Query         psy12202
Match_columns 157
No_of_seqs    123 out of 740
Neff          4.7 
Searched_HMMs 46136
Date          Fri Aug 16 21:27:05 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy12202.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/12202hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 cd00125 PLA2c PLA2c: Phospholi 100.0   8E-40 1.7E-44  247.6   6.2  106    6-140     1-107 (115)
  2 cd04707 otoconin_90 otoconin_9 100.0 3.8E-38 8.2E-43  239.4   6.5  103    9-141     1-105 (117)
  3 KOG4087|consensus              100.0 5.8E-37 1.3E-41  239.0   7.3  109    4-141    19-129 (144)
  4 PF00068 Phospholip_A2_1:  Phos 100.0 2.1E-35 4.6E-40  222.4   4.9  109    6-144     1-111 (116)
  5 smart00085 PA2c Phospholipase  100.0 7.6E-35 1.6E-39  220.3   7.4  106    6-140     1-108 (117)
  6 cd00618 PLA2_like PLA2_like: P  99.9 2.6E-22 5.7E-27  141.1   5.5   78   26-134     1-83  (83)
  7 cd04706 PLA2_plant PLA2_plant:  99.2 4.5E-12 9.7E-17   96.8   0.3   35   23-62     19-57  (117)
  8 cd04704 PLA2_bee_venom_like PL  98.5 3.7E-08   8E-13   72.8   1.4   62   31-135     8-75  (97)
  9 PF05826 Phospholip_A2_2:  Phos  96.9 0.00015 3.2E-09   53.7  -1.1   19  117-135    56-74  (99)
 10 PF08398 Parvo_coat_N:  Parvovi  96.6  0.0011 2.4E-08   46.0   1.4   39   31-74      6-47  (64)
 11 cd04705 PLA2_group_III_like PL  94.0   0.023 4.9E-07   42.6   0.9   21  117-137    64-84  (100)
 12 PF06951 PLA2G12:  Group XII se  28.6      36 0.00077   28.1   1.6   21   38-63     88-112 (184)
 13 PF14703 DUF4463:  Domain of un  28.3      18 0.00038   24.7  -0.2   20   30-50     61-80  (85)

No 1  
>cd00125 PLA2c PLA2c: Phospholipase A2, a family of secretory and cytosolic enzymes; the latter are either Ca dependent or Ca independent. PLA2 cleaves the sn-2 position of the glycerol backbone of phospholipids (PC or phosphatidylethanolamine), usually in a metal-dependent reaction, to generate lysophospholipid (LysoPL) and a free fatty acid (FA). The resulting products are either dietary or used in synthetic pathways for leukotrienes and prostaglandins. Often, arachidonic acid is released as a free fatty acid and acts as second messenger in signaling networks. Secreted PLA2s have also been found to specifically bind to a variety of soluble and membrane proteins in mammals, including receptors. As a toxin, PLA2 is a potent presynaptic neurotoxin which blocks nerve terminals by binding to the nerve membrane and hydrolyzing stable membrane lipids. The products of the hydrolysis (LysoPL and FA) cannot form bilayers leading to a change in membrane conformation and ultimately to a block in 
Probab=100.00  E-value=8e-40  Score=247.63  Aligned_cols=106  Identities=37%  Similarity=0.660  Sum_probs=98.0

Q ss_pred             cHHHHHHHHhhhcCCCcccccCCccccCCCCCCCCcCccCCccccccccchhhHHhhhhhcccCCc-ceeeEEeecCCcc
Q psy12202          6 SAVQLYSMVSCSTGCDPLSYKGYGCYCGFLGSGYPVDPIDRTSQLNMARDHDSGHEIYIIFIYSGV-VSYTTGAIQGPTV   84 (157)
Q Consensus         6 ~l~qf~~Mi~c~tg~~~l~Y~~YGCyCg~gG~G~PVD~iDrcC~~~~~~~Hd~CY~~~~~~~c~~~-~~Y~~~~~~~~~~   84 (157)
                      +|+||++||+|+||++|++|++||||||+||+|+|||+|||||+.     ||.||+.+....|.|+ .+|+|++.++   
T Consensus         1 ~l~qf~~MI~c~tgr~~~~Y~~YGCyCG~GG~G~PvD~~DrCC~~-----HD~CY~~~~~~~C~p~~~~Y~y~~~~~---   72 (115)
T cd00125           1 NLLQFGKMIKCTTGRSALDYNGYGCYCGLGGSGTPVDDTDRCCQV-----HDCCYDRAEKGGCSPYFTSYSYTCSDG---   72 (115)
T ss_pred             CHHHHHHHHHHhcCCCHHHHhhcCCccCCCCCCCCcccHHHHHHH-----HHhHHhccccCCCccccccceEEEECC---
Confidence            589999999999999999999999999999999999999999999     9999999976778887 9999999877   


Q ss_pred             cccCCCCCceeCCCCCCCCceeeccCCCCChhhhhhchhhHHHHHHhccCCCCCCc
Q psy12202         85 LSFSNISSPTCGPASEDGPYVVSKASKRGKSCSHRLCECDRRFSECLRPYSCPKYK  140 (157)
Q Consensus        85 ~s~~~~~~i~C~~~~~~~~~~~~~~~~~~~~C~~~lCeCDr~~A~C~~~~~~~~~~  140 (157)
                             .|+|.              +..++|+++||||||++|+||++++|+.+.
T Consensus        73 -------~i~C~--------------~~~~~C~~~~CeCDr~aa~Cf~~~~yn~~~  107 (115)
T cd00125          73 -------QITCS--------------DANDKCARALCECDRAAALCFARAPYNPKY  107 (115)
T ss_pred             -------cceEC--------------cCCChHhHHHhHccHHHHHHHhhCcCChhh
Confidence                   89994              456899999999999999999999987653


No 2  
>cd04707 otoconin_90 otoconin_90: Phospholipase A2-like domains present in otoconin-90 and otoconin-95, mammal proteins that are principal matrix proteins of calcitic otoconia. Interactions involving otoconin-90 may trigger or constitute key events in otoconia formation. The PLA2-like domains in otoconins may have lost their metal-binding sites.
Probab=100.00  E-value=3.8e-38  Score=239.39  Aligned_cols=103  Identities=31%  Similarity=0.574  Sum_probs=92.9

Q ss_pred             HHHHHHhhhcCCCcccccCCccccCCCCCCCCcCccCCccccccccchhhHHhhhhhcccCC--cceeeEEeecCCcccc
Q psy12202          9 QLYSMVSCSTGCDPLSYKGYGCYCGFLGSGYPVDPIDRTSQLNMARDHDSGHEIYIIFIYSG--VVSYTTGAIQGPTVLS   86 (157)
Q Consensus         9 qf~~Mi~c~tg~~~l~Y~~YGCyCg~gG~G~PVD~iDrcC~~~~~~~Hd~CY~~~~~~~c~~--~~~Y~~~~~~~~~~~s   86 (157)
                      ||+.||+|+||+++++|++||||||+||+|+|||+|||||+.     ||.||+.++...|.+  +..|+|++.++     
T Consensus         1 qf~~MI~c~tgr~~~~Y~~YGCyCG~GG~G~PvD~~DrCC~~-----HD~CY~~~~~~~C~~~~~~~Y~y~c~~~-----   70 (117)
T cd04707           1 QLGEMLKCLTGRCPREFEDYGCYCGQEGEGLPVDELDRCCFQ-----HRCCLEQASEMGCLQDRKLSTEVTCVDH-----   70 (117)
T ss_pred             CHHHHHhhhcCCCHHHHcccCCcccCCCCCCCcccchhHHHH-----hHHHHhhhhhcCCCCCCCcceEEEEECC-----
Confidence            799999999999999999999999999999999999999999     999999998666743  47899999877     


Q ss_pred             cCCCCCceeCCCCCCCCceeeccCCCCChhhhhhchhhHHHHHHhccCCCCCCcc
Q psy12202         87 FSNISSPTCGPASEDGPYVVSKASKRGKSCSHRLCECDRRFSECLRPYSCPKYKA  141 (157)
Q Consensus        87 ~~~~~~i~C~~~~~~~~~~~~~~~~~~~~C~~~lCeCDr~~A~C~~~~~~~~~~~  141 (157)
                           .|+|               +..++|+++||||||++|+||++++|+.+..
T Consensus        71 -----~i~C---------------~~~~~C~~~vCeCDk~aa~Cf~~~~Yn~~~~  105 (117)
T cd04707          71 -----KPKC---------------EGVSVCEKLLCTCDKTAAECMAAAHFNSSLN  105 (117)
T ss_pred             -----cccc---------------CCCChHHHHHhhccHHHHHHhccCCCCHhhc
Confidence                 8999               3457899999999999999999999887544


No 3  
>KOG4087|consensus
Probab=100.00  E-value=5.8e-37  Score=238.97  Aligned_cols=109  Identities=35%  Similarity=0.631  Sum_probs=101.3

Q ss_pred             CccHHHHHHHHhhhcCCC-cccccCCccccCCCCCCCCcCccCCccccccccchhhHHhhhhhcccCCc-ceeeEEeecC
Q psy12202          4 KRSAVQLYSMVSCSTGCD-PLSYKGYGCYCGFLGSGYPVDPIDRTSQLNMARDHDSGHEIYIIFIYSGV-VSYTTGAIQG   81 (157)
Q Consensus         4 ~R~l~qf~~Mi~c~tg~~-~l~Y~~YGCyCg~gG~G~PVD~iDrcC~~~~~~~Hd~CY~~~~~~~c~~~-~~Y~~~~~~~   81 (157)
                      .++|+||.+||+++|+.+ ++.|++||||||+||+|+|+|+|||||+.     ||.||+.+....|+++ ..|+|++.++
T Consensus        19 ~g~l~~l~~Mi~~vt~~~~~l~Y~~YGCyCGlGG~G~P~D~iDwCC~~-----HDcCY~~le~~gC~py~~~Ys~sc~n~   93 (144)
T KOG4087|consen   19 HGALLNLKKMIECVTGKSAALSYNKYGCYCGLGGSGQPKDAIDWCCHA-----HDCCYDRLEEKGCSPYTERYSWSCSNQ   93 (144)
T ss_pred             chHHHHHHHHHHHHcCCCccceecCccccccCCCCCCccchHHHHHhc-----ccHHHHHHHHcCCCccccceeeEeeCC
Confidence            458999999999999998 67999999999999999999999999999     9999999998889998 8999999988


Q ss_pred             CcccccCCCCCceeCCCCCCCCceeeccCCCCChhhhhhchhhHHHHHHhccCCCCCCcc
Q psy12202         82 PTVLSFSNISSPTCGPASEDGPYVVSKASKRGKSCSHRLCECDRRFSECLRPYSCPKYKA  141 (157)
Q Consensus        82 ~~~~s~~~~~~i~C~~~~~~~~~~~~~~~~~~~~C~~~lCeCDr~~A~C~~~~~~~~~~~  141 (157)
                                .|+|+              +.+.+|+.+||||||++|+||++.+||++..
T Consensus        94 ----------~I~Cs--------------~~~~~C~~~lC~CDk~~a~C~~r~~yn~ky~  129 (144)
T KOG4087|consen   94 ----------SITCS--------------DKNTECEAQLCECDKKAAECLKRTTYNKKYK  129 (144)
T ss_pred             ----------eEEeC--------------CCccHHHHHHhhhhhHHHHHHhcCccchhhc
Confidence                      99994              5578999999999999999999999988654


No 4  
>PF00068 Phospholip_A2_1:  Phospholipase A2;  InterPro: IPR001211 Phospholipase A2 (3.1.1.4 from EC) (PLA2) is a small lipolytic enzyme that releases fatty acids from the second carbon group of glycerol. It is involved in a number of physiologically important cellular processes, such as the liberation of arachidonic acid from membrane phospholipids []. It plays a pivotal role in the biosynthesis of prostaglandin and other mediators of inflammation. PLA2 has four to seven disulphide bonds and binds a calcium ion that is essential for activity. Within the active enzyme, the alpha amino group is involved in a conserved hydrogen-bonding network linking the N-terminal region to the active site. The side chains of two conserved residues, His and Asp, participate in the catalytic network. Many PLA2's are widely distributed in snakes, lizards, bees and mammals. In mammals there are at least four forms: pancreatic, membrane-associated as well as two less well characterised forms. The venom of most snakes contains multiple forms of PLA2. Some of them are presynaptic neurotoxins which inhibit neuromuscular transmission by blocking acetylcholine release from the nerve termini. Some of the proteins in this family are allergens. Allergies are hypersensitivity reactions of the immune system to specific substances called allergens (such as pollen, stings, drugs, or food) that, in most people, result in no symptoms. A nomenclature system has been established for antigens (allergens) that cause IgE-mediated atopic allergies in humans [WHO/IUIS Allergen Nomenclature Subcommittee King T.P., Hoffmann D., Loewenstein H., Marsh D.G., Platts-Mills T.A.E., Thomas W. Bull. World Health Organ. 72:797-806(1994)]. This nomenclature system is defined by a designation that is composed of the first three letters of the genus; a space; the first letter of the species name; a space and an arabic number. In the event that two species names have identical designations, they are discriminated from one another by adding one or more letters (as necessary) to each species designation.  The allergens in this family include allergens with the following designations: Api m 1.; GO: 0004623 phospholipase A2 activity, 0005509 calcium ion binding, 0016042 lipid catabolic process; PDB: 1OQS_F 1S6B_B 1XXW_B 1MH2_B 2RD4_B 1OZ6_A 2OSN_A 2PH4_B 1FDK_A 2BP2_A ....
Probab=100.00  E-value=2.1e-35  Score=222.40  Aligned_cols=109  Identities=38%  Similarity=0.652  Sum_probs=95.5

Q ss_pred             cHHHHHHHHhhhcCCCc-ccccCCccccCCCCCCCCcCccCCccccccccchhhHHhhhhhcccCCc-ceeeEEeecCCc
Q psy12202          6 SAVQLYSMVSCSTGCDP-LSYKGYGCYCGFLGSGYPVDPIDRTSQLNMARDHDSGHEIYIIFIYSGV-VSYTTGAIQGPT   83 (157)
Q Consensus         6 ~l~qf~~Mi~c~tg~~~-l~Y~~YGCyCg~gG~G~PVD~iDrcC~~~~~~~Hd~CY~~~~~~~c~~~-~~Y~~~~~~~~~   83 (157)
                      +|+||..||+++++..+ ++|++||||||++|+|.|||+||++|+.     |++||+++....|.+. .+|+|.+..+  
T Consensus         1 ~l~q~~~Mi~~~~~~~~~~~y~~YGCyCg~~g~G~PvD~iD~~C~~-----h~~Cy~~~~~~~C~~~~~~Y~~~~~~~--   73 (116)
T PF00068_consen    1 NLWQFGEMIKCVTGKFPFFKYNDYGCYCGFGGKGQPVDEIDRCCRK-----HDQCYKCAKEKGCDPYFTSYSYSCSNK--   73 (116)
T ss_dssp             -HHHHHHHHHHHHSSSHHHHHSSBTTTBSSSSSSS-SSHHHHHHHH-----HHHHHHHHTTTTSSTTTSS-EEEEETT--
T ss_pred             CHHHHHHHHHHhhCCCcHHHHccccccCCCCCCCCCcccccchhHH-----hHHHHHHHhcccccccccceEEEEecC--
Confidence            58999999999999875 5999999999999999999999999999     9999999988788776 8999999877  


Q ss_pred             ccccCCCCCceeCCCCCCCCceeeccCCCCChhhhhhchhhHHHHHHhccCCCCCCccccc
Q psy12202         84 VLSFSNISSPTCGPASEDGPYVVSKASKRGKSCSHRLCECDRRFSECLRPYSCPKYKAVCR  144 (157)
Q Consensus        84 ~~s~~~~~~i~C~~~~~~~~~~~~~~~~~~~~C~~~lCeCDr~~A~C~~~~~~~~~~~~c~  144 (157)
                              .|+|.              + +++|+++|||||++||+||++++|+.......
T Consensus        74 --------~i~C~--------------~-~~~C~~~lCeCD~~~A~cl~~~~yn~~~~~~~  111 (116)
T PF00068_consen   74 --------NITCS--------------D-NDSCERALCECDKAFAECLARNSYNKKYKNFD  111 (116)
T ss_dssp             --------EEEEE--------------S-SSHHHHHHHHHHHHHHHHHHHTGB-GGGBTTT
T ss_pred             --------CcccC--------------C-CCchhHHhhhCcHHHHHHHHhCccCHHHhCCC
Confidence                    89993              4 89999999999999999999999888765443


No 5  
>smart00085 PA2c Phospholipase A2.
Probab=100.00  E-value=7.6e-35  Score=220.34  Aligned_cols=106  Identities=35%  Similarity=0.606  Sum_probs=95.9

Q ss_pred             cHHHHHHHHhhhcCCCc-ccccCCccccCCCCCCCCcCccCCccccccccchhhHHhhhhhcccCCc-ceeeEEeecCCc
Q psy12202          6 SAVQLYSMVSCSTGCDP-LSYKGYGCYCGFLGSGYPVDPIDRTSQLNMARDHDSGHEIYIIFIYSGV-VSYTTGAIQGPT   83 (157)
Q Consensus         6 ~l~qf~~Mi~c~tg~~~-l~Y~~YGCyCg~gG~G~PVD~iDrcC~~~~~~~Hd~CY~~~~~~~c~~~-~~Y~~~~~~~~~   83 (157)
                      +|+||+.||+|+||++| ++|.+||||||+||+|.|||+||+||++     ||.||+.+....|.++ ..|+|++.++  
T Consensus         1 ~l~qf~~mi~c~t~~~~~~~y~~YGCyCG~gg~G~pvD~~D~CC~~-----HD~Cy~~~~~~~C~~~~~~y~~~c~~~--   73 (117)
T smart00085        1 NLWQFGNMIQCATGKRAWLSYGDYGCYCGWGGSGTPVDATDRCCFV-----HDCCYGKAEKEGCNPKTTTYSYSCDNG--   73 (117)
T ss_pred             CHHHHHHHHHHhcCCCcccchhccCcccCCCCCCCccccccchhhh-----cCchhhhcccCCCcccccceEEEEECC--
Confidence            58999999999999665 6999999999999999999999999999     9999999976677776 9999999877  


Q ss_pred             ccccCCCCCceeCCCCCCCCceeeccCCCCChhhhhhchhhHHHHHHhccCCCCCCc
Q psy12202         84 VLSFSNISSPTCGPASEDGPYVVSKASKRGKSCSHRLCECDRRFSECLRPYSCPKYK  140 (157)
Q Consensus        84 ~~s~~~~~~i~C~~~~~~~~~~~~~~~~~~~~C~~~lCeCDr~~A~C~~~~~~~~~~  140 (157)
                              .|+|.              ..+++|++.+|||||.+|+||++++|+.++
T Consensus        74 --------~~~C~--------------~~~~~C~~~~C~CD~~aa~Cf~~~~yn~~~  108 (117)
T smart00085       74 --------FITCG--------------GKNTACLVFVCECDRAAAICFAKNPYNKKN  108 (117)
T ss_pred             --------cceEC--------------cCCCccceeecccCHHHHHHhhhCccChhc
Confidence                    89994              336799999999999999999999988764


No 6  
>cd00618 PLA2_like PLA2_like: Phospholipase A2, a super-family of secretory and cytosolic enzymes; the latter are either Ca dependent or Ca independent. PLA2 cleaves the sn-2 position of the glycerol backbone of phospholipids (PC or phosphatidylethanolamine), usually in a metal-dependent reaction, to generate lysophospholipid (LysoPL) and a free fatty acid (FA). The resulting products are either dietary or used in synthetic pathways for leukotrienes and prostaglandins. Often, arachidonic acid is released as a free fatty acid and acts as second messenger in signaling networks. Secreted PLA2s have also been found to specifically bind to a variety of soluble and membrane proteins in mammals, including receptors. As a toxin, PLA2 is a potent presynaptic neurotoxin which blocks nerve terminals by binding to the nerve membrane and hydrolyzing stable membrane lipids. The products of the hydrolysis (LysoPL and FA) cannot form bilayers leading to a change in membrane conformation and ultimately 
Probab=99.86  E-value=2.6e-22  Score=141.10  Aligned_cols=78  Identities=37%  Similarity=0.654  Sum_probs=63.9

Q ss_pred             cCCccccCCCCC----CCCcCccCCccccccccchhhHHhhhhhcccCCc-ceeeEEeecCCcccccCCCCCceeCCCCC
Q psy12202         26 KGYGCYCGFLGS----GYPVDPIDRTSQLNMARDHDSGHEIYIIFIYSGV-VSYTTGAIQGPTVLSFSNISSPTCGPASE  100 (157)
Q Consensus        26 ~~YGCyCg~gG~----G~PVD~iDrcC~~~~~~~Hd~CY~~~~~~~c~~~-~~Y~~~~~~~~~~~s~~~~~~i~C~~~~~  100 (157)
                      ++||||||+||+    |.|||+||+||+.     ||.||+.+........ ..|.|  ...          .++|.    
T Consensus         1 ~~ygc~CG~g~~~~~~g~p~D~~D~CC~~-----HD~Cy~~~~~~~~~~~~~~~~~--~~~----------~~~~~----   59 (83)
T cd00618           1 LPYGCYCGPGGSACPSGQPVDETDRCCRK-----HDCCYDQISDGGCCDGCLSYSF--SEG----------GVTCL----   59 (83)
T ss_pred             CCcCcccCCCCcCCCCCCCCCcchhhhhh-----CccHhhhhhccCCCCCcceeee--cCC----------ceeEC----
Confidence            479999999999    9999999999999     9999999975433332 55666  222          67773    


Q ss_pred             CCCceeeccCCCCChhhhhhchhhHHHHHHhccC
Q psy12202        101 DGPYVVSKASKRGKSCSHRLCECDRRFSECLRPY  134 (157)
Q Consensus       101 ~~~~~~~~~~~~~~~C~~~lCeCDr~~A~C~~~~  134 (157)
                                .+.++|.+.+|+||++||+||+++
T Consensus        60 ----------~~~~~c~~~~C~CD~~~a~Cl~~~   83 (83)
T cd00618          60 ----------TNSDLCTRSHCDCDRRLAICLARA   83 (83)
T ss_pred             ----------CCCChhhHhhCcccHHHHHHhhhC
Confidence                      567899999999999999999874


No 7  
>cd04706 PLA2_plant PLA2_plant: Plant-specific sub-family of  Phospholipase A2, a super-family of secretory and cytosolic enzymes; the latter are either Ca dependent or Ca independent. Enzymatically active PLA2 cleaves the sn-2 position of the glycerol backbone of phospholipids; secreted PLA2s have also been found to specifically bind to a variety of soluble and membrane proteins in mammals, including receptors. As a toxin, PLA2 is a potent presynaptic neurotoxin which blocks nerve terminals by binding to the nerve membrane and hydrolyzing stable membrane lipids. The products of the hydrolysis cannot form bilayers leading to a change in membrane conformation and ultimately to a block in the release of neurotransmitters. PLA2 may form dimers or oligomers. This sub-family does not appear to have a conserved active site and metal-binding loop.
Probab=99.17  E-value=4.5e-12  Score=96.81  Aligned_cols=35  Identities=34%  Similarity=0.543  Sum_probs=32.4

Q ss_pred             ccccCCccccCCCCCC----CCcCccCCccccccccchhhHHhh
Q psy12202         23 LSYKGYGCYCGFLGSG----YPVDPIDRTSQLNMARDHDSGHEI   62 (157)
Q Consensus        23 l~Y~~YGCyCg~gG~G----~PVD~iDrcC~~~~~~~Hd~CY~~   62 (157)
                      +.|..||||||+||+|    .|||+||+||+.     ||.||+.
T Consensus        19 ~~y~~YG~yCG~g~~g~~~~~P~D~lD~CC~~-----HD~Cy~~   57 (117)
T cd04706          19 PPFLRYGKYCGPGYSGCPGERPCDDLDACCMT-----HDACVQA   57 (117)
T ss_pred             CcccccCcccCCCCCCCCCCCCcchhhHHHHh-----CcCcccC
Confidence            3599999999999998    899999999999     9999964


No 8  
>cd04704 PLA2_bee_venom_like PLA2_bee_venom_like: A sub-family of  Phospholipase A2, similar to bee venom PLA2. PLA2 is a super-family of secretory and cytosolic enzymes; the latter are either Ca dependent or Ca independent. Enzymatically active PLA2 cleaves the sn-2 position of the glycerol backbone of phospholipids; secreted PLA2s have also been found to specifically bind to a variety of soluble and membrane proteins in mammals, including receptors. As a toxin, PLA2 is a potent presynaptic neurotoxin which blocks nerve terminals by binding to the nerve membrane and hydrolyzing stable membrane lipids. The products of the hydrolysis cannot form bilayers leading to a change in membrane conformation and ultimately to a block in the release of neurotransmitters. PLA2 may form dimers or oligomers. Bee venom PLA2 has fewer conserved disulfide bridges than most canonical PLA2s.
Probab=98.51  E-value=3.7e-08  Score=72.84  Aligned_cols=62  Identities=24%  Similarity=0.478  Sum_probs=46.3

Q ss_pred             ccCCCCCCC-Cc-----CccCCccccccccchhhHHhhhhhcccCCcceeeEEeecCCcccccCCCCCceeCCCCCCCCc
Q psy12202         31 YCGFLGSGY-PV-----DPIDRTSQLNMARDHDSGHEIYIIFIYSGVVSYTTGAIQGPTVLSFSNISSPTCGPASEDGPY  104 (157)
Q Consensus        31 yCg~gG~G~-PV-----D~iDrcC~~~~~~~Hd~CY~~~~~~~c~~~~~Y~~~~~~~~~~~s~~~~~~i~C~~~~~~~~~  104 (157)
                      |||.|.... +.     .++|+||+.     ||.|+..+.-.      .|+|+.                          
T Consensus         8 WCG~Gn~a~~~~dlG~~~~tD~CCr~-----HD~C~~~i~~~------~~kyg~--------------------------   50 (97)
T cd04704           8 WCGPGNIATNYSDLGAFRETDKCCRE-----HDHCPDIISAG------EYKYGL--------------------------   50 (97)
T ss_pred             ecCCCCCCCCcccccCccccchHHHc-----cccCcCccccc------ccccCc--------------------------
Confidence            899987664 44     689999999     99999776421      223321                          


Q ss_pred             eeeccCCCCChhhhhhchhhHHHHHHhccCC
Q psy12202        105 VVSKASKRGKSCSHRLCECDRRFSECLRPYS  135 (157)
Q Consensus       105 ~~~~~~~~~~~C~~~lCeCDr~~A~C~~~~~  135 (157)
                            .+...+.+..|+||++|+.||.+..
T Consensus        51 ------~N~~~~t~~~C~CD~~f~~CL~~~~   75 (97)
T cd04704          51 ------TNTRLFTRSHCDCDNRFRQCLKNVN   75 (97)
T ss_pred             ------cCCCccccccCcHHHHHHHHHHHcC
Confidence                  2335678899999999999999865


No 9  
>PF05826 Phospholip_A2_2:  Phospholipase A2;  InterPro: IPR001211 Phospholipase A2 (3.1.1.4 from EC) (PLA2) is a small lipolytic enzyme that releases fatty acids from the second carbon group of glycerol. It is involved in a number of physiologically important cellular processes, such as the liberation of arachidonic acid from membrane phospholipids []. It plays a pivotal role in the biosynthesis of prostaglandin and other mediators of inflammation. PLA2 has four to seven disulphide bonds and binds a calcium ion that is essential for activity. Within the active enzyme, the alpha amino group is involved in a conserved hydrogen-bonding network linking the N-terminal region to the active site. The side chains of two conserved residues, His and Asp, participate in the catalytic network. Many PLA2's are widely distributed in snakes, lizards, bees and mammals. In mammals there are at least four forms: pancreatic, membrane-associated as well as two less well characterised forms. The venom of most snakes contains multiple forms of PLA2. Some of them are presynaptic neurotoxins which inhibit neuromuscular transmission by blocking acetylcholine release from the nerve termini. Some of the proteins in this family are allergens. Allergies are hypersensitivity reactions of the immune system to specific substances called allergens (such as pollen, stings, drugs, or food) that, in most people, result in no symptoms. A nomenclature system has been established for antigens (allergens) that cause IgE-mediated atopic allergies in humans [WHO/IUIS Allergen Nomenclature Subcommittee King T.P., Hoffmann D., Loewenstein H., Marsh D.G., Platts-Mills T.A.E., Thomas W. Bull. World Health Organ. 72:797-806(1994)]. This nomenclature system is defined by a designation that is composed of the first three letters of the genus; a space; the first letter of the species name; a space and an arabic number. In the event that two species names have identical designations, they are discriminated from one another by adding one or more letters (as necessary) to each species designation.  The allergens in this family include allergens with the following designations: Api m 1.; GO: 0004623 phospholipase A2 activity, 0005509 calcium ion binding, 0016042 lipid catabolic process; PDB: 1POC_A.
Probab=96.88  E-value=0.00015  Score=53.69  Aligned_cols=19  Identities=37%  Similarity=0.982  Sum_probs=15.0

Q ss_pred             hhhhchhhHHHHHHhccCC
Q psy12202        117 SHRLCECDRRFSECLRPYS  135 (157)
Q Consensus       117 ~~~lCeCDr~~A~C~~~~~  135 (157)
                      -..-|+||++|..||++..
T Consensus        56 T~~hC~Cd~~f~~CL~~~~   74 (99)
T PF05826_consen   56 TISHCDCDSRFYQCLKNVN   74 (99)
T ss_dssp             -EEBHHHHHHHHHHHHTS-
T ss_pred             ceeecCcccHHHHHHHHcC
Confidence            4567999999999999843


No 10 
>PF08398 Parvo_coat_N:  Parvovirus coat protein VP1;  InterPro: IPR013607 Parvoviruses are some of the smallest viruses containing linear, non-segmented single-stranded DNA genomes, with an average genome size of 5000 nucleotides. Parvoviruses have been described that infect a wide range of invertebrates and vertebrates and are well known for causing enteric disease in mammals. Genomes contains two large ORFs: NS1 and VP1; other ORFs are found in some sub-types and different gene products can arise from splice variants and the use of different start codons [].  This is the N-terminal region of the Parvovirus VP1 coat protein []; its function is not known. ; GO: 0005198 structural molecule activity, 0019028 viral capsid
Probab=96.55  E-value=0.0011  Score=46.05  Aligned_cols=39  Identities=23%  Similarity=0.389  Sum_probs=31.4

Q ss_pred             ccCCC---CCCCCcCccCCccccccccchhhHHhhhhhcccCCccee
Q psy12202         31 YCGFL---GSGYPVDPIDRTSQLNMARDHDSGHEIYIIFIYSGVVSY   74 (157)
Q Consensus        31 yCg~g---G~G~PVD~iDrcC~~~~~~~Hd~CY~~~~~~~c~~~~~Y   74 (157)
                      |+|+|   -.|.||+++|..++.     ||..|+.+......||..|
T Consensus         6 YlGPgn~l~~g~Pv~~~D~aA~~-----HD~aY~~~lk~G~NPY~~~   47 (64)
T PF08398_consen    6 YLGPGNPLDNGEPVNPVDAAARE-----HDEAYDELLKHGDNPYLHF   47 (64)
T ss_pred             ccCCCCCcCCCCCCCHHHHHHHH-----HHHHHHHHHHcCCCCceec
Confidence            56766   469999999999999     9999999986666665433


No 11 
>cd04705 PLA2_group_III_like PLA2_group_III_like: A sub-family of  Phospholipase A2, similar to human group III PLA2. PLA2 is a super-family of secretory and cytosolic enzymes; the latter are either Ca dependent or Ca independent. Enzymatically active PLA2 cleaves the sn-2 position of the glycerol backbone of phospholipids; secreted PLA2s have also been found to specifically bind to a variety of soluble and membrane proteins in mammals, including receptors. As a toxin, PLA2 is a potent presynaptic neurotoxin which blocks nerve terminals by binding to the nerve membrane and hydrolyzing stable membrane lipids. The products of the hydrolysis cannot form bilayers leading to a change in membrane conformation and ultimately to a block in the release of neurotransmitters. PLA2 may form dimers or oligomers.
Probab=94.01  E-value=0.023  Score=42.58  Aligned_cols=21  Identities=43%  Similarity=0.896  Sum_probs=16.9

Q ss_pred             hhhhchhhHHHHHHhccCCCC
Q psy12202        117 SHRLCECDRRFSECLRPYSCP  137 (157)
Q Consensus       117 ~~~lCeCDr~~A~C~~~~~~~  137 (157)
                      ...-|+||++|..||....-+
T Consensus        64 tisHCdCD~rf~~CL~~~n~~   84 (100)
T cd04705          64 SVSHCDCDSRLKDCLRLSSSS   84 (100)
T ss_pred             ccccccHHHHHHHHHHHcCCc
Confidence            345699999999999987543


No 12 
>PF06951 PLA2G12:  Group XII secretory phospholipase A2 precursor (PLA2G12);  InterPro: IPR010711 This family consists of several group XII secretory phospholipase A2 precursor (PLA2G12) (3.1.1.4 from EC) proteins. Group XII and group V PLA(2)s are thought to participate in helper T cell immune response through release of immediate second signals and generation of downstream eicosanoids [].; GO: 0004623 phospholipase A2 activity, 0005509 calcium ion binding, 0016042 lipid catabolic process, 0005576 extracellular region
Probab=28.57  E-value=36  Score=28.12  Aligned_cols=21  Identities=19%  Similarity=0.393  Sum_probs=16.0

Q ss_pred             CCCcC----ccCCccccccccchhhHHhhh
Q psy12202         38 GYPVD----PIDRTSQLNMARDHDSGHEIY   63 (157)
Q Consensus        38 G~PVD----~iDrcC~~~~~~~Hd~CY~~~   63 (157)
                      |.++|    +.=.||-.     ||.||+.=
T Consensus        88 G~~~d~~iP~~t~CCn~-----HDiCYdTC  112 (184)
T PF06951_consen   88 GLQIDIGIPAMTKCCNQ-----HDICYDTC  112 (184)
T ss_pred             CCcccCCCCchhccchh-----hhhHHHcc
Confidence            44555    37799999     99999864


No 13 
>PF14703 DUF4463:  Domain of unknown function (DUF4463)
Probab=28.28  E-value=18  Score=24.69  Aligned_cols=20  Identities=35%  Similarity=0.581  Sum_probs=16.0

Q ss_pred             cccCCCCCCCCcCccCCcccc
Q psy12202         30 CYCGFLGSGYPVDPIDRTSQL   50 (157)
Q Consensus        30 CyCg~gG~G~PVD~iDrcC~~   50 (157)
                      .++|+-| |.-||+||.+...
T Consensus        61 ~~~~~~g-~~kVDaIdyy~~e   80 (85)
T PF14703_consen   61 GFLGLFG-GKKVDAIDYYREE   80 (85)
T ss_pred             CcCCCCC-CCcchHHHHHHHH
Confidence            4667777 8999999987665


Done!