Diaphorina citri psyllid: psy12201

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110------

MVSCSTGCDPLSYKGYGCYCGFLGSGYPVDPIDRCCELHDWCYTGSNCPLFLEYFIPYVWTCFRGRPLCQRGKSCSHRLCECDRRFSECLRPYSCPRYKAVCRSNVFRLMQNLILI

cccccccccccccccccccccccccccccccccHHHHHccccccccccccccccEEcEEEEECccEEEEcccccccHHHcHHHHHHHHHHccccccccccccccccEEEcccEEcc

MVSC*TGCDPLSYKGYGCYCGFLGSGYPVDPIDRCCELHDWCYTGSNCPLFLEYFIPYVWTCFRGRPLCQRGKSCSHRLCECDRRFSECLRPYSCPRYKAVCRSNVFRLMQNLILI

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MVSCSTGCDPLSYKGYGCYCGFLGSGYPVDPIDRCCELHDWCYTGSNCPLFLEYFIPYVWTCFRGRPLCQRGKSCSHRLCECDRRFSECLRPYSCPRYKAVCRSNVFRLMQNLILI

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Phospholipase A2	PA2 catalyzes the calcium-dependent hydrolysis of the 2-acyl groups in 3-sn-phosphoglycerides.	confident	P04055
Phospholipase A2	PA2 catalyzes the calcium-dependent hydrolysis of the 2-acyl groups in 3-sn-phosphoglycerides.	confident	P04054
Phospholipase A2	PA2 catalyzes the calcium-dependent hydrolysis of the 2-acyl groups in 3-sn-phosphoglycerides.	confident	P43434

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0051715 [BP]	cytolysis in other organism	probable	GO:0044364, GO:0031640, GO:0008150, GO:0065007, GO:0001906, GO:0065008, GO:0035821, GO:0051704
GO:0009395 [BP]	phospholipid catabolic process	probable	GO:0044238, GO:0006644, GO:0046434, GO:0009987, GO:1901575, GO:0044237, GO:0016042, GO:0044248, GO:0071704, GO:0006796, GO:0044710, GO:0008150, GO:0008152, GO:0006793, GO:0019637, GO:0044242, GO:0009056, GO:0044255, GO:0006629
GO:0005509 [MF]	calcium ion binding	probable	GO:0043169, GO:0046872, GO:0003674, GO:0005488, GO:0043167
GO:0005615 [CC]	extracellular space	probable	GO:0005575, GO:0005576, GO:0044421
GO:0009405 [BP]	pathogenesis	probable	GO:0008150, GO:0051704
GO:0047498 [MF]	calcium-dependent phospholipase A2 activity	probable	GO:0016787, GO:0016788, GO:0003824, GO:0003674, GO:0052689, GO:0004623, GO:0004620, GO:0016298
GO:0030593 [BP]	neutrophil chemotaxis	probable	GO:0006928, GO:0050900, GO:0051674, GO:0070887, GO:0060326, GO:0044699, GO:0051716, GO:0042330, GO:0071621, GO:0030595, GO:0006935, GO:0009987, GO:0044763, GO:0042221, GO:0051179, GO:0040011, GO:0016477, GO:0009605, GO:0048870, GO:0050896, GO:0002376, GO:0008150
GO:0050778 [BP]	positive regulation of immune response	probable	GO:0050776, GO:0048584, GO:0048583, GO:0008150, GO:0002684, GO:0002682, GO:0048518, GO:0065007, GO:0050789
GO:0048146 [BP]	positive regulation of fibroblast proliferation	probable	GO:0008284, GO:0042127, GO:0048145, GO:0050794, GO:0065007, GO:0048518, GO:0008150, GO:0050789, GO:0048522
GO:0045740 [BP]	positive regulation of DNA replication	probable	GO:0009893, GO:0019222, GO:0009891, GO:0031326, GO:0031325, GO:0031323, GO:0050789, GO:0080090, GO:0010604, GO:0031328, GO:2000112, GO:0019219, GO:0065007, GO:0048518, GO:0051054, GO:0045935, GO:0051052, GO:0060255, GO:0009889, GO:0050794, GO:0008150, GO:0051171, GO:0051173, GO:0006275, GO:0010557, GO:0010556, GO:0048522
GO:0036148 [BP]	phosphatidylglycerol acyl-chain remodeling	probable	GO:0044238, GO:0006644, GO:0006650, GO:0009987, GO:0044710, GO:0044237, GO:0071704, GO:0006796, GO:0008150, GO:0008152, GO:0006793, GO:0019637, GO:0046486, GO:0046471, GO:0044255, GO:0006629
GO:0036149 [BP]	phosphatidylinositol acyl-chain remodeling	probable	GO:0044238, GO:0006644, GO:0006650, GO:0009987, GO:0044710, GO:0044237, GO:0071704, GO:0006796, GO:0046488, GO:0008152, GO:0006793, GO:0019637, GO:0008150, GO:0046486, GO:0044255, GO:0006629
GO:0005543 [MF]	phospholipid binding	probable	GO:0043168, GO:0043167, GO:0003674, GO:0008289, GO:0005488
GO:0010524 [BP]	positive regulation of calcium ion transport into cytosol	probable	GO:0010959, GO:0032879, GO:0032388, GO:0051050, GO:0060341, GO:0051928, GO:0051049, GO:0032386, GO:0051924, GO:0032846, GO:0050794, GO:0043270, GO:2000021, GO:0065007, GO:0043269, GO:0048518, GO:0008150, GO:0032844, GO:0050789, GO:0010522, GO:0048522
GO:0007243 [BP]	intracellular protein kinase cascade	probable	GO:0044700, GO:0051716, GO:0050896, GO:0009987, GO:0050794, GO:0008150, GO:0065007, GO:0044763, GO:0007165, GO:0023052, GO:0007154, GO:0035556, GO:0050789, GO:0044699
GO:0050829 [BP]	defense response to Gram-negative bacterium	probable	GO:0009607, GO:0050896, GO:0009617, GO:0006952, GO:0006950, GO:0008150, GO:0042742, GO:0051707, GO:0051704
GO:0030141 [CC]	secretory granule	probable	GO:0005737, GO:0031982, GO:0016023, GO:0031410, GO:0044464, GO:0044444, GO:0005623, GO:0031988, GO:0005575, GO:0043229, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0043231
GO:0044398 [BP]	envenomation resulting in induction of edema in other organism	probable	GO:0050896, GO:0007610, GO:0008150, GO:0035737, GO:0035738, GO:0051705, GO:0051704
GO:0032612 [BP]	interleukin-1 production	probable	GO:0001816, GO:0032501, GO:0008150, GO:0044699, GO:0044707
GO:0045932 [BP]	negative regulation of muscle contraction	probable	GO:0044057, GO:0006937, GO:0051241, GO:0008150, GO:0065007, GO:0090257, GO:0051239, GO:0048519, GO:0050789
GO:0036151 [BP]	phosphatidylcholine acyl-chain remodeling	probable	GO:0006650, GO:0034641, GO:0006807, GO:0044281, GO:0044255, GO:0044710, GO:0071704, GO:0006644, GO:0006629, GO:0009308, GO:0009987, GO:0044106, GO:0042439, GO:0008152, GO:0046486, GO:0044238, GO:1901564, GO:0006576, GO:0044237, GO:0006066, GO:0006796, GO:0006793, GO:0019637, GO:0008150, GO:0046470, GO:1901615
GO:0036150 [BP]	phosphatidylserine acyl-chain remodeling	probable	GO:0006650, GO:0006658, GO:0019752, GO:0006807, GO:0044281, GO:0044255, GO:0044710, GO:0006520, GO:0071704, GO:0006644, GO:0006629, GO:0009987, GO:0008150, GO:0008152, GO:0043436, GO:0046486, GO:0006575, GO:0044238, GO:1901564, GO:0052646, GO:0006082, GO:1901135, GO:0044237, GO:0006796, GO:0006793, GO:0019637
GO:0036152 [BP]	phosphatidylethanolamine acyl-chain remodeling	probable	GO:0006650, GO:0034641, GO:0006807, GO:0044281, GO:0044255, GO:0044710, GO:0071704, GO:0006644, GO:0006629, GO:0009308, GO:0009987, GO:0044106, GO:0042439, GO:0008152, GO:0046486, GO:0044238, GO:1901564, GO:0006576, GO:0044237, GO:0006066, GO:0006796, GO:0006793, GO:0019637, GO:0008150, GO:0046470, GO:1901615
GO:0005783 [CC]	endoplasmic reticulum	probable	GO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0045919 [BP]	positive regulation of cytolysis	probable	GO:0042268, GO:0050794, GO:0048518, GO:0065007, GO:0010942, GO:0008150, GO:0010941, GO:0050789, GO:0048522
GO:0044522 [BP]	envenomation resulting in myocyte killing in other organism	probable	GO:0050896, GO:0007610, GO:0035738, GO:0008150, GO:0035737, GO:0044521, GO:0051705, GO:0051704
GO:0006654 [BP]	phosphatidic acid biosynthetic process	probable	GO:0006650, GO:0044249, GO:0044255, GO:0045017, GO:0044710, GO:0071704, GO:0006644, GO:0006629, GO:1901576, GO:0009987, GO:0009058, GO:0008150, GO:0008152, GO:0046486, GO:0090407, GO:0008610, GO:0044238, GO:0008654, GO:0044237, GO:0006796, GO:0006793, GO:0019637, GO:0046474, GO:0046473
GO:0009986 [CC]	cell surface	probable	GO:0005575, GO:0044464, GO:0005623
GO:0032052 [MF]	bile acid binding	probable	GO:0043168, GO:0097159, GO:0031406, GO:0008289, GO:0043167, GO:0003674, GO:0005488, GO:0005496, GO:0033293
GO:0032869 [BP]	cellular response to insulin stimulus	probable	GO:0070887, GO:0032868, GO:0044699, GO:0009719, GO:0051716, GO:0071375, GO:0071417, GO:0071310, GO:0071495, GO:0009987, GO:0032870, GO:0044763, GO:0010243, GO:0042221, GO:0043434, GO:0010033, GO:1901700, GO:1901701, GO:0009725, GO:0050896, GO:1901699, GO:1901652, GO:1901653, GO:0008150, GO:1901698
GO:0015758 [BP]	glucose transport	probable	GO:0008645, GO:0006810, GO:0008643, GO:0044765, GO:0008150, GO:0015749, GO:0071702, GO:0051234, GO:0051179, GO:0044699
GO:0050482 [BP]	arachidonic acid secretion	probable	GO:0006869, GO:0046717, GO:0006820, GO:0015718, GO:0044699, GO:1901571, GO:0071702, GO:0033036, GO:0015909, GO:0015908, GO:0015849, GO:0006811, GO:0006810, GO:0015711, GO:0044765, GO:0008150, GO:0051234, GO:0010876, GO:0051179, GO:0046942, GO:0046903, GO:0071715, GO:0032309
GO:0005794 [CC]	Golgi apparatus	probable	GO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0016043 [BP]	cellular component organization	probable	GO:0008150, GO:0071840
GO:0048471 [CC]	perinuclear region of cytoplasm	probable	GO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0043498 [MF]	cell surface binding	probable
GO:0044240 [BP]	multicellular organismal lipid catabolic process	probable	GO:0044238, GO:1901575, GO:0032501, GO:0006629, GO:0044707, GO:0007586, GO:0044710, GO:0044236, GO:0071704, GO:0008150, GO:0008152, GO:0044241, GO:0044243, GO:0009056, GO:0016042, GO:0044699
GO:0006663 [BP]	platelet activating factor biosynthetic process	probable	GO:0006650, GO:0044249, GO:0034641, GO:0006807, GO:0044281, GO:0044283, GO:0044255, GO:1901576, GO:0044710, GO:0044711, GO:0008150, GO:0071704, GO:0046469, GO:0006644, GO:0006629, GO:0009308, GO:0045017, GO:0046165, GO:0009987, GO:0044106, GO:0009058, GO:0042439, GO:0008152, GO:0046486, GO:0090407, GO:0008610, GO:0044238, GO:1901564, GO:0006576, GO:1901566, GO:0008654, GO:0044237, GO:0006066, GO:0006796, GO:0006793, GO:0019637, GO:0046474, GO:1901617, GO:1901615
GO:0008201 [MF]	heparin binding	probable	GO:0043168, GO:1901681, GO:0097367, GO:0043167, GO:0005539, GO:0003674, GO:0005488
GO:0051092 [BP]	positive regulation of NF-kappaB transcription factor activity	probable	GO:0080090, GO:0019222, GO:0031326, GO:0031323, GO:0050789, GO:2000112, GO:0060255, GO:0065007, GO:0044093, GO:0065009, GO:0010468, GO:0019219, GO:0009889, GO:0050794, GO:0008150, GO:0051171, GO:2001141, GO:0051091, GO:0051090, GO:0051252, GO:0006355, GO:0010556
GO:0045944 [BP]	positive regulation of transcription from RNA polymerase II promoter	probable	GO:0009893, GO:0019222, GO:0031328, GO:0031326, GO:0031325, GO:2001141, GO:0031323, GO:0010628, GO:0050789, GO:0080090, GO:0010604, GO:0051171, GO:0009891, GO:2000112, GO:0019219, GO:0010556, GO:0065007, GO:0048518, GO:0010468, GO:0045935, GO:0060255, GO:0009889, GO:0050794, GO:0008150, GO:0045893, GO:0051173, GO:0051252, GO:0051254, GO:0006355, GO:0010557, GO:0006357, GO:0048522
GO:0000187 [BP]	activation of MAPK activity	probable	GO:0019220, GO:0009893, GO:0019222, GO:0033674, GO:0031325, GO:0048584, GO:0048583, GO:0032147, GO:0023056, GO:0043406, GO:0043405, GO:0023051, GO:0071902, GO:0010647, GO:0071900, GO:0010627, GO:0050789, GO:0043085, GO:0043408, GO:0010646, GO:0051347, GO:0010604, GO:0009966, GO:0009967, GO:0010562, GO:0043549, GO:0051246, GO:0051247, GO:0032270, GO:0044093, GO:0031399, GO:0048518, GO:0065007, GO:0065009, GO:0010740, GO:0050790, GO:0045937, GO:0060255, GO:0031323, GO:0045859, GO:0080090, GO:0050794, GO:0043410, GO:0032268, GO:0008150, GO:0042325, GO:0051174, GO:0042327, GO:0045860, GO:0031401, GO:0051338, GO:0001932, GO:0001934, GO:0048522
GO:0035899 [BP]	negative regulation of blood coagulation in other organism	probable	GO:0032101, GO:0050818, GO:0080134, GO:0051241, GO:0048583, GO:1900046, GO:0050819, GO:0065007, GO:0050789, GO:0061041, GO:1900047, GO:0008150, GO:0051239, GO:0030193, GO:0048519, GO:0065008, GO:0035806, GO:0035821, GO:0030195, GO:0051704
GO:0019370 [BP]	leukotriene biosynthetic process	probable	GO:0006633, GO:0006631, GO:0006636, GO:0019752, GO:0044249, GO:0044281, GO:0044283, GO:0072330, GO:1901576, GO:0044710, GO:0044711, GO:1901570, GO:0071704, GO:0046456, GO:0006629, GO:0009987, GO:0032787, GO:0009058, GO:0008150, GO:0008152, GO:0043436, GO:1901568, GO:0044255, GO:0008610, GO:0044238, GO:0006082, GO:0046394, GO:0016053, GO:0044237, GO:0006691, GO:0006690, GO:0033559
GO:0032637 [BP]	interleukin-8 production	probable	GO:0001816, GO:0032501, GO:0008150, GO:0044699, GO:0044707
GO:0005886 [CC]	plasma membrane	probable	GO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623
GO:0002446 [BP]	neutrophil mediated immunity	probable	GO:0002376, GO:0008150, GO:0002443, GO:0002444, GO:0002252

Prediction of Enzyme Commission Number

EC Number	Description	Confidence Level
3.-.-.-	Hydrolases.	probable
3.1.-.-	Acting on ester bonds.	probable
3.1.1.-	Carboxylic ester hydrolases.	probable
3.1.1.4	1-alkenylglycerophosphocholine O-acyltransferase.	probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1P7O, chain A
Confidence level:very confident
Coverage over the Query: 1-104
View the alignment between query and template
View the model in PyMOL