similarity=0.487  Sum_probs=17.6

Q ss_pred             CCCCcccccccCHHHHHHHHHH
Q psy12196          1 MSCVPCDVLFHNKATLYKHLYL   22 (150)
Q Consensus         1 ~~C~~C~~~f~~~~~l~~h~~~   22 (150)
                      |.|..|+..|.+....+.|.+.
T Consensus       315 ~tC~~C~v~F~~~~~qR~H~KS  336 (373)
T PTZ00448        315 LLCRKCNIQLMDHNAFKQHYRS  336 (373)
T ss_pred             ccccccccccCCHHHHHHHhhh
Confidence            4588888888888888888775


No 193
>KOG2071|consensus
Probab=32.84  E-value=30  Score=25.90  Aligned_cols=26  Identities=19%  Similarity=0.340  Sum_probs=22.4

Q ss_pred             CCcCCcchhhhccCchHHHHHHHHhc
Q psy12196        114 HQIQCPYCITDFSEDKNLIQHIVSVH  139 (150)
Q Consensus       114 ~~~~C~~C~~~f~~~~~l~~H~~~~~  139 (150)
                      .+-+|..||..|........||..|-
T Consensus       417 ~pnqC~~CG~R~~~~ee~sk~md~H~  442 (579)
T KOG2071|consen  417 SPNQCKSCGLRFDDSEERSKHMDIHD  442 (579)
T ss_pred             CcchhcccccccccchhhhhHhhhhh
Confidence            46789999999999999888887774


No 194
>TIGR00686 phnA alkylphosphonate utilization operon protein PhnA. The protein family includes an uncharacterized member designated phnA in Escherichia coli, part of a large operon associated with alkylphosphonate uptake and carbon-phosphorus bond cleavage. This protein is not related to the characterized phosphonoacetate hydrolase designated PhnA by Kulakova, et al. (2001, 1997).
Probab=32.47  E-value=14  Score=20.84  Aligned_cols=11  Identities=18%  Similarity=0.610  Sum_probs=5.3

Q ss_pred             ccCCCChhhhc
Q psy12196         86 YQCNECPESFE   96 (150)
Q Consensus        86 ~~c~~c~~~~~   96 (150)
                      |.|++|+..+.
T Consensus        20 ~iCpeC~~EW~   30 (109)
T TIGR00686        20 LICPSCLYEWN   30 (109)
T ss_pred             eECcccccccc
Confidence            45555554443


No 195
>PTZ00448 hypothetical protein; Provisional
Probab=32.40  E-value=32  Score=24.17  Aligned_cols=23  Identities=22%  Similarity=0.436  Sum_probs=20.0

Q ss_pred             CcCCcchhhhccCchHHHHHHHH
Q psy12196        115 QIQCPYCITDFSEDKNLIQHIVS  137 (150)
Q Consensus       115 ~~~C~~C~~~f~~~~~l~~H~~~  137 (150)
                      .|.|..|+-.|.+......|+++
T Consensus       314 ~~tC~~C~v~F~~~~~qR~H~KS  336 (373)
T PTZ00448        314 MLLCRKCNIQLMDHNAFKQHYRS  336 (373)
T ss_pred             CccccccccccCCHHHHHHHhhh
Confidence            57899999999988888888865


No 196
>PF11672 DUF3268:  Protein of unknown function (DUF3268);  InterPro: IPR021686 This entry is represented by Listeria phage P100, Gp150. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches.
Probab=32.16  E-value=17  Score=20.34  Aligned_cols=9  Identities=22%  Similarity=0.633  Sum_probs=4.6

Q ss_pred             ccccCCCCc
Q psy12196         57 MFTCRRCPS   65 (150)
Q Consensus        57 ~~~c~~c~~   65 (150)
                      |..|+-|+.
T Consensus         2 p~~CpYCg~   10 (102)
T PF11672_consen    2 PIICPYCGG   10 (102)
T ss_pred             CcccCCCCC
Confidence            345555554


No 197
>PRK03681 hypA hydrogenase nickel incorporation protein; Validated
Probab=31.88  E-value=36  Score=19.41  Aligned_cols=10  Identities=20%  Similarity=0.571  Sum_probs=4.6

Q ss_pred             cccCCCCccc
Q psy12196         58 FTCRRCPSTF   67 (150)
Q Consensus        58 ~~c~~c~~~f   67 (150)
                      +.|..|+..|
T Consensus        71 ~~C~~Cg~~~   80 (114)
T PRK03681         71 CWCETCQQYV   80 (114)
T ss_pred             EEcccCCCee
Confidence            4455555433


No 198
>PF13824 zf-Mss51:  Zinc-finger of mitochondrial splicing suppressor 51
Probab=31.29  E-value=45  Score=16.34  Aligned_cols=10  Identities=30%  Similarity=0.773  Sum_probs=4.5

Q ss_pred             ccccCCCCcc
Q psy12196         57 MFTCRRCPST   66 (150)
Q Consensus        57 ~~~c~~c~~~   66 (150)
                      .|.|+.||.-
T Consensus        14 ~~~Cp~cGip   23 (55)
T PF13824_consen   14 NFECPDCGIP   23 (55)
T ss_pred             CCcCCCCCCc
Confidence            3444444433


No 199
>PF05495 zf-CHY:  CHY zinc finger;  InterPro: IPR008913 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  Pirh2 is an eukaryotic ubiquitin protein ligase, which has been shown to promote p53 degradation in mammals. Pirh2 physically interacts with p53 and promotes ubiquitination of p53 independently of MDM2. Like MDM2, Pirh2 is thought to participate in an autoregulatory feedback loop that controls p53 function. Pirh2 proteins contain three distinct zinc fingers, the CHY-type, the CTCHY-type which is C-terminal to the CHY-type zinc finger and a RING finger. The CHY-type zinc finger has no currently known function []. As well as Pirh2, the CHY-type zinc finger is also found in the following proteins:   Yeast helper of Tim protein 13. Hot13 may have a role in the assembly and recycling of the small Tims, a complex of the mitochondrial intermembrane space that participates in the TIM22 import pathway for assembly of the inner membrane [] Several plant hypothetical proteins that also contain haemerythrin cation binding domains Several protozoan hypothetical proteins that also contain a Myb domain   The solution structure of this zinc finger has been solved and binds 3 zinc atoms as shown in the following schematic representation:   ++---------+-----+ || | | CXHYxxxxxxxxxCCxxxxxCxxCHxxxxxHxxxxxxxxxxxCxxCxxxxxxxxxCxxC | | | | | | | | +-+-----------------+--+ +--+---------+--+ 'C': conserved cysteine involved in the binding of one zinc atom. 'H': conserved histidine involved in the binding of one zinc atom.  More information about these proteins can be found at Protein of the Month: Zinc Fingers []; GO: 0008270 zinc ion binding; PDB: 2DKT_A 2K2C_A.
Probab=31.27  E-value=3.4  Score=21.29  Aligned_cols=13  Identities=15%  Similarity=0.388  Sum_probs=6.4

Q ss_pred             cccCCCChhhhcc
Q psy12196         85 SYQCNECPESFER   97 (150)
Q Consensus        85 ~~~c~~c~~~~~~   97 (150)
                      ...|..|+..++.
T Consensus        41 ~v~Cg~C~~~~~~   53 (71)
T PF05495_consen   41 RVICGKCRTEQPI   53 (71)
T ss_dssp             EEEETTT--EEES
T ss_pred             CeECCCCCCccCh
Confidence            4566666655544


No 200
>PRK10220 hypothetical protein; Provisional
Probab=30.29  E-value=19  Score=20.39  Aligned_cols=10  Identities=40%  Similarity=1.202  Sum_probs=4.7

Q ss_pred             ccCCCChhhh
Q psy12196         86 YQCNECPESF   95 (150)
Q Consensus        86 ~~c~~c~~~~   95 (150)
                      |.|++|+..+
T Consensus        21 ~vCpeC~hEW   30 (111)
T PRK10220         21 YICPECAHEW   30 (111)
T ss_pred             EECCcccCcC
Confidence            4455554443


No 201
>KOG3002|consensus
Probab=30.00  E-value=1.5e+02  Score=20.47  Aligned_cols=73  Identities=14%  Similarity=0.202  Sum_probs=38.1

Q ss_pred             CCCcccccccCHHHHHHHHHHHhhCCCcceecc----cccccccChHHHHHHHhccCCcccccCCCC--cccC-ChHHHH
Q psy12196          2 SCVPCDVLFHNKATLYKHLYLEHKATSLSIQCN----MCSLVLDSKESLVTHISQTHTLMFTCRRCP--STFL-NSATLS   74 (150)
Q Consensus         2 ~C~~C~~~f~~~~~l~~h~~~~~~~~~~~~~c~----~c~~~f~~~~~l~~h~~~~~~~~~~c~~c~--~~f~-~~~~l~   74 (150)
                      .|+.|...+.+...+.....+    +.....|+    -|.++|..... ..|.....-.++.||.-+  -.+. ....+.
T Consensus        82 ~CP~Cr~~~g~~R~~amEkV~----e~~~vpC~~~~~GC~~~~~Y~~~-~~HE~~C~f~~~~CP~p~~~C~~~G~~~~l~  156 (299)
T KOG3002|consen   82 KCPTCRLPIGNIRCRAMEKVA----EAVLVPCKNAKLGCTKSFPYGEK-SKHEKVCEFRPCSCPVPGAECKYTGSYKDLY  156 (299)
T ss_pred             cCCccccccccHHHHHHHHHH----HhceecccccccCCceeeccccc-cccccccccCCcCCCCCcccCCccCcHHHHH
Confidence            477787777777666655444    22334555    37777765544 334322223666666542  1122 234455


Q ss_pred             HHHHh
Q psy12196         75 KHVKM   79 (150)
Q Consensus        75 ~h~~~   79 (150)
                      .|...
T Consensus       157 ~H~~~  161 (299)
T KOG3002|consen  157 AHLND  161 (299)
T ss_pred             HHHHh
Confidence            66553


No 202
>PHA02998 RNA polymerase subunit; Provisional
Probab=29.84  E-value=8.6  Score=23.82  Aligned_cols=40  Identities=15%  Similarity=0.353  Sum_probs=23.1

Q ss_pred             cccCCCChhhhcchhHHhhHHhhhcCCC--CCCcCCcchhhhccCc
Q psy12196         85 SYQCNECPESFERLNKLKRHKFQAHNDS--VHQIQCPYCITDFSED  128 (150)
Q Consensus        85 ~~~c~~c~~~~~~~~~l~~h~~~~~~~~--~~~~~C~~C~~~f~~~  128 (150)
                      ...|+.|+..-.....++    +...+.  ..-|.|..|++.|.-.
T Consensus       143 ~v~CPkCg~~~A~f~qlQ----TRSADEPmT~FYkC~~CG~~wkpp  184 (195)
T PHA02998        143 NTPCPNCKSKNTTPMMIQ----TRAADEPPLVRHACRDCKKHFKPP  184 (195)
T ss_pred             CCCCCCCCCCceEEEEEe----eccCCCCceEEEEcCCCCCccCCc
Confidence            357888886544333222    333333  2347899999887643


No 203
>PF01363 FYVE:  FYVE zinc finger;  InterPro: IPR000306 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The FYVE zinc finger is named after four proteins that it has been found in: Fab1, YOTB/ZK632.12, Vac1, and EEA1. The FYVE finger has been shown to bind two zinc ions []. The FYVE finger has eight potential zinc coordinating cysteine positions. Many members of this family also include two histidines in a motif R+HHC+XCG, where + represents a charged residue and X any residue. FYVE-type domains are divided into two known classes: FYVE domains that specifically bind to phosphatidylinositol 3-phosphate in lipid bilayers and FYVE-related domains of undetermined function []. Those that bind to phosphatidylinositol 3-phosphate are often found in proteins targeted to lipid membranes that are involved in regulating membrane traffic [, , ]. Most FYVE domains target proteins to endosomes by binding specifically to phosphatidylinositol-3-phosphate at the membrane surface. By contrast, the CARP2 FYVE-like domain is not optimized to bind to phosphoinositides or insert into lipid bilayers. FYVE domains are distinguished from other zinc fingers by three signature sequences: an N-terminal WxxD motif, a basic R(R/K)HHCR patch, and a C-terminal RVC motif. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0046872 metal ion binding; PDB: 1HYI_A 1JOC_B 1HYJ_A 1DVP_A 3ZYQ_A 4AVX_A 1VFY_A 3T7L_A 1X4U_A 1WFK_A ....
Probab=29.07  E-value=32  Score=17.28  Aligned_cols=8  Identities=25%  Similarity=0.912  Sum_probs=1.6

Q ss_pred             cccccccc
Q psy12196         33 CNMCSLVL   40 (150)
Q Consensus        33 c~~c~~~f   40 (150)
                      |..|++.|
T Consensus        12 C~~C~~~F   19 (69)
T PF01363_consen   12 CMICGKKF   19 (69)
T ss_dssp             -TTT--B-
T ss_pred             CcCcCCcC
Confidence            34444444


No 204
>PRK05580 primosome assembly protein PriA; Validated
Probab=29.04  E-value=25  Score=26.98  Aligned_cols=8  Identities=38%  Similarity=0.870  Sum_probs=3.7

Q ss_pred             CcCCcchh
Q psy12196        115 QIQCPYCI  122 (150)
Q Consensus       115 ~~~C~~C~  122 (150)
                      +..|+.|+
T Consensus       421 ~~~Cp~Cg  428 (679)
T PRK05580        421 PKACPECG  428 (679)
T ss_pred             CCCCCCCc
Confidence            33455554


No 205
>COG4888 Uncharacterized Zn ribbon-containing protein [General function prediction only]
Probab=28.98  E-value=3.1  Score=23.02  Aligned_cols=8  Identities=25%  Similarity=0.829  Sum_probs=3.7

Q ss_pred             eecccccc
Q psy12196         31 IQCNMCSL   38 (150)
Q Consensus        31 ~~c~~c~~   38 (150)
                      |.|+.|+.
T Consensus        23 FtCp~Cgh   30 (104)
T COG4888          23 FTCPRCGH   30 (104)
T ss_pred             EecCccCC
Confidence            44444444


No 206
>PF10122 Mu-like_Com:  Mu-like prophage protein Com;  InterPro: IPR019294  Members of this entry belong to the Com family of proteins that act as translational regulators of mom [, ]. 
Probab=28.70  E-value=11  Score=18.08  Aligned_cols=31  Identities=23%  Similarity=0.623  Sum_probs=16.4

Q ss_pred             cccCCCChhhhcchhHHhhHHhhhcCCCCCCcCCcchhhhc
Q psy12196         85 SYQCNECPESFERLNKLKRHKFQAHNDSVHQIQCPYCITDF  125 (150)
Q Consensus        85 ~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~~C~~C~~~f  125 (150)
                      .++|..|++.......+.        +.  ..+|+.|+...
T Consensus         4 eiRC~~CnklLa~~g~~~--------~l--eIKCpRC~tiN   34 (51)
T PF10122_consen    4 EIRCGHCNKLLAKAGEVI--------EL--EIKCPRCKTIN   34 (51)
T ss_pred             ceeccchhHHHhhhcCcc--------EE--EEECCCCCccc
Confidence            356777776544321111        11  55788887543


No 207
>cd00974 DSRD Desulforedoxin (DSRD) domain; a small non-heme iron domain present in the desulforedoxin (rubredoxin oxidoreductase) and desulfoferrodoxin proteins of some archeael and bacterial methanogens and sulfate/sulfur reducers. Desulforedoxin is a small, single-domain homodimeric protein; each subunit contains an iron atom bound to four cysteinyl sulfur atoms, Fe(S-Cys)4, in a distorted tetrahedral coordination. Its metal center is similar to that found in rubredoxin type proteins. Desulforedoxin is regarded as a potential redox partner for rubredoxin. Desulfoferrodoxin forms a homodimeric protein, with each protomer comprised of two domains, the N-terminal DSRD domain and C-terminal superoxide reductase-like (SORL) domain. Each domain has a distinct iron center: the DSRD iron center I, Fe(S-Cys)4; and the SORL iron center II, Fe[His4Cys(Glu)].
Probab=28.53  E-value=20  Score=15.29  Aligned_cols=6  Identities=33%  Similarity=1.038  Sum_probs=2.4

Q ss_pred             CCCccc
Q psy12196          2 SCVPCD    7 (150)
Q Consensus         2 ~C~~C~    7 (150)
                      +|..||
T Consensus         6 kC~~CG   11 (34)
T cd00974           6 KCEICG   11 (34)
T ss_pred             EcCCCC
Confidence            334443


No 208
>PF14369 zf-RING_3:  zinc-finger
Probab=28.52  E-value=29  Score=15.07  Aligned_cols=8  Identities=38%  Similarity=0.833  Sum_probs=4.3

Q ss_pred             CCcccccc
Q psy12196          3 CVPCDVLF   10 (150)
Q Consensus         3 C~~C~~~f   10 (150)
                      |+.|+..|
T Consensus        24 CP~C~~gF   31 (35)
T PF14369_consen   24 CPRCHGGF   31 (35)
T ss_pred             CcCCCCcE
Confidence            55555544


No 209
>PF07295 DUF1451:  Protein of unknown function (DUF1451);  InterPro: IPR009912 This family consists of several hypothetical bacterial proteins of around 160 residues in length. Members of this family contain four highly conserved cysteine resides toward the C-terminal region of the protein. The function of this family is unknown.
Probab=28.25  E-value=21  Score=21.45  Aligned_cols=31  Identities=19%  Similarity=0.403  Sum_probs=17.3

Q ss_pred             CCcccCCCChhhhcchhHHhhHHhhhcCCCCCCcCCcchhhhc
Q psy12196         83 SKSYQCNECPESFERLNKLKRHKFQAHNDSVHQIQCPYCITDF  125 (150)
Q Consensus        83 ~~~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~~C~~C~~~f  125 (150)
                      ...+.|..||......         +.+.   --.|+.|+..-
T Consensus       110 ~G~l~C~~Cg~~~~~~---------~~~~---l~~Cp~C~~~~  140 (146)
T PF07295_consen  110 PGTLVCENCGHEVELT---------HPER---LPPCPKCGHTE  140 (146)
T ss_pred             CceEecccCCCEEEec---------CCCc---CCCCCCCCCCe
Confidence            3458888888643321         1222   22588888653


No 210
>cd00730 rubredoxin Rubredoxin; nonheme iron binding domains containing a [Fe(SCys)4] center. Rubredoxins are small nonheme iron proteins. The iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), but iron can also be replaced by cobalt, nickel or zinc. They are believed to be involved in electron transfer.
Probab=28.19  E-value=29  Score=16.55  Aligned_cols=9  Identities=22%  Similarity=0.944  Sum_probs=3.8

Q ss_pred             CCCcccccc
Q psy12196          2 SCVPCDVLF   10 (150)
Q Consensus         2 ~C~~C~~~f   10 (150)
                      +|..||..+
T Consensus         3 ~C~~CgyiY   11 (50)
T cd00730           3 ECRICGYIY   11 (50)
T ss_pred             CCCCCCeEE
Confidence            344444433


No 211
>KOG2071|consensus
Probab=28.09  E-value=44  Score=25.08  Aligned_cols=26  Identities=27%  Similarity=0.461  Sum_probs=22.3

Q ss_pred             cccccCCCCcccCChHHHHHHHHhhc
Q psy12196         56 LMFTCRRCPSTFLNSATLSKHVKMEH   81 (150)
Q Consensus        56 ~~~~c~~c~~~f~~~~~l~~h~~~~~   81 (150)
                      .+-+|..||.+|........||..|-
T Consensus       417 ~pnqC~~CG~R~~~~ee~sk~md~H~  442 (579)
T KOG2071|consen  417 SPNQCKSCGLRFDDSEERSKHMDIHD  442 (579)
T ss_pred             CcchhcccccccccchhhhhHhhhhh
Confidence            67889999999999988888887774


No 212
>PRK05452 anaerobic nitric oxide reductase flavorubredoxin; Provisional
Probab=28.03  E-value=16  Score=26.62  Aligned_cols=39  Identities=18%  Similarity=0.342  Sum_probs=21.5

Q ss_pred             CcccCCCChhhhcchhHHhhHHhhhcC----CCCCCcCCcchhh
Q psy12196         84 KSYQCNECPESFERLNKLKRHKFQAHN----DSVHQIQCPYCIT  123 (150)
Q Consensus        84 ~~~~c~~c~~~~~~~~~l~~h~~~~~~----~~~~~~~C~~C~~  123 (150)
                      ..|+|..||..+.....-... .+..+    +-+-.|.||.|+-
T Consensus       424 ~~~~c~~c~~~yd~~~g~~~~-~~~~gt~~~~lp~~~~cp~c~~  466 (479)
T PRK05452        424 PRMQCSVCQWIYDPAKGEPMQ-DVAPGTPWSEVPDNFLCPECSL  466 (479)
T ss_pred             CeEEECCCCeEECCCCCCccc-CCCCCCChhhCCCCCcCcCCCC
Confidence            458999999877643221110 01111    2223589999984


No 213
>PF01155 HypA:  Hydrogenase expression/synthesis hypA family;  InterPro: IPR000688 Bacterial membrane-bound nickel-dependent hydrogenases requires a number of accessory proteins which are involved in their maturation. The exact role of these proteins is not yet clear, but some seem to be required for the incorporation of the nickel ions []. One of these proteins is generally known as hypA. It is a protein of about 12 to 14 kDa that contains, in its C-terminal region, four conserved cysteines that form a zinc-finger like motif. Escherichia coli has two proteins that belong to this family, hypA and hybF. A homologue, MJ0214, has also been found in a number of archaeal species, including the genome of Methanocaldococcus jannaschii (Methanococcus jannaschii).; GO: 0016151 nickel ion binding, 0006464 protein modification process; PDB: 2KDX_A 3A44_D 3A43_B.
Probab=27.89  E-value=32  Score=19.57  Aligned_cols=11  Identities=18%  Similarity=0.676  Sum_probs=5.1

Q ss_pred             eeccccccccc
Q psy12196         31 IQCNMCSLVLD   41 (150)
Q Consensus        31 ~~c~~c~~~f~   41 (150)
                      ..|..|+..|.
T Consensus        71 ~~C~~Cg~~~~   81 (113)
T PF01155_consen   71 ARCRDCGHEFE   81 (113)
T ss_dssp             EEETTTS-EEE
T ss_pred             EECCCCCCEEe
Confidence            34555555554


No 214
>PLN02748 tRNA dimethylallyltransferase
Probab=27.67  E-value=38  Score=24.78  Aligned_cols=25  Identities=20%  Similarity=0.214  Sum_probs=20.9

Q ss_pred             CCcCCcchhh-hccCchHHHHHHHHh
Q psy12196        114 HQIQCPYCIT-DFSEDKNLIQHIVSV  138 (150)
Q Consensus       114 ~~~~C~~C~~-~f~~~~~l~~H~~~~  138 (150)
                      +.|.|..|++ .+.....+..|+++.
T Consensus       417 ~~~~Ce~C~~~~~~G~~eW~~Hlksr  442 (468)
T PLN02748        417 TQYVCEACGNKVLRGAHEWEQHKQGR  442 (468)
T ss_pred             ccccccCCCCcccCCHHHHHHHhcch
Confidence            4678999997 799888999998654


No 215
>PF01286 XPA_N:  XPA protein N-terminal;  InterPro: IPR022652 Xeroderma pigmentosum (XP) [] is a human autosomal recessive disease, characterised by a high incidence of sunlight-induced skin cancer. Skin cells of individual's with this condition are hypersensitive to ultraviolet light, due to defects in the incision step of DNA excision repair. There are a minimum of seven genetic complementation groups involved in this pathway: XP-A to XP-G. XP-A is the most severe form of the disease and is due to defects in a 30 kDa nuclear protein called XPA (or XPAC) []. The sequence of the XPA protein is conserved from higher eukaryotes [] to yeast (gene RAD14) []. XPA is a hydrophilic protein of 247 to 296 amino-acid residues which has a C4-type zinc finger motif in its central section. This entry contains the zinc-finger containing region in the XPA protein. It is found N-terminal to PF05181 from PFAM ; PDB: 1D4U_A 1XPA_A.
Probab=26.88  E-value=25  Score=15.29  Aligned_cols=12  Identities=25%  Similarity=0.689  Sum_probs=5.5

Q ss_pred             CCcchhhhccCc
Q psy12196        117 QCPYCITDFSED  128 (150)
Q Consensus       117 ~C~~C~~~f~~~  128 (150)
                      .|..|++.|..+
T Consensus         5 ~C~eC~~~f~dS   16 (34)
T PF01286_consen    5 KCDECGKPFMDS   16 (34)
T ss_dssp             E-TTT--EES-S
T ss_pred             hHhHhCCHHHHH
Confidence            577788777654


No 216
>PRK03564 formate dehydrogenase accessory protein FdhE; Provisional
Probab=26.52  E-value=29  Score=23.81  Aligned_cols=8  Identities=25%  Similarity=0.476  Sum_probs=5.1

Q ss_pred             CcCCcchh
Q psy12196        115 QIQCPYCI  122 (150)
Q Consensus       115 ~~~C~~C~  122 (150)
                      -..|..|+
T Consensus       252 ~e~C~~C~  259 (309)
T PRK03564        252 AESCGDCG  259 (309)
T ss_pred             eeeccccc
Confidence            45677776


No 217
>PF08271 TF_Zn_Ribbon:  TFIIB zinc-binding;  InterPro: IPR013137 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents a zinc finger motif found in transcription factor IIB (TFIIB). In eukaryotes the initiation of transcription of protein encoding genes by the polymerase II complexe (Pol II) is modulated by general and specific transcription factors. The general transcription factors operate through common promoters elements (such as the TATA box). At least seven different proteins associate to form the general transcription factors: TFIIA, -IIB, -IID, -IIE, -IIF, -IIG, and -IIH [].  TFIIB and TFIID are responsible for promoter recognition and interaction with pol II; together with Pol II, they form a minimal initiation complex capable of transcription under certain conditions. The TATA box of a Pol II promoter is bound in the initiation complex by the TBP subunit of TFIID, which bends the DNA around the C-terminal domain of TFIIB whereas the N-terminal zinc finger of TFIIB interacts with Pol II [, ]. The TFIIB zinc finger adopts a zinc ribbon fold characterised by two beta-hairpins forming two structurally similar zinc-binding sub-sites []. The zinc finger contacts the rbp1 subunit of Pol II through its dock domain, a conserved region of about 70 amino acids located close to the polymerase active site []. In the Pol II complex this surface is located near the RNA exit groove. Interestingly this sequence is best conserved in the three polymerases that utilise a TFIIB-like general transcription factor (Pol II, Pol III, and archaeal RNA polymerase) but not in Pol I [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0006355 regulation of transcription, DNA-dependent; PDB: 1VD4_A 1PFT_A 3K1F_M 3K7A_M 1RO4_A 1RLY_A 1DL6_A.
Probab=26.46  E-value=25  Score=15.91  Aligned_cols=9  Identities=44%  Similarity=1.073  Sum_probs=4.1

Q ss_pred             eeccccccc
Q psy12196         31 IQCNMCSLV   39 (150)
Q Consensus        31 ~~c~~c~~~   39 (150)
                      +.|+.||..
T Consensus        20 ~vC~~CG~V   28 (43)
T PF08271_consen   20 LVCPNCGLV   28 (43)
T ss_dssp             EEETTT-BB
T ss_pred             EECCCCCCE
Confidence            455555543


No 218
>PRK00564 hypA hydrogenase nickel incorporation protein; Provisional
Probab=26.32  E-value=45  Score=19.13  Aligned_cols=13  Identities=23%  Similarity=0.756  Sum_probs=7.0

Q ss_pred             ccccCCCCcccCC
Q psy12196         57 MFTCRRCPSTFLN   69 (150)
Q Consensus        57 ~~~c~~c~~~f~~   69 (150)
                      .+.|..|+..|..
T Consensus        71 ~~~C~~Cg~~~~~   83 (117)
T PRK00564         71 ELECKDCSHVFKP   83 (117)
T ss_pred             EEEhhhCCCcccc
Confidence            3556666655543


No 219
>TIGR00143 hypF [NiFe] hydrogenase maturation protein HypF. A previously described regulatory effect of HypF mutatation is attributable to loss of activity of a regulatory hydrogenase. A zinc finger-like region CXXCX(18)CXXCX(24)CXXCX(18)CXXC region further supported the regulatory hypothesis. However, more recent work (PUBMED:11375153) shows the direct effect is on the activity of expressed hydrogenases with nickel/iron centers, rather than on expression.
Probab=26.27  E-value=4.1  Score=31.17  Aligned_cols=61  Identities=15%  Similarity=0.338  Sum_probs=26.4

Q ss_pred             ecccccccccChHHHHHHHhccCCcccccCCCCcccCChHHHHHHHHhhcCCC-cccCCCChhhhcch
Q psy12196         32 QCNMCSLVLDSKESLVTHISQTHTLMFTCRRCPSTFLNSATLSKHVKMEHNSK-SYQCNECPESFERL   98 (150)
Q Consensus        32 ~c~~c~~~f~~~~~l~~h~~~~~~~~~~c~~c~~~f~~~~~l~~h~~~~~~~~-~~~c~~c~~~~~~~   98 (150)
                      .|..|-+.+.++..     .+.+.....|..||-.|.-...|.- -+..+.-. ---|..|-+.+...
T Consensus        70 ~C~~Cl~E~~dp~~-----Rry~YpF~nCt~CGPr~~i~~~lpy-dr~~t~m~~f~~C~~C~~ey~~p  131 (711)
T TIGR00143        70 TCSDCLEEMLDKND-----RRYLYPFISCTHCGPRFTIIEALPY-DRENTSMADFPLCPDCAKEYKDP  131 (711)
T ss_pred             hHHHHHHHhcCCCc-----ccccCCcccccCCCCCeEEeecCCC-CCCCcCCCCCcCCHHHHHHhcCC
Confidence            35555554443332     1222233457777766654333221 11111111 12466666665544


No 220
>PRK00762 hypA hydrogenase nickel incorporation protein; Provisional
Probab=25.94  E-value=22  Score=20.63  Aligned_cols=6  Identities=50%  Similarity=1.481  Sum_probs=2.9

Q ss_pred             CCcchh
Q psy12196        117 QCPYCI  122 (150)
Q Consensus       117 ~C~~C~  122 (150)
                      .||.|+
T Consensus        94 ~CP~Cg   99 (124)
T PRK00762         94 ECPVCG   99 (124)
T ss_pred             cCcCCC
Confidence            355554


No 221
>COG4338 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=25.87  E-value=24  Score=16.67  Aligned_cols=16  Identities=25%  Similarity=0.526  Sum_probs=11.4

Q ss_pred             cCCCChhhhcchhHHh
Q psy12196         87 QCNECPESFERLNKLK  102 (150)
Q Consensus        87 ~c~~c~~~~~~~~~l~  102 (150)
                      .|++|++.|+....+.
T Consensus        14 ICpvCqRPFsWRkKW~   29 (54)
T COG4338          14 ICPVCQRPFSWRKKWA   29 (54)
T ss_pred             hhhhhcCchHHHHHHH
Confidence            6888888887765443


No 222
>COG1326 Uncharacterized archaeal Zn-finger protein [General function prediction only]
Probab=25.84  E-value=64  Score=20.53  Aligned_cols=10  Identities=20%  Similarity=0.783  Sum_probs=4.6

Q ss_pred             cccCCCCccc
Q psy12196         58 FTCRRCPSTF   67 (150)
Q Consensus        58 ~~c~~c~~~f   67 (150)
                      ..|..||..+
T Consensus        31 vrC~eCG~V~   40 (201)
T COG1326          31 VRCEECGTVH   40 (201)
T ss_pred             EEccCCCcEe
Confidence            3455555443


No 223
>PRK14892 putative transcription elongation factor Elf1; Provisional
Probab=25.73  E-value=19  Score=20.04  Aligned_cols=10  Identities=20%  Similarity=0.504  Sum_probs=5.0

Q ss_pred             ccCCCChhhh
Q psy12196         86 YQCNECPESF   95 (150)
Q Consensus        86 ~~c~~c~~~~   95 (150)
                      ..|..||..+
T Consensus        43 ~~C~~CG~y~   52 (99)
T PRK14892         43 ITCGNCGLYT   52 (99)
T ss_pred             EECCCCCCcc
Confidence            4555555443


No 224
>COG4896 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=25.59  E-value=30  Score=17.31  Aligned_cols=6  Identities=67%  Similarity=1.802  Sum_probs=2.4

Q ss_pred             ccCCCC
Q psy12196         86 YQCNEC   91 (150)
Q Consensus        86 ~~c~~c   91 (150)
                      |-|++|
T Consensus        32 ymC~eC   37 (68)
T COG4896          32 YMCPEC   37 (68)
T ss_pred             Eechhh
Confidence            334333


No 225
>PLN03239 histone acetyltransferase; Provisional
Probab=25.31  E-value=56  Score=22.90  Aligned_cols=23  Identities=13%  Similarity=0.353  Sum_probs=19.7

Q ss_pred             CcCCcchhhhccCchHHHHHHHH
Q psy12196        115 QIQCPYCITDFSEDKNLIQHIVS  137 (150)
Q Consensus       115 ~~~C~~C~~~f~~~~~l~~H~~~  137 (150)
                      -|.|..|-+-|.+...|.+|+..
T Consensus       106 lYiCE~Clky~~~~~~l~~H~~~  128 (351)
T PLN03239        106 LYVCEFSFGFFARKSELLRFQAK  128 (351)
T ss_pred             EEEeccchhhhcCHHHHHHHHHh
Confidence            78899999988889999998764


No 226
>COG1571 Predicted DNA-binding protein containing a Zn-ribbon domain [General function prediction only]
Probab=25.30  E-value=47  Score=23.94  Aligned_cols=30  Identities=17%  Similarity=0.560  Sum_probs=18.7

Q ss_pred             ccCCCCcccCChHHHHHHHHhhcCCCcccCCCChhhhcchh
Q psy12196         59 TCRRCPSTFLNSATLSKHVKMEHNSKSYQCNECPESFERLN   99 (150)
Q Consensus        59 ~c~~c~~~f~~~~~l~~h~~~~~~~~~~~c~~c~~~~~~~~   99 (150)
                      .|+.||..-.+           .|...|+|..||..+....
T Consensus       352 ~Cp~Cg~~m~S-----------~G~~g~rC~kCg~~~~~~~  381 (421)
T COG1571         352 VCPRCGGRMKS-----------AGRNGFRCKKCGTRARETL  381 (421)
T ss_pred             CCCccCCchhh-----------cCCCCcccccccccCCccc
Confidence            67778754322           2333688888887776653


No 227
>KOG4124|consensus
Probab=24.57  E-value=18  Score=25.08  Aligned_cols=53  Identities=26%  Similarity=0.555  Sum_probs=33.2

Q ss_pred             CCcccCCC--ChhhhcchhHHhhHHhhhcC-----------------CCCCCcCCcchhhhccCchHHHHHH
Q psy12196         83 SKSYQCNE--CPESFERLNKLKRHKFQAHN-----------------DSVHQIQCPYCITDFSEDKNLIQHI  135 (150)
Q Consensus        83 ~~~~~c~~--c~~~~~~~~~l~~h~~~~~~-----------------~~~~~~~C~~C~~~f~~~~~l~~H~  135 (150)
                      .++|.|.+  |++.+.....|..|...-+.                 ...++|+|++|.+.....-.|.-|.
T Consensus       347 ~~~~~~~vp~~~~~~~n~ng~~~~~~~~h~s~i~~~s~~~~ph~~~~~~nk~~r~~i~~~~~k~~~~l~~~~  418 (442)
T KOG4124|consen  347 DKPYKCPVPNCDKAYKNQNGLKYHKLHGHCSPITTPTPAPIPHQGFVVENKPYRCEVCSKRYKNLNGLKYHR  418 (442)
T ss_pred             cCCCCCCCCcchhhcccCcceeeccccCcCCCCCCCCCCCCCcceeeeccCcccChhhhhhhccCCCCCcee
Confidence            35677766  77777766666655332111                 1125899999999888765555543


No 228
>KOG0782|consensus
Probab=24.46  E-value=21  Score=26.75  Aligned_cols=52  Identities=15%  Similarity=0.450  Sum_probs=32.2

Q ss_pred             HHHHHHHHhhcCCCcccCCCChhhhcchhHHhhHHhhhcCCCCCCcCCcchhhhccCch
Q psy12196         71 ATLSKHVKMEHNSKSYQCNECPESFERLNKLKRHKFQAHNDSVHQIQCPYCITDFSEDK  129 (150)
Q Consensus        71 ~~l~~h~~~~~~~~~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~~C~~C~~~f~~~~  129 (150)
                      ..+..|-=+|.....-+|..||+.|.+.-.+      |..+ .....|.+|..+|-.+-
T Consensus       239 ~~fvrHHWVHrrRqeGkC~~CgKgFQQKf~F------hsKE-ivAisCSWCKqayH~Kv  290 (1004)
T KOG0782|consen  239 SGFVRHHWVHRRRQEGKCNTCGKGFQQKFFF------HSKE-IVAISCSWCKQAYHLKV  290 (1004)
T ss_pred             ccchHHhHhhHhhhccccchhhhhhhhheee------cccc-EEEEEehHHHHHhhcch
Confidence            3555555555544445788899888765332      2222 22557888988887664


No 229
>PF10276 zf-CHCC:  Zinc-finger domain;  InterPro: IPR019401 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.   This entry represents a short conserved zinc-finger domain. It contains the sequence motif Cx8Hx14Cx2C. ; PDB: 2JVM_A 2JRR_A 2JZ8_A.
Probab=24.43  E-value=31  Score=15.59  Aligned_cols=11  Identities=18%  Similarity=0.637  Sum_probs=8.8

Q ss_pred             ceecccccccc
Q psy12196         30 SIQCNMCSLVL   40 (150)
Q Consensus        30 ~~~c~~c~~~f   40 (150)
                      ...|+.|+..|
T Consensus        29 ~~~CpYCg~~y   39 (40)
T PF10276_consen   29 PVVCPYCGTRY   39 (40)
T ss_dssp             EEEETTTTEEE
T ss_pred             eEECCCCCCEE
Confidence            46899998876


No 230
>cd00065 FYVE FYVE domain; Zinc-binding domain; targets proteins to membrane lipids via interaction with phosphatidylinositol-3-phosphate, PI3P; present in Fab1, YOTB, Vac1, and EEA1;
Probab=24.25  E-value=60  Score=15.40  Aligned_cols=6  Identities=50%  Similarity=1.453  Sum_probs=2.2

Q ss_pred             cCCCCc
Q psy12196         60 CRRCPS   65 (150)
Q Consensus        60 c~~c~~   65 (150)
                      |..||.
T Consensus        21 Cr~Cg~   26 (57)
T cd00065          21 CRNCGR   26 (57)
T ss_pred             cCcCcC
Confidence            333333


No 231
>PF14803 Nudix_N_2:  Nudix N-terminal; PDB: 3CNG_C.
Probab=23.80  E-value=23  Score=15.33  Aligned_cols=9  Identities=33%  Similarity=0.907  Sum_probs=5.0

Q ss_pred             CcCCcchhh
Q psy12196        115 QIQCPYCIT  123 (150)
Q Consensus       115 ~~~C~~C~~  123 (150)
                      .+.|+.|+.
T Consensus        22 R~vC~~Cg~   30 (34)
T PF14803_consen   22 RLVCPACGF   30 (34)
T ss_dssp             EEEETTTTE
T ss_pred             ceECCCCCC
Confidence            345666654


No 232
>KOG2747|consensus
Probab=23.75  E-value=55  Score=23.35  Aligned_cols=28  Identities=18%  Similarity=0.490  Sum_probs=24.0

Q ss_pred             CCcCCcchhhhccCchHHHHHHHHhcCC
Q psy12196        114 HQIQCPYCITDFSEDKNLIQHIVSVHLG  141 (150)
Q Consensus       114 ~~~~C~~C~~~f~~~~~l~~H~~~~~~~  141 (150)
                      .-|.|..|-+-+.+...|++|+......
T Consensus       157 ~lYiCEfCLkY~~s~~~l~rH~~kC~~r  184 (396)
T KOG2747|consen  157 KLYICEFCLKYMKSRTSLQRHLKKCKLR  184 (396)
T ss_pred             eEEEehHHHhHhchHHHHHHHHHhcCCC
Confidence            3688999999999999999999877644


No 233
>COG1656 Uncharacterized conserved protein [Function unknown]
Probab=23.37  E-value=71  Score=19.73  Aligned_cols=11  Identities=18%  Similarity=0.969  Sum_probs=5.3

Q ss_pred             cccCCCCcccC
Q psy12196         58 FTCRRCPSTFL   68 (150)
Q Consensus        58 ~~c~~c~~~f~   68 (150)
                      +.|+.|++.|+
T Consensus       131 ~~C~~CgkiYW  141 (165)
T COG1656         131 YRCPKCGKIYW  141 (165)
T ss_pred             eECCCCccccc
Confidence            34555554444


No 234
>PF14787 zf-CCHC_5:  GAG-polyprotein viral zinc-finger; PDB: 1CL4_A 1DSV_A.
Probab=23.26  E-value=28  Score=15.33  Aligned_cols=14  Identities=29%  Similarity=0.622  Sum_probs=7.9

Q ss_pred             CCcchhhhccCchH
Q psy12196        117 QCPYCITDFSEDKN  130 (150)
Q Consensus       117 ~C~~C~~~f~~~~~  130 (150)
                      .|+.|++.|-+.++
T Consensus         4 ~CprC~kg~Hwa~~   17 (36)
T PF14787_consen    4 LCPRCGKGFHWASE   17 (36)
T ss_dssp             C-TTTSSSCS-TTT
T ss_pred             cCcccCCCcchhhh
Confidence            47778777765543


No 235
>TIGR01206 lysW lysine biosynthesis protein LysW. This very small, poorly characterized protein has been shown essential in Thermus thermophilus for an unusual pathway of Lys biosynthesis from aspartate by way of alpha-aminoadipate (AAA) rather than diaminopimelate. It is found also in Deinococcus radiodurans and Pyrococcus horikoshii, which appear to share the AAA pathway.
Probab=23.09  E-value=41  Score=16.37  Aligned_cols=8  Identities=25%  Similarity=0.754  Sum_probs=3.6

Q ss_pred             CCCccccc
Q psy12196          2 SCVPCDVL    9 (150)
Q Consensus         2 ~C~~C~~~    9 (150)
                      .|+.||..
T Consensus         4 ~CP~CG~~   11 (54)
T TIGR01206         4 ECPDCGAE   11 (54)
T ss_pred             CCCCCCCE
Confidence            34444443


No 236
>KOG2923|consensus
Probab=22.94  E-value=73  Score=16.14  Aligned_cols=12  Identities=17%  Similarity=0.456  Sum_probs=6.0

Q ss_pred             cCCcccccCCCC
Q psy12196         53 THTLMFTCRRCP   64 (150)
Q Consensus        53 ~~~~~~~c~~c~   64 (150)
                      .++.-..|+.|.
T Consensus        40 ~ge~Va~CpsCS   51 (67)
T KOG2923|consen   40 NGEDVARCPSCS   51 (67)
T ss_pred             CCCeeecCCCce
Confidence            344444566664


No 237
>KOG1940|consensus
Probab=22.67  E-value=1.7e+02  Score=19.98  Aligned_cols=18  Identities=17%  Similarity=0.397  Sum_probs=12.4

Q ss_pred             eecccccccccChHHHHHH
Q psy12196         31 IQCNMCSLVLDSKESLVTH   49 (150)
Q Consensus        31 ~~c~~c~~~f~~~~~l~~h   49 (150)
                      |.||.|.+ ..+...+...
T Consensus       197 y~CP~C~~-~~d~~~~~~~  214 (276)
T KOG1940|consen  197 YTCPICSK-PGDMSHYFRK  214 (276)
T ss_pred             CCCCcccc-hHHHHHHHHH
Confidence            88999988 5555555444


No 238
>COG4391 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=22.43  E-value=38  Score=16.98  Aligned_cols=13  Identities=38%  Similarity=1.132  Sum_probs=9.1

Q ss_pred             CcCCcchhhhccC
Q psy12196        115 QIQCPYCITDFSE  127 (150)
Q Consensus       115 ~~~C~~C~~~f~~  127 (150)
                      .-.|+.|+..|..
T Consensus        48 ev~CPYC~t~y~l   60 (62)
T COG4391          48 EVVCPYCSTRYRL   60 (62)
T ss_pred             cEecCccccEEEe
Confidence            4578888877753


No 239
>PF13821 DUF4187:  Domain of unknown function (DUF4187)
Probab=22.38  E-value=48  Score=16.16  Aligned_cols=17  Identities=18%  Similarity=0.593  Sum_probs=11.8

Q ss_pred             CCcccccccCHHHHHHH
Q psy12196          3 CVPCDVLFHNKATLYKH   19 (150)
Q Consensus         3 C~~C~~~f~~~~~l~~h   19 (150)
                      |-.||..|.+...|..+
T Consensus        30 C~~Cg~~Y~d~~dL~~~   46 (55)
T PF13821_consen   30 CFWCGTKYDDEEDLERN   46 (55)
T ss_pred             eeeeCCccCCHHHHHhC
Confidence            66777777777776544


No 240
>PF03470 zf-XS:  XS zinc finger domain;  InterPro: IPR005381 This domain is a putative nucleic acid binding zinc finger and is found at the N terminus of proteins that also contain an adjacent XS domain IPR005380 from INTERPRO and in some proteins a C-terminal XH domain IPR005379 from INTERPRO.
Probab=22.30  E-value=83  Score=14.55  Aligned_cols=8  Identities=25%  Similarity=0.314  Sum_probs=4.1

Q ss_pred             HHHHHHHH
Q psy12196         13 KATLYKHL   20 (150)
Q Consensus        13 ~~~l~~h~   20 (150)
                      ...|..|-
T Consensus        14 ~~~LlqHA   21 (43)
T PF03470_consen   14 YRELLQHA   21 (43)
T ss_pred             hhHHHHHH
Confidence            45555554


No 241
>PF13240 zinc_ribbon_2:  zinc-ribbon domain
Probab=22.12  E-value=29  Score=13.41  Aligned_cols=6  Identities=33%  Similarity=1.137  Sum_probs=2.5

Q ss_pred             CCcccc
Q psy12196          3 CVPCDV    8 (150)
Q Consensus         3 C~~C~~    8 (150)
                      |+.||.
T Consensus         2 Cp~CG~    7 (23)
T PF13240_consen    2 CPNCGA    7 (23)
T ss_pred             CcccCC
Confidence            344443


No 242
>PF12773 DZR:  Double zinc ribbon
Probab=21.80  E-value=46  Score=15.40  Aligned_cols=6  Identities=33%  Similarity=1.082  Sum_probs=2.5

Q ss_pred             cCCCCh
Q psy12196         87 QCNECP   92 (150)
Q Consensus        87 ~c~~c~   92 (150)
                      .|..|+
T Consensus        31 ~C~~Cg   36 (50)
T PF12773_consen   31 ICPNCG   36 (50)
T ss_pred             CCcCCc
Confidence            344443


No 243
>KOG1813|consensus
Probab=21.80  E-value=75  Score=21.73  Aligned_cols=15  Identities=33%  Similarity=0.691  Sum_probs=11.7

Q ss_pred             cccccCCCCcccCCh
Q psy12196         56 LMFTCRRCPSTFLNS   70 (150)
Q Consensus        56 ~~~~c~~c~~~f~~~   70 (150)
                      .||.|.+|.+.|.++
T Consensus       240 ~Pf~c~icr~~f~~p  254 (313)
T KOG1813|consen  240 LPFKCFICRKYFYRP  254 (313)
T ss_pred             CCccccccccccccc
Confidence            578888888887665


No 244
>PF12230 PRP21_like_P:  Pre-mRNA splicing factor PRP21 like protein;  InterPro: IPR022030  This domain family is found in eukaryotes, and is typically between 212 and 238 amino acids in length. The family is found in association with PF01805 from PFAM. There are two completely conserved residues (W and H) that may be functionally important. PRP21 is required for assembly of the prespliceosome and it interacts with U2 snRNP and/or pre-mRNA in the prespliceosome. This family also contains proteins similar to PRP21, such as the mammalian SF3a. SF3a also interacts with U2 snRNP from the prespliceosome, converting it to its active form. ; PDB: 4DGW_B.
Probab=21.77  E-value=30  Score=22.39  Aligned_cols=29  Identities=17%  Similarity=0.182  Sum_probs=0.0

Q ss_pred             CcCCcchhhhccCchHHHHHHHHhcCCCCC
Q psy12196        115 QIQCPYCITDFSEDKNLIQHIVSVHLGKEG  144 (150)
Q Consensus       115 ~~~C~~C~~~f~~~~~l~~H~~~~~~~~~~  144 (150)
                      ...||+||..... +.|..||++.-....|
T Consensus       168 ~~~cPitGe~IP~-~e~~eHmRi~LlDP~w  196 (229)
T PF12230_consen  168 MIICPITGEMIPA-DEMDEHMRIELLDPRW  196 (229)
T ss_dssp             ------------------------------
T ss_pred             ccccccccccccc-cccccccccccccccc
Confidence            4689999988887 4688898887655444


No 245
>PRK01343 zinc-binding protein; Provisional
Probab=21.30  E-value=42  Score=16.59  Aligned_cols=12  Identities=25%  Similarity=0.526  Sum_probs=8.7

Q ss_pred             CcCCcchhhhcc
Q psy12196        115 QIQCPYCITDFS  126 (150)
Q Consensus       115 ~~~C~~C~~~f~  126 (150)
                      ...|++|++.+.
T Consensus         9 ~~~CP~C~k~~~   20 (57)
T PRK01343          9 TRPCPECGKPST   20 (57)
T ss_pred             CCcCCCCCCcCc
Confidence            346889988765


No 246
>TIGR03831 YgiT_finger YgiT-type zinc finger domain. This domain model describes a small domain with two copies of a putative zinc-binding motif CXXC (usually CXXCG). Most member proteins consist largely of this domain or else carry an additional C-terminal helix-turn-helix domain, resembling that of the phage protein Cro and modeled by pfam01381.
Probab=21.30  E-value=42  Score=14.99  Aligned_cols=11  Identities=27%  Similarity=1.005  Sum_probs=6.7

Q ss_pred             cccCCCCcccC
Q psy12196         58 FTCRRCPSTFL   68 (150)
Q Consensus        58 ~~c~~c~~~f~   68 (150)
                      +.|+.||..+.
T Consensus        33 ~~C~~CGE~~~   43 (46)
T TIGR03831        33 LVCPQCGEEYL   43 (46)
T ss_pred             cccccCCCEee
Confidence            45777766554


No 247
>KOG3352|consensus
Probab=21.00  E-value=43  Score=20.27  Aligned_cols=13  Identities=31%  Similarity=0.621  Sum_probs=10.8

Q ss_pred             CcCCcchhhhccC
Q psy12196        115 QIQCPYCITDFSE  127 (150)
Q Consensus       115 ~~~C~~C~~~f~~  127 (150)
                      ..+|++||..|..
T Consensus       133 ~~rc~eCG~~fkL  145 (153)
T KOG3352|consen  133 TQRCPECGHYFKL  145 (153)
T ss_pred             cccCCcccceEEe
Confidence            6689999988864


No 248
>PF09963 DUF2197:  Uncharacterized protein conserved in bacteria (DUF2197);  InterPro: IPR019241  This family represents various hypothetical bacterial proteins with no known function. 
Probab=20.81  E-value=27  Score=17.15  Aligned_cols=8  Identities=25%  Similarity=0.658  Sum_probs=3.7

Q ss_pred             CcCCcchh
Q psy12196        115 QIQCPYCI  122 (150)
Q Consensus       115 ~~~C~~C~  122 (150)
                      .|.|..|.
T Consensus        31 tYmC~eC~   38 (56)
T PF09963_consen   31 TYMCDECK   38 (56)
T ss_pred             ceeChhHH
Confidence            44444443


No 249
>smart00064 FYVE Protein present in Fab1, YOTB, Vac1, and EEA1. The FYVE zinc finger is named after four proteins where it was first found: Fab1, YOTB/ZK632.12, Vac1, and EEA1. The FYVE finger has been shown to bind two Zn2+ ions. The FYVE finger has eight potential zinc coordinating cysteine positions. The FYVE finger is structurally related to the PF06220 zf-U1:  U1 zinc finger;  InterPro: IPR013085 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  C2H2-type (classical) zinc fingers (Znf) were the first class to be characterised. They contain a short beta hairpin and an alpha helix (beta/beta/alpha structure), where a single zinc atom is held in place by Cys(2)His(2) (C2H2) residues in a tetrahedral array. C2H2 Znf's can be divided into three groups based on the number and pattern of fingers: triple-C2H2 (binds single ligand), multiple-adjacent-C2H2 (binds multiple ligands), and separated paired-C2H2 []. C2H2 Znf's are the most common DNA-binding motifs found in eukaryotic transcription factors, and have also been identified in prokaryotes []. Transcription factors usually contain several Znf's (each with a conserved beta/beta/alpha structure) capable of making multiple contacts along the DNA, where the C2H2 Znf motifs recognise DNA sequences by binding to the major groove of DNA via a short alpha-helix in the Znf, the Znf spanning 3-4 bases of the DNA []. C2H2 Znf's can also bind to RNA and protein targets []. This entry represents a C2H2-type zinc finger motif found in several U1 small nuclear ribonucleoprotein C (U1-C) proteins. Some proteins contain multiple copies of this motif. The U1 small nuclear ribonucleoprotein (U1 snRNP) binds to the pre-mRNA 5' splice site at early stages of spliceosome assembly. Recruitment of U1 to a class of weak 5' splice site is promoted by binding of the protein TIA-1 to uridine-rich sequences immediately downstream from the 5' splice site. Binding of TIA-1 in the vicinity of a 5' splice site helps to stabilise U1 snRNP recruitment, at least in part, via a direct interaction with U1-C, thus providing one molecular mechanism for the function of this splicing regulator []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 2VRD_A.
Probab=20.17  E-value=78  Score=14.00  Aligned_cols=9  Identities=22%  Similarity=0.589  Sum_probs=3.5

Q ss_pred             CCCcccccc
Q psy12196          2 SCVPCDVLF   10 (150)
Q Consensus         2 ~C~~C~~~f   10 (150)
                      =|+.|+.-|
T Consensus         5 yCdyC~~~~   13 (38)
T PF06220_consen    5 YCDYCKKYL   13 (38)
T ss_dssp             B-TTT--B-
T ss_pred             eccccccee
Confidence            377888777


No 251
>PF02591 DUF164:  Putative zinc ribbon domain;  InterPro: IPR003743 This entry describes proteins of unknown function.
Probab=20.16  E-value=1.3e+02  Score=14.47  Aligned_cols=10  Identities=20%  Similarity=0.607  Sum_probs=4.9

Q ss_pred             cccccCCCCc
Q psy12196         56 LMFTCRRCPS   65 (150)
Q Consensus        56 ~~~~c~~c~~   65 (150)
                      ....|+.|++
T Consensus        45 ~i~~Cp~CgR   54 (56)
T PF02591_consen   45 EIVFCPNCGR   54 (56)
T ss_pred             CeEECcCCCc
Confidence            3345555553


No 252
>KOG4577|consensus
Probab=20.06  E-value=31  Score=23.31  Aligned_cols=33  Identities=21%  Similarity=0.380  Sum_probs=18.3

Q ss_pred             CCCcccccccCHHHHHHHHHHHhhCCCcceeccccc
Q psy12196          2 SCVPCDVLFHNKATLYKHLYLEHKATSLSIQCNMCS   37 (150)
Q Consensus         2 ~C~~C~~~f~~~~~l~~h~~~~~~~~~~~~~c~~c~   37 (150)
                      +|.-|+..+.++..|+.--+.+|.   +-.+|..|.
T Consensus        35 ~CagC~q~IlDrFilKvl~R~wHs---~CLkCs~C~   67 (383)
T KOG4577|consen   35 ICAGCDQHILDRFILKVLDRHWHS---SCLKCSDCH   67 (383)
T ss_pred             cccchHHHHHHHHHHHHHhhhhhh---hhcchhhhh
Confidence            356667766676666655444444   223555553


Done!