Query         psy12201
Match_columns 116
No_of_seqs    115 out of 736
Neff          5.5 
Searched_HMMs 46136
Date          Fri Aug 16 21:25:48 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy12201.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/12201hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 cd00125 PLA2c PLA2c: Phospholi 100.0 3.7E-40   8E-45  234.5   4.7  102    1-102     8-110 (115)
  2 cd04707 otoconin_90 otoconin_9 100.0 1.3E-39 2.8E-44  232.4   5.4  102    1-104     5-109 (117)
  3 KOG4087|consensus              100.0 1.8E-38 3.9E-43  232.0   3.4  107    1-107    28-136 (144)
  4 PF00068 Phospholip_A2_1:  Phos 100.0 3.9E-36 8.5E-41  213.1   1.3  104    1-104     8-112 (116)
  5 smart00085 PA2c Phospholipase  100.0 6.7E-35 1.5E-39  207.6   5.4  101    1-101     8-110 (117)
  6 cd00618 PLA2_like PLA2_like: P  99.9   7E-24 1.5E-28  140.7   5.6   78   14-93      1-83  (83)
  7 cd04706 PLA2_plant PLA2_plant:  99.4 6.6E-14 1.4E-18  100.2   2.4   57   11-94     19-79  (117)
  8 cd04704 PLA2_bee_venom_like PL  98.7 6.5E-09 1.4E-13   72.1   2.4   62   19-94      8-75  (97)
  9 PF05826 Phospholip_A2_2:  Phos  97.2 0.00011 2.3E-09   51.1   0.9   61   19-93      7-73  (99)
 10 PF08398 Parvo_coat_N:  Parvovi  95.9  0.0026 5.7E-08   41.3   0.5   37   19-55      6-45  (64)
 11 cd04705 PLA2_group_III_like PL  95.8  0.0054 1.2E-07   43.0   1.6   50   31-94     33-82  (100)
 12 PF06951 PLA2G12:  Group XII se  55.7     7.4 0.00016   30.0   1.5   21   25-45     87-111 (184)
 13 PF14703 DUF4463:  Domain of un  32.8      18 0.00039   23.1   0.4   21   19-40     62-82  (85)

No 1  
>cd00125 PLA2c PLA2c: Phospholipase A2, a family of secretory and cytosolic enzymes; the latter are either Ca dependent or Ca independent. PLA2 cleaves the sn-2 position of the glycerol backbone of phospholipids (PC or phosphatidylethanolamine), usually in a metal-dependent reaction, to generate lysophospholipid (LysoPL) and a free fatty acid (FA). The resulting products are either dietary or used in synthetic pathways for leukotrienes and prostaglandins. Often, arachidonic acid is released as a free fatty acid and acts as second messenger in signaling networks. Secreted PLA2s have also been found to specifically bind to a variety of soluble and membrane proteins in mammals, including receptors. As a toxin, PLA2 is a potent presynaptic neurotoxin which blocks nerve terminals by binding to the nerve membrane and hydrolyzing stable membrane lipids. The products of the hydrolysis (LysoPL and FA) cannot form bilayers leading to a change in membrane conformation and ultimately to a block in 
Probab=100.00  E-value=3.7e-40  Score=234.50  Aligned_cols=102  Identities=41%  Similarity=0.916  Sum_probs=92.7

Q ss_pred             CeeeecCCCcccccCCcCCCCCCCCCCcccCCCchhhhhhhhhhcCCCCCCCCCceeeEEEEeCCceeeCCC-Cchhhhh
Q psy12201          1 MVSCSTGCDPLSYKGYGCYCGFLGSGYPVDPIDRCCELHDWCYTGSNCPLFLEYFIPYVWTCFRGRPLCQRG-KSCSHRL   79 (116)
Q Consensus         1 Mi~c~tg~~~~~y~~YGC~Cg~~G~G~PvD~iD~cC~~hd~CY~~~~C~~~~~~~~~Y~~~~~~~~i~C~~~-~~C~r~l   79 (116)
                      ||+++||++|++|++||||||+||+|+|||+|||||+.||.||+.+.-..+.|++.+|+|++.++.|+|.+. ++|+++|
T Consensus         8 MI~c~tgr~~~~Y~~YGCyCG~GG~G~PvD~~DrCC~~HD~CY~~~~~~~C~p~~~~Y~y~~~~~~i~C~~~~~~C~~~~   87 (115)
T cd00125           8 MIKCTTGRSALDYNGYGCYCGLGGSGTPVDDTDRCCQVHDCCYDRAEKGGCSPYFTSYSYTCSDGQITCSDANDKCARAL   87 (115)
T ss_pred             HHHHhcCCCHHHHhhcCCccCCCCCCCCcccHHHHHHHHHhHHhccccCCCccccccceEEEECCcceECcCCChHhHHH
Confidence            999999999999999999999999999999999999999999999943333477889999999999999754 9999999


Q ss_pred             chhhHHHHHHhCcCCCCCCcccc
Q psy12201         80 CECDRRFSECLRPYSCPRYKAVC  102 (116)
Q Consensus        80 CeCDk~~A~cl~~~~~~~~~~~c  102 (116)
                      |||||+||+||++++|+.++...
T Consensus        88 CeCDr~aa~Cf~~~~yn~~~~~~  110 (115)
T cd00125          88 CECDRAAALCFARAPYNPKYRNY  110 (115)
T ss_pred             hHccHHHHHHHhhCcCChhhccC
Confidence            99999999999999998875544


No 2  
>cd04707 otoconin_90 otoconin_90: Phospholipase A2-like domains present in otoconin-90 and otoconin-95, mammal proteins that are principal matrix proteins of calcitic otoconia. Interactions involving otoconin-90 may trigger or constitute key events in otoconia formation. The PLA2-like domains in otoconins may have lost their metal-binding sites.
Probab=100.00  E-value=1.3e-39  Score=232.43  Aligned_cols=102  Identities=33%  Similarity=0.747  Sum_probs=92.2

Q ss_pred             CeeeecCCCcccccCCcCCCCCCCCCCcccCCCchhhhhhhhhhcCC---CCCCCCCceeeEEEEeCCceeeCCCCchhh
Q psy12201          1 MVSCSTGCDPLSYKGYGCYCGFLGSGYPVDPIDRCCELHDWCYTGSN---CPLFLEYFIPYVWTCFRGRPLCQRGKSCSH   77 (116)
Q Consensus         1 Mi~c~tg~~~~~y~~YGC~Cg~~G~G~PvD~iD~cC~~hd~CY~~~~---C~~~~~~~~~Y~~~~~~~~i~C~~~~~C~r   77 (116)
                      ||+++||+++++|++||||||+||+|+|||+|||||+.||.||+.++   |.+ .++ ..|+|+++++.|+|+..+.|++
T Consensus         5 MI~c~tgr~~~~Y~~YGCyCG~GG~G~PvD~~DrCC~~HD~CY~~~~~~~C~~-~~~-~~Y~y~c~~~~i~C~~~~~C~~   82 (117)
T cd04707           5 MLKCLTGRCPREFEDYGCYCGQEGEGLPVDELDRCCFQHRCCLEQASEMGCLQ-DRK-LSTEVTCVDHKPKCEGVSVCEK   82 (117)
T ss_pred             HHhhhcCCCHHHHcccCCcccCCCCCCCcccchhHHHHhHHHHhhhhhcCCCC-CCC-cceEEEEECCccccCCCChHHH
Confidence            99999999999999999999999999999999999999999999884   542 123 5899999999999987889999


Q ss_pred             hhchhhHHHHHHhCcCCCCCCcccccc
Q psy12201         78 RLCECDRRFSECLRPYSCPRYKAVCRS  104 (116)
Q Consensus        78 ~lCeCDk~~A~cl~~~~~~~~~~~c~~  104 (116)
                      +||||||+||+||++++|+.+..+.+.
T Consensus        83 ~vCeCDk~aa~Cf~~~~Yn~~~~~~~~  109 (117)
T cd04707          83 LLCTCDKTAAECMAAAHFNSSLNSLDV  109 (117)
T ss_pred             HHhhccHHHHHHhccCCCCHhhccCCH
Confidence            999999999999999999988776554


No 3  
>KOG4087|consensus
Probab=100.00  E-value=1.8e-38  Score=231.99  Aligned_cols=107  Identities=37%  Similarity=0.831  Sum_probs=97.1

Q ss_pred             CeeeecCCC-cccccCCcCCCCCCCCCCcccCCCchhhhhhhhhhcCCCCCCCCCceeeEEEEeCCceeeCC-CCchhhh
Q psy12201          1 MVSCSTGCD-PLSYKGYGCYCGFLGSGYPVDPIDRCCELHDWCYTGSNCPLFLEYFIPYVWTCFRGRPLCQR-GKSCSHR   78 (116)
Q Consensus         1 Mi~c~tg~~-~~~y~~YGC~Cg~~G~G~PvD~iD~cC~~hd~CY~~~~C~~~~~~~~~Y~~~~~~~~i~C~~-~~~C~r~   78 (116)
                      ||+++||++ ++.|++||||||+||+|+|+|+|||||+.||.||+.++-..+.+|+..|+|+++++.|+|++ +..|+++
T Consensus        28 Mi~~vt~~~~~l~Y~~YGCyCGlGG~G~P~D~iDwCC~~HDcCY~~le~~gC~py~~~Ys~sc~n~~I~Cs~~~~~C~~~  107 (144)
T KOG4087|consen   28 MIECVTGKSAALSYNKYGCYCGLGGSGQPKDAIDWCCHAHDCCYDRLEEKGCSPYTERYSWSCSNQSITCSDKNTECEAQ  107 (144)
T ss_pred             HHHHHcCCCccceecCccccccCCCCCCccchHHHHHhcccHHHHHHHHcCCCccccceeeEeeCCeEEeCCCccHHHHH
Confidence            899999999 58999999999999999999999999999999999996445567899999999999999976 4899999


Q ss_pred             hchhhHHHHHHhCcCCCCCCcccccccch
Q psy12201         79 LCECDRRFSECLRPYSCPRYKAVCRSNVF  107 (116)
Q Consensus        79 lCeCDk~~A~cl~~~~~~~~~~~c~~~~~  107 (116)
                      ||||||++|+||+|.+||.++...++.-.
T Consensus       108 lC~CDk~~a~C~~r~~yn~ky~~~~n~~c  136 (144)
T KOG4087|consen  108 LCECDKKAAECLKRTTYNKKYKYYPNRLC  136 (144)
T ss_pred             HhhhhhHHHHHHhcCccchhhccCCCccc
Confidence            99999999999999999998776665433


No 4  
>PF00068 Phospholip_A2_1:  Phospholipase A2;  InterPro: IPR001211 Phospholipase A2 (3.1.1.4 from EC) (PLA2) is a small lipolytic enzyme that releases fatty acids from the second carbon group of glycerol. It is involved in a number of physiologically important cellular processes, such as the liberation of arachidonic acid from membrane phospholipids []. It plays a pivotal role in the biosynthesis of prostaglandin and other mediators of inflammation. PLA2 has four to seven disulphide bonds and binds a calcium ion that is essential for activity. Within the active enzyme, the alpha amino group is involved in a conserved hydrogen-bonding network linking the N-terminal region to the active site. The side chains of two conserved residues, His and Asp, participate in the catalytic network. Many PLA2's are widely distributed in snakes, lizards, bees and mammals. In mammals there are at least four forms: pancreatic, membrane-associated as well as two less well characterised forms. The venom of most snakes contains multiple forms of PLA2. Some of them are presynaptic neurotoxins which inhibit neuromuscular transmission by blocking acetylcholine release from the nerve termini. Some of the proteins in this family are allergens. Allergies are hypersensitivity reactions of the immune system to specific substances called allergens (such as pollen, stings, drugs, or food) that, in most people, result in no symptoms. A nomenclature system has been established for antigens (allergens) that cause IgE-mediated atopic allergies in humans [WHO/IUIS Allergen Nomenclature Subcommittee King T.P., Hoffmann D., Loewenstein H., Marsh D.G., Platts-Mills T.A.E., Thomas W. Bull. World Health Organ. 72:797-806(1994)]. This nomenclature system is defined by a designation that is composed of the first three letters of the genus; a space; the first letter of the species name; a space and an arabic number. In the event that two species names have identical designations, they are discriminated from one another by adding one or more letters (as necessary) to each species designation.  The allergens in this family include allergens with the following designations: Api m 1.; GO: 0004623 phospholipase A2 activity, 0005509 calcium ion binding, 0016042 lipid catabolic process; PDB: 1OQS_F 1S6B_B 1XXW_B 1MH2_B 2RD4_B 1OZ6_A 2OSN_A 2PH4_B 1FDK_A 2BP2_A ....
Probab=100.00  E-value=3.9e-36  Score=213.13  Aligned_cols=104  Identities=42%  Similarity=0.905  Sum_probs=91.0

Q ss_pred             CeeeecCCCc-ccccCCcCCCCCCCCCCcccCCCchhhhhhhhhhcCCCCCCCCCceeeEEEEeCCceeeCCCCchhhhh
Q psy12201          1 MVSCSTGCDP-LSYKGYGCYCGFLGSGYPVDPIDRCCELHDWCYTGSNCPLFLEYFIPYVWTCFRGRPLCQRGKSCSHRL   79 (116)
Q Consensus         1 Mi~c~tg~~~-~~y~~YGC~Cg~~G~G~PvD~iD~cC~~hd~CY~~~~C~~~~~~~~~Y~~~~~~~~i~C~~~~~C~r~l   79 (116)
                      ||+++|+..+ ++|++||||||++|+|+|||+||++|+.|+.||+++.-..+.+++..|+|++..+.|+|+++++|+++|
T Consensus         8 Mi~~~~~~~~~~~y~~YGCyCg~~g~G~PvD~iD~~C~~h~~Cy~~~~~~~C~~~~~~Y~~~~~~~~i~C~~~~~C~~~l   87 (116)
T PF00068_consen    8 MIKCVTGKFPFFKYNDYGCYCGFGGKGQPVDEIDRCCRKHDQCYKCAKEKGCDPYFTSYSYSCSNKNITCSDNDSCERAL   87 (116)
T ss_dssp             HHHHHHSSSHHHHHSSBTTTBSSSSSSS-SSHHHHHHHHHHHHHHHHTTTTSSTTTSS-EEEEETTEEEEESSSHHHHHH
T ss_pred             HHHHhhCCCcHHHHccccccCCCCCCCCCcccccchhHHhHHHHHHHhcccccccccceEEEEecCCcccCCCCchhHHh
Confidence            8999998886 699999999999999999999999999999999999544455667799999999999997799999999


Q ss_pred             chhhHHHHHHhCcCCCCCCcccccc
Q psy12201         80 CECDRRFSECLRPYSCPRYKAVCRS  104 (116)
Q Consensus        80 CeCDk~~A~cl~~~~~~~~~~~c~~  104 (116)
                      ||||++||+||++++|+.++.+.+.
T Consensus        88 CeCD~~~A~cl~~~~yn~~~~~~~~  112 (116)
T PF00068_consen   88 CECDKAFAECLARNSYNKKYKNFDR  112 (116)
T ss_dssp             HHHHHHHHHHHHHTGB-GGGBTTTH
T ss_pred             hhCcHHHHHHHHhCccCHHHhCCCc
Confidence            9999999999999999988776544


No 5  
>smart00085 PA2c Phospholipase A2.
Probab=100.00  E-value=6.7e-35  Score=207.57  Aligned_cols=101  Identities=38%  Similarity=0.780  Sum_probs=90.6

Q ss_pred             CeeeecCCCc-ccccCCcCCCCCCCCCCcccCCCchhhhhhhhhhcCCCCCCCCCceeeEEEEeCCceeeCC-CCchhhh
Q psy12201          1 MVSCSTGCDP-LSYKGYGCYCGFLGSGYPVDPIDRCCELHDWCYTGSNCPLFLEYFIPYVWTCFRGRPLCQR-GKSCSHR   78 (116)
Q Consensus         1 Mi~c~tg~~~-~~y~~YGC~Cg~~G~G~PvD~iD~cC~~hd~CY~~~~C~~~~~~~~~Y~~~~~~~~i~C~~-~~~C~r~   78 (116)
                      ||+++||++| ++|++||||||+||+|+|||+||+||+.||.||+.++-....++++.|+|+++++.|+|.. .++|++.
T Consensus         8 mi~c~t~~~~~~~y~~YGCyCG~gg~G~pvD~~D~CC~~HD~Cy~~~~~~~C~~~~~~y~~~c~~~~~~C~~~~~~C~~~   87 (117)
T smart00085        8 MIQCATGKRAWLSYGDYGCYCGWGGSGTPVDATDRCCFVHDCCYGKAEKEGCNPKTTTYSYSCDNGFITCGGKNTACLVF   87 (117)
T ss_pred             HHHHhcCCCcccchhccCcccCCCCCCCccccccchhhhcCchhhhcccCCCcccccceEEEEECCcceECcCCCcccee
Confidence            8999999776 7999999999999999999999999999999999884234456789999999999999964 7899999


Q ss_pred             hchhhHHHHHHhCcCCCCCCccc
Q psy12201         79 LCECDRRFSECLRPYSCPRYKAV  101 (116)
Q Consensus        79 lCeCDk~~A~cl~~~~~~~~~~~  101 (116)
                      +||||+++|+||+++|+|.+...
T Consensus        88 ~C~CD~~aa~Cf~~~~yn~~~~~  110 (117)
T smart00085       88 VCECDRAAAICFAKNPYNKKNYN  110 (117)
T ss_pred             ecccCHHHHHHhhhCccChhccc
Confidence            99999999999999999887443


No 6  
>cd00618 PLA2_like PLA2_like: Phospholipase A2, a super-family of secretory and cytosolic enzymes; the latter are either Ca dependent or Ca independent. PLA2 cleaves the sn-2 position of the glycerol backbone of phospholipids (PC or phosphatidylethanolamine), usually in a metal-dependent reaction, to generate lysophospholipid (LysoPL) and a free fatty acid (FA). The resulting products are either dietary or used in synthetic pathways for leukotrienes and prostaglandins. Often, arachidonic acid is released as a free fatty acid and acts as second messenger in signaling networks. Secreted PLA2s have also been found to specifically bind to a variety of soluble and membrane proteins in mammals, including receptors. As a toxin, PLA2 is a potent presynaptic neurotoxin which blocks nerve terminals by binding to the nerve membrane and hydrolyzing stable membrane lipids. The products of the hydrolysis (LysoPL and FA) cannot form bilayers leading to a change in membrane conformation and ultimately 
Probab=99.89  E-value=7e-24  Score=140.73  Aligned_cols=78  Identities=40%  Similarity=0.855  Sum_probs=64.1

Q ss_pred             cCCcCCCCCCCC----CCcccCCCchhhhhhhhhhcCCCCCCCCCceeeEEEEeCCceee-CCCCchhhhhchhhHHHHH
Q psy12201         14 KGYGCYCGFLGS----GYPVDPIDRCCELHDWCYTGSNCPLFLEYFIPYVWTCFRGRPLC-QRGKSCSHRLCECDRRFSE   88 (116)
Q Consensus        14 ~~YGC~Cg~~G~----G~PvD~iD~cC~~hd~CY~~~~C~~~~~~~~~Y~~~~~~~~i~C-~~~~~C~r~lCeCDk~~A~   88 (116)
                      +.||||||+||+    |+|||+||+||+.||.||+.+.-.....+...|.|  ..+.++| .+.+.|++.+|+||++||+
T Consensus         1 ~~ygc~CG~g~~~~~~g~p~D~~D~CC~~HD~Cy~~~~~~~~~~~~~~~~~--~~~~~~~~~~~~~c~~~~C~CD~~~a~   78 (83)
T cd00618           1 LPYGCYCGPGGSACPSGQPVDETDRCCRKHDCCYDQISDGGCCDGCLSYSF--SEGGVTCLTNSDLCTRSHCDCDRRLAI   78 (83)
T ss_pred             CCcCcccCCCCcCCCCCCCCCcchhhhhhCccHhhhhhccCCCCCcceeee--cCCceeECCCCChhhHhhCcccHHHHH
Confidence            479999999999    99999999999999999999853222223345655  5666888 5779999999999999999


Q ss_pred             HhCcC
Q psy12201         89 CLRPY   93 (116)
Q Consensus        89 cl~~~   93 (116)
                      ||+++
T Consensus        79 Cl~~~   83 (83)
T cd00618          79 CLARA   83 (83)
T ss_pred             HhhhC
Confidence            99864


No 7  
>cd04706 PLA2_plant PLA2_plant: Plant-specific sub-family of  Phospholipase A2, a super-family of secretory and cytosolic enzymes; the latter are either Ca dependent or Ca independent. Enzymatically active PLA2 cleaves the sn-2 position of the glycerol backbone of phospholipids; secreted PLA2s have also been found to specifically bind to a variety of soluble and membrane proteins in mammals, including receptors. As a toxin, PLA2 is a potent presynaptic neurotoxin which blocks nerve terminals by binding to the nerve membrane and hydrolyzing stable membrane lipids. The products of the hydrolysis cannot form bilayers leading to a change in membrane conformation and ultimately to a block in the release of neurotransmitters. PLA2 may form dimers or oligomers. This sub-family does not appear to have a conserved active site and metal-binding loop.
Probab=99.42  E-value=6.6e-14  Score=100.16  Aligned_cols=57  Identities=35%  Similarity=0.766  Sum_probs=47.4

Q ss_pred             ccccCCcCCCCCCCCC----CcccCCCchhhhhhhhhhcCCCCCCCCCceeeEEEEeCCceeeCCCCchhhhhchhhHHH
Q psy12201         11 LSYKGYGCYCGFLGSG----YPVDPIDRCCELHDWCYTGSNCPLFLEYFIPYVWTCFRGRPLCQRGKSCSHRLCECDRRF   86 (116)
Q Consensus        11 ~~y~~YGC~Cg~~G~G----~PvD~iD~cC~~hd~CY~~~~C~~~~~~~~~Y~~~~~~~~i~C~~~~~C~r~lCeCDk~~   86 (116)
                      ..|..||||||+|++|    .|||+||+||+.||.||+...          +              +   ..-|+||.+|
T Consensus        19 ~~y~~YG~yCG~g~~g~~~~~P~D~lD~CC~~HD~Cy~~~~----------~--------------~---~~~c~C~~~f   71 (117)
T cd04706          19 PPFLRYGKYCGPGYSGCPGERPCDDLDACCMTHDACVQAKK----------N--------------D---YLSLECNEKF   71 (117)
T ss_pred             CcccccCcccCCCCCCCCCCCCcchhhHHHHhCcCcccCCC----------C--------------C---cCCchHHHHH
Confidence            3599999999999988    899999999999999997431          0              0   2468999999


Q ss_pred             HHHhCcCC
Q psy12201         87 SECLRPYS   94 (116)
Q Consensus        87 A~cl~~~~   94 (116)
                      ..|+++..
T Consensus        72 ~~Cl~~~~   79 (117)
T cd04706          72 KNCVRRFR   79 (117)
T ss_pred             HHHHHHhc
Confidence            99998644


No 8  
>cd04704 PLA2_bee_venom_like PLA2_bee_venom_like: A sub-family of  Phospholipase A2, similar to bee venom PLA2. PLA2 is a super-family of secretory and cytosolic enzymes; the latter are either Ca dependent or Ca independent. Enzymatically active PLA2 cleaves the sn-2 position of the glycerol backbone of phospholipids; secreted PLA2s have also been found to specifically bind to a variety of soluble and membrane proteins in mammals, including receptors. As a toxin, PLA2 is a potent presynaptic neurotoxin which blocks nerve terminals by binding to the nerve membrane and hydrolyzing stable membrane lipids. The products of the hydrolysis cannot form bilayers leading to a change in membrane conformation and ultimately to a block in the release of neurotransmitters. PLA2 may form dimers or oligomers. Bee venom PLA2 has fewer conserved disulfide bridges than most canonical PLA2s.
Probab=98.72  E-value=6.5e-09  Score=72.14  Aligned_cols=62  Identities=26%  Similarity=0.577  Sum_probs=47.0

Q ss_pred             CCCCCCCCC-cc-----cCCCchhhhhhhhhhcCCCCCCCCCceeeEEEEeCCceeeCCCCchhhhhchhhHHHHHHhCc
Q psy12201         19 YCGFLGSGY-PV-----DPIDRCCELHDWCYTGSNCPLFLEYFIPYVWTCFRGRPLCQRGKSCSHRLCECDRRFSECLRP   92 (116)
Q Consensus        19 ~Cg~~G~G~-Pv-----D~iD~cC~~hd~CY~~~~C~~~~~~~~~Y~~~~~~~~i~C~~~~~C~r~lCeCDk~~A~cl~~   92 (116)
                      |||.|.... +.     .++|+||++||.|+.-+.  +.     .|+|..       .+.....+..|+||++|+.||++
T Consensus         8 WCG~Gn~a~~~~dlG~~~~tD~CCr~HD~C~~~i~--~~-----~~kyg~-------~N~~~~t~~~C~CD~~f~~CL~~   73 (97)
T cd04704           8 WCGPGNIATNYSDLGAFRETDKCCREHDHCPDIIS--AG-----EYKYGL-------TNTRLFTRSHCDCDNRFRQCLKN   73 (97)
T ss_pred             ecCCCCCCCCcccccCccccchHHHccccCcCccc--cc-----ccccCc-------cCCCccccccCcHHHHHHHHHHH
Confidence            888887664 44     689999999999997763  11     233332       14578899999999999999998


Q ss_pred             CC
Q psy12201         93 YS   94 (116)
Q Consensus        93 ~~   94 (116)
                      ..
T Consensus        74 ~~   75 (97)
T cd04704          74 VN   75 (97)
T ss_pred             cC
Confidence            65


No 9  
>PF05826 Phospholip_A2_2:  Phospholipase A2;  InterPro: IPR001211 Phospholipase A2 (3.1.1.4 from EC) (PLA2) is a small lipolytic enzyme that releases fatty acids from the second carbon group of glycerol. It is involved in a number of physiologically important cellular processes, such as the liberation of arachidonic acid from membrane phospholipids []. It plays a pivotal role in the biosynthesis of prostaglandin and other mediators of inflammation. PLA2 has four to seven disulphide bonds and binds a calcium ion that is essential for activity. Within the active enzyme, the alpha amino group is involved in a conserved hydrogen-bonding network linking the N-terminal region to the active site. The side chains of two conserved residues, His and Asp, participate in the catalytic network. Many PLA2's are widely distributed in snakes, lizards, bees and mammals. In mammals there are at least four forms: pancreatic, membrane-associated as well as two less well characterised forms. The venom of most snakes contains multiple forms of PLA2. Some of them are presynaptic neurotoxins which inhibit neuromuscular transmission by blocking acetylcholine release from the nerve termini. Some of the proteins in this family are allergens. Allergies are hypersensitivity reactions of the immune system to specific substances called allergens (such as pollen, stings, drugs, or food) that, in most people, result in no symptoms. A nomenclature system has been established for antigens (allergens) that cause IgE-mediated atopic allergies in humans [WHO/IUIS Allergen Nomenclature Subcommittee King T.P., Hoffmann D., Loewenstein H., Marsh D.G., Platts-Mills T.A.E., Thomas W. Bull. World Health Organ. 72:797-806(1994)]. This nomenclature system is defined by a designation that is composed of the first three letters of the genus; a space; the first letter of the species name; a space and an arabic number. In the event that two species names have identical designations, they are discriminated from one another by adding one or more letters (as necessary) to each species designation.  The allergens in this family include allergens with the following designations: Api m 1.; GO: 0004623 phospholipase A2 activity, 0005509 calcium ion binding, 0016042 lipid catabolic process; PDB: 1POC_A.
Probab=97.24  E-value=0.00011  Score=51.07  Aligned_cols=61  Identities=28%  Similarity=0.556  Sum_probs=35.2

Q ss_pred             CCCCCCCCC------cccCCCchhhhhhhhhhcCCCCCCCCCceeeEEEEeCCceeeCCCCchhhhhchhhHHHHHHhCc
Q psy12201         19 YCGFLGSGY------PVDPIDRCCELHDWCYTGSNCPLFLEYFIPYVWTCFRGRPLCQRGKSCSHRLCECDRRFSECLRP   92 (116)
Q Consensus        19 ~Cg~~G~G~------PvD~iD~cC~~hd~CY~~~~C~~~~~~~~~Y~~~~~~~~i~C~~~~~C~r~lCeCDk~~A~cl~~   92 (116)
                      |||.|..-.      .--++|+||++||.|..-+.  +.   ...|..  .+       ...=-..-|+||++|..||++
T Consensus         7 WCG~gn~a~~~~dlG~~~~tD~CCR~HD~C~~~I~--~~---~~k~gl--~N-------~~~~T~~hC~Cd~~f~~CL~~   72 (99)
T PF05826_consen    7 WCGPGNIAKNYSDLGEFKETDRCCREHDHCPDKIP--PG---ETKYGL--HN-------PRPFTISHCDCDSRFYQCLKN   72 (99)
T ss_dssp             SSBSS---SSTT---SSHHHHHHHHHHHT-SSEE---TT----EETTE--E---------SSS-EEBHHHHHHHHHHHHT
T ss_pred             ccCCCCCccCcccccccHHHHHHHHhhccCCCccC--CC---cccccc--cc-------CCcCceeecCcccHHHHHHHH
Confidence            777763311      12468999999999986553  11   112222  11       122235689999999999998


Q ss_pred             C
Q psy12201         93 Y   93 (116)
Q Consensus        93 ~   93 (116)
                      .
T Consensus        73 ~   73 (99)
T PF05826_consen   73 V   73 (99)
T ss_dssp             S
T ss_pred             c
Confidence            4


No 10 
>PF08398 Parvo_coat_N:  Parvovirus coat protein VP1;  InterPro: IPR013607 Parvoviruses are some of the smallest viruses containing linear, non-segmented single-stranded DNA genomes, with an average genome size of 5000 nucleotides. Parvoviruses have been described that infect a wide range of invertebrates and vertebrates and are well known for causing enteric disease in mammals. Genomes contains two large ORFs: NS1 and VP1; other ORFs are found in some sub-types and different gene products can arise from splice variants and the use of different start codons [].  This is the N-terminal region of the Parvovirus VP1 coat protein []; its function is not known. ; GO: 0005198 structural molecule activity, 0019028 viral capsid
Probab=95.90  E-value=0.0026  Score=41.31  Aligned_cols=37  Identities=30%  Similarity=0.348  Sum_probs=28.3

Q ss_pred             CCCCC---CCCCcccCCCchhhhhhhhhhcCCCCCCCCCc
Q psy12201         19 YCGFL---GSGYPVDPIDRCCELHDWCYTGSNCPLFLEYF   55 (116)
Q Consensus        19 ~Cg~~---G~G~PvD~iD~cC~~hd~CY~~~~C~~~~~~~   55 (116)
                      |.|+|   -.|.||+.+|+.+++||..|....-...+||+
T Consensus         6 YlGPgn~l~~g~Pv~~~D~aA~~HD~aY~~~lk~G~NPY~   45 (64)
T PF08398_consen    6 YLGPGNPLDNGEPVNPVDAAAREHDEAYDELLKHGDNPYL   45 (64)
T ss_pred             ccCCCCCcCCCCCCCHHHHHHHHHHHHHHHHHHcCCCCce
Confidence            45554   46899999999999999999998444445543


No 11 
>cd04705 PLA2_group_III_like PLA2_group_III_like: A sub-family of  Phospholipase A2, similar to human group III PLA2. PLA2 is a super-family of secretory and cytosolic enzymes; the latter are either Ca dependent or Ca independent. Enzymatically active PLA2 cleaves the sn-2 position of the glycerol backbone of phospholipids; secreted PLA2s have also been found to specifically bind to a variety of soluble and membrane proteins in mammals, including receptors. As a toxin, PLA2 is a potent presynaptic neurotoxin which blocks nerve terminals by binding to the nerve membrane and hydrolyzing stable membrane lipids. The products of the hydrolysis cannot form bilayers leading to a change in membrane conformation and ultimately to a block in the release of neurotransmitters. PLA2 may form dimers or oligomers.
Probab=95.77  E-value=0.0054  Score=42.96  Aligned_cols=50  Identities=32%  Similarity=0.473  Sum_probs=32.7

Q ss_pred             CCCchhhhhhhhhhcCCCCCCCCCceeeEEEEeCCceeeCCCCchhhhhchhhHHHHHHhCcCC
Q psy12201         31 PIDRCCELHDWCYTGSNCPLFLEYFIPYVWTCFRGRPLCQRGKSCSHRLCECDRRFSECLRPYS   94 (116)
Q Consensus        31 ~iD~cC~~hd~CY~~~~C~~~~~~~~~Y~~~~~~~~i~C~~~~~C~r~lCeCDk~~A~cl~~~~   94 (116)
                      ++|+||+.||.|-.-+.     +....|.  ..+       ...=...-|+||++|..||+...
T Consensus        33 ~~DrCCR~HD~Cp~~I~-----~~~~k~g--l~N-------~~~~tisHCdCD~rf~~CL~~~n   82 (100)
T cd04705          33 EPDRCCWKHKQCPGHII-----PPFSSDG--HHN-------FHLHSVSHCDCDSRLKDCLRLSS   82 (100)
T ss_pred             chhhhhhhhhcCccccC-----Ccccccc--eec-------CCCcccccccHHHHHHHHHHHcC
Confidence            58999999999866552     1111222  211       12223567999999999999864


No 12 
>PF06951 PLA2G12:  Group XII secretory phospholipase A2 precursor (PLA2G12);  InterPro: IPR010711 This family consists of several group XII secretory phospholipase A2 precursor (PLA2G12) (3.1.1.4 from EC) proteins. Group XII and group V PLA(2)s are thought to participate in helper T cell immune response through release of immediate second signals and generation of downstream eicosanoids [].; GO: 0004623 phospholipase A2 activity, 0005509 calcium ion binding, 0016042 lipid catabolic process, 0005576 extracellular region
Probab=55.65  E-value=7.4  Score=30.00  Aligned_cols=21  Identities=38%  Similarity=1.062  Sum_probs=15.9

Q ss_pred             CCCccc----CCCchhhhhhhhhhc
Q psy12201         25 SGYPVD----PIDRCCELHDWCYTG   45 (116)
Q Consensus        25 ~G~PvD----~iD~cC~~hd~CY~~   45 (116)
                      .|.++|    +.=.||-.||.||+-
T Consensus        87 ~G~~~d~~iP~~t~CCn~HDiCYdT  111 (184)
T PF06951_consen   87 LGLQIDIGIPAMTKCCNQHDICYDT  111 (184)
T ss_pred             cCCcccCCCCchhccchhhhhHHHc
Confidence            455555    367899999999983


No 13 
>PF14703 DUF4463:  Domain of unknown function (DUF4463)
Probab=32.75  E-value=18  Score=23.09  Aligned_cols=21  Identities=38%  Similarity=0.583  Sum_probs=16.2

Q ss_pred             CCCCCCCCCcccCCCchhhhhh
Q psy12201         19 YCGFLGSGYPVDPIDRCCELHD   40 (116)
Q Consensus        19 ~Cg~~G~G~PvD~iD~cC~~hd   40 (116)
                      ++|+.| |.-||+||+.-.+..
T Consensus        62 ~~~~~g-~~kVDaIdyy~~el~   82 (85)
T PF14703_consen   62 FLGLFG-GKKVDAIDYYREELK   82 (85)
T ss_pred             cCCCCC-CCcchHHHHHHHHHH
Confidence            556667 899999999876543


Done!