Query         psy12215
Match_columns 155
No_of_seqs    174 out of 1418
Neff          9.0 
Searched_HMMs 46136
Date          Fri Aug 16 21:45:46 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy12215.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/12215hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG4577|consensus               99.9 5.1E-29 1.1E-33  184.3   1.1  146    1-155    51-203 (383)
  2 KOG1701|consensus               99.9 8.6E-29 1.9E-33  191.5  -3.8  141    1-153   293-438 (468)
  3 KOG2272|consensus               99.9   2E-24 4.4E-29  157.5  -2.3  131    2-143    32-162 (332)
  4 KOG1701|consensus               99.8 5.1E-21 1.1E-25  148.6   4.6  104    1-108   351-463 (468)
  5 KOG1044|consensus               99.8 5.2E-21 1.1E-25  153.1   3.4  135    1-149    82-223 (670)
  6 KOG1703|consensus               99.8   4E-20 8.7E-25  150.4   2.5  130    1-144   321-450 (479)
  7 KOG2272|consensus               99.8 3.5E-20 7.6E-25  135.4   0.2  125    3-144   156-280 (332)
  8 KOG1044|consensus               99.7   2E-18 4.4E-23  138.4   1.2   98    1-105   151-248 (670)
  9 KOG1703|consensus               99.6 4.3E-17 9.3E-22  132.7   0.8   99    1-104   380-478 (479)
 10 PF00412 LIM:  LIM domain;  Int  99.6 7.3E-15 1.6E-19   86.5   5.4   58   50-108     1-58  (58)
 11 KOG4577|consensus               99.3 1.6E-13 3.5E-18  102.4  -2.3   95   49-153    35-131 (383)
 12 PF00412 LIM:  LIM domain;  Int  99.3 1.9E-12   4E-17   76.1   2.2   42    1-44     17-58  (58)
 13 KOG1700|consensus               99.1 1.3E-11 2.7E-16   90.0   0.5  103    2-108    26-167 (200)
 14 smart00132 LIM Zinc-binding do  98.7 1.4E-08   3E-13   54.4   2.5   37   49-85      1-37  (39)
 15 KOG0490|consensus               97.9 1.9E-06 4.2E-11   63.9  -1.0  101    3-107    16-119 (235)
 16 smart00132 LIM Zinc-binding do  97.8   1E-05 2.2E-10   42.9   1.0   20    1-20     18-37  (39)
 17 KOG1702|consensus               97.4 9.6E-06 2.1E-10   58.5  -2.7   58   49-108     6-63  (264)
 18 KOG1700|consensus               97.3 5.9E-05 1.3E-09   55.1  -0.2   58   49-108     9-66  (200)
 19 KOG1702|consensus               96.1  0.0008 1.7E-08   48.8  -1.2   42    2-45     23-64  (264)
 20 KOG0490|consensus               93.5   0.027 5.9E-07   41.6   0.6   66   53-123     2-69  (235)
 21 PF06677 Auto_anti-p27:  Sjogre  87.8    0.39 8.5E-06   25.9   1.5   22   12-39     19-40  (41)
 22 PF11781 RRN7:  RNA polymerase   86.7    0.49 1.1E-05   24.7   1.5   24   12-41     10-33  (36)
 23 smart00504 Ubox Modified RING   86.7    0.43 9.4E-06   27.6   1.5   46   11-59      2-47  (63)
 24 PF08394 Arc_trans_TRASH:  Arch  86.4    0.42 9.1E-06   25.1   1.1   24   50-73      1-24  (37)
 25 PF07191 zinc-ribbons_6:  zinc-  84.4     2.1 4.6E-05   25.8   3.6   58   12-85      3-60  (70)
 26 PF06906 DUF1272:  Protein of u  83.4       1 2.3E-05   25.8   1.9   46   12-59      7-53  (57)
 27 COG1645 Uncharacterized Zn-fin  83.4    0.78 1.7E-05   31.2   1.6   23   12-41     30-52  (131)
 28 KOG1813|consensus               83.3     1.2 2.6E-05   34.4   2.7   50   76-129   242-291 (313)
 29 PF14835 zf-RING_6:  zf-RING of  82.4     1.5 3.2E-05   26.1   2.3   47   11-61      8-54  (65)
 30 PF14446 Prok-RING_1:  Prokaryo  82.3    0.72 1.6E-05   26.4   1.0   28   49-76      7-36  (54)
 31 COG5152 Uncharacterized conser  82.2    0.88 1.9E-05   33.2   1.6   48   76-127   197-244 (259)
 32 PF10367 Vps39_2:  Vacuolar sor  81.2     1.2 2.5E-05   28.6   1.9   28   49-76     80-107 (109)
 33 PF14634 zf-RING_5:  zinc-RING   81.1     1.9   4E-05   23.2   2.4   41   78-120     2-43  (44)
 34 PF14835 zf-RING_6:  zf-RING of  80.1       1 2.2E-05   26.7   1.2   43   76-124     8-51  (65)
 35 PF04570 DUF581:  Protein of un  79.5     1.4   3E-05   25.6   1.5   27   12-38     18-44  (58)
 36 KOG0320|consensus               78.3     1.3 2.8E-05   31.7   1.4   50   73-124   129-178 (187)
 37 PF14471 DUF4428:  Domain of un  76.6     2.4 5.2E-05   23.9   2.0   30   77-107     1-30  (51)
 38 PF10235 Cript:  Microtubule-as  75.4     1.5 3.3E-05   27.8   1.0   36   12-59     46-81  (90)
 39 PF10367 Vps39_2:  Vacuolar sor  74.0     3.1 6.7E-05   26.6   2.3   28   12-41     80-108 (109)
 40 PF09943 DUF2175:  Uncharacteri  73.6     1.3 2.8E-05   28.8   0.3   33   76-108     3-35  (101)
 41 PF13920 zf-C3HC4_3:  Zinc fing  73.5     6.1 0.00013   21.7   3.1   44   77-124     4-48  (50)
 42 PF13240 zinc_ribbon_2:  zinc-r  73.0     1.6 3.5E-05   20.3   0.5    8   13-20      2-9   (23)
 43 PRK00420 hypothetical protein;  71.0     2.5 5.5E-05   28.0   1.3   25   11-41     24-48  (112)
 44 PF13923 zf-C3HC4_2:  Zinc fing  69.8     3.3 7.2E-05   21.5   1.4   38   13-52      1-38  (39)
 45 KOG1813|consensus               68.7     2.7 5.8E-05   32.5   1.2   46   11-59    242-287 (313)
 46 COG2191 Formylmethanofuran deh  68.5     1.7 3.6E-05   31.8   0.1   32   76-108   173-204 (206)
 47 PRK14890 putative Zn-ribbon RN  67.2     3.5 7.5E-05   24.0   1.2   36   12-55      9-44  (59)
 48 KOG4739|consensus               64.0     4.9 0.00011   30.1   1.8   42   78-124     6-48  (233)
 49 PF06689 zf-C4_ClpX:  ClpX C4-t  63.8     8.2 0.00018   20.6   2.2   31   12-42      3-33  (41)
 50 PF13834 DUF4193:  Domain of un  63.5     2.5 5.3E-05   27.3   0.1   29   10-39     70-98  (99)
 51 COG1645 Uncharacterized Zn-fin  62.1     4.7  0.0001   27.5   1.3   21   78-104    31-51  (131)
 52 PF13639 zf-RING_2:  Ring finge  62.1     5.7 0.00012   21.1   1.4   32   13-44      3-34  (44)
 53 PF12773 DZR:  Double zinc ribb  62.0     3.8 8.2E-05   22.5   0.7   38   13-59      1-41  (50)
 54 KOG0320|consensus               61.8     2.9 6.3E-05   30.0   0.2   51    8-59    129-179 (187)
 55 PRK00807 50S ribosomal protein  61.2     8.8 0.00019   21.7   2.1   24   12-35      3-27  (52)
 56 PF09943 DUF2175:  Uncharacteri  61.2     8.9 0.00019   24.9   2.4   32   49-80      4-35  (101)
 57 PF14570 zf-RING_4:  RING/Ubox   60.2     4.4 9.5E-05   22.6   0.7   43   14-56      2-46  (48)
 58 PF01258 zf-dskA_traR:  Prokary  59.7     1.4 2.9E-05   22.8  -1.3   27   78-105     6-32  (36)
 59 COG5152 Uncharacterized conser  57.5     2.6 5.6E-05   30.8  -0.6   46   11-59    197-242 (259)
 60 cd02249 ZZ Zinc finger, ZZ typ  57.0      10 0.00022   20.5   1.9   10   97-106    23-32  (46)
 61 cd00162 RING RING-finger (Real  56.9     5.9 0.00013   20.3   0.9   41   13-55      2-43  (45)
 62 COG4847 Uncharacterized protei  55.4      11 0.00024   24.1   2.0   31   76-106     7-37  (103)
 63 PF02069 Metallothio_Pro:  Prok  55.4     6.5 0.00014   22.3   0.9   27   13-41     10-37  (52)
 64 PRK14873 primosome assembly pr  54.6     9.5 0.00021   33.1   2.2   39   11-56    393-431 (665)
 65 PF13248 zf-ribbon_3:  zinc-rib  53.5     5.9 0.00013   18.8   0.5    7   13-19      5-11  (26)
 66 PF00645 zf-PARP:  Poly(ADP-rib  53.2     5.6 0.00012   24.4   0.4   13   49-61      9-21  (82)
 67 PF12674 Zn_ribbon_2:  Putative  52.6     4.6 9.9E-05   25.1  -0.0   30   12-43      2-36  (81)
 68 PF08792 A2L_zn_ribbon:  A2L zi  52.4      16 0.00035   18.5   2.0   24   12-40      5-28  (33)
 69 PF12156 ATPase-cat_bd:  Putati  51.6      12 0.00027   23.5   1.9   25   12-36      2-28  (88)
 70 COG2075 RPL24A Ribosomal prote  50.8      17 0.00038   21.6   2.2   24   12-35      5-29  (66)
 71 COG1198 PriA Primosomal protei  49.8      13 0.00028   32.7   2.2   40   11-56    445-484 (730)
 72 smart00291 ZnF_ZZ Zinc-binding  48.8      19 0.00042   19.3   2.1   10   97-106    27-36  (44)
 73 PF11571 Med27:  Mediator compl  46.7     5.4 0.00012   25.2  -0.4   16   40-57     49-64  (90)
 74 PF00097 zf-C3HC4:  Zinc finger  46.6      24 0.00053   18.1   2.3   29   78-108     1-30  (41)
 75 KOG0978|consensus               45.6     3.7 8.1E-05   35.6  -1.6   48   11-61    644-692 (698)
 76 TIGR00595 priA primosomal prot  45.2      17 0.00037   30.4   2.2   40   11-56    223-262 (505)
 77 PF15227 zf-C3HC4_4:  zinc fing  45.0      36 0.00078   18.0   2.8   29   78-108     1-29  (42)
 78 smart00547 ZnF_RBZ Zinc finger  43.7      11 0.00023   17.6   0.5   20   36-55      5-24  (26)
 79 PF00569 ZZ:  Zinc finger, ZZ t  41.6      38 0.00083   18.3   2.6   10   97-106    28-37  (46)
 80 PRK14559 putative protein seri  40.9      20 0.00044   31.1   2.1   37   12-59      3-39  (645)
 81 KOG2462|consensus               40.8      14 0.00031   28.4   1.0   69    9-85    129-197 (279)
 82 PF03854 zf-P11:  P-11 zinc fin  40.2      41 0.00089   18.7   2.5   28   95-124    19-46  (50)
 83 COG2888 Predicted Zn-ribbon RN  39.7      14 0.00031   21.5   0.7   10   12-21     11-20  (61)
 84 cd02336 ZZ_RSC8 Zinc finger, Z  37.0      40 0.00087   18.4   2.2   30   77-107     2-33  (45)
 85 PF04981 NMD3:  NMD3 family ;    36.9      24 0.00053   26.3   1.8   40   13-60      1-48  (236)
 86 PF10122 Mu-like_Com:  Mu-like   36.6      21 0.00045   20.1   1.0   12   11-22      5-16  (51)
 87 PF10886 DUF2685:  Protein of u  36.2      31 0.00068   19.7   1.7   24   49-73      3-26  (54)
 88 COG3813 Uncharacterized protei  35.8      34 0.00074   20.8   1.9   45   13-59      8-53  (84)
 89 PF00641 zf-RanBP:  Zn-finger i  33.7      27 0.00059   16.9   1.1   24   33-56      4-27  (30)
 90 smart00659 RPOLCX RNA polymera  33.7      26 0.00056   19.0   1.1   11   11-21      3-13  (44)
 91 cd02340 ZZ_NBR1_like Zinc fing  33.7      38 0.00083   18.1   1.8   11   49-59      2-12  (43)
 92 PF10764 Gin:  Inhibitor of sig  33.3      35 0.00075   18.7   1.6   28   12-43      1-28  (46)
 93 cd00472 Ribosomal_L24e_L24 Rib  33.3      42 0.00092   19.1   2.0   24   12-35      5-29  (54)
 94 PF08271 TF_Zn_Ribbon:  TFIIB z  33.2      29 0.00062   18.4   1.2   10   49-58     21-30  (43)
 95 PRK12495 hypothetical protein;  33.1      21 0.00044   26.6   0.8   26    8-40     40-65  (226)
 96 PF04564 U-box:  U-box domain;   32.5      63  0.0014   19.2   2.8   48    9-59      3-51  (73)
 97 PF06827 zf-FPG_IleRS:  Zinc fi  32.3      26 0.00057   16.9   0.9   10   49-58      3-12  (30)
 98 PF07754 DUF1610:  Domain of un  31.7      32 0.00069   16.2   1.1    9   51-59      2-10  (24)
 99 PRK00398 rpoP DNA-directed RNA  31.6      26 0.00057   18.9   0.9   11   11-21      4-14  (46)
100 PF04810 zf-Sec23_Sec24:  Sec23  31.4      40 0.00086   17.7   1.6   29   49-83      4-32  (40)
101 PF01286 XPA_N:  XPA protein N-  31.4      16 0.00034   18.8  -0.0   10   12-21      5-14  (34)
102 cd02335 ZZ_ADA2 Zinc finger, Z  30.2      49  0.0011   18.1   1.9   10   98-107    25-34  (49)
103 PRK14891 50S ribosomal protein  30.1      45 0.00097   22.7   2.0   24   12-35      6-30  (131)
104 PF10083 DUF2321:  Uncharacteri  30.1     5.7 0.00012   27.8  -2.3   34   97-135    28-61  (158)
105 PF00096 zf-C2H2:  Zinc finger,  29.9      20 0.00043   15.8   0.2   10   11-20      1-10  (23)
106 PRK05580 primosome assembly pr  29.6      43 0.00093   29.2   2.3   39   12-56    392-430 (679)
107 PRK04136 rpl40e 50S ribosomal   28.7      27  0.0006   19.4   0.6   24   32-55     13-36  (48)
108 TIGR00570 cdk7 CDK-activating   28.6      52  0.0011   25.9   2.4   28   96-124    27-54  (309)
109 PLN03208 E3 ubiquitin-protein   28.1      56  0.0012   23.8   2.3   48   75-124    18-79  (193)
110 PF14445 Prok-RING_2:  Prokaryo  28.0     4.5 9.7E-05   22.7  -2.5   44   11-57      8-51  (57)
111 cd02341 ZZ_ZZZ3 Zinc finger, Z  28.0      64  0.0014   17.8   2.1   10   97-106    26-35  (48)
112 KOG3002|consensus               27.5      40 0.00087   26.3   1.6   43   11-58     49-91  (299)
113 PRK11595 DNA utilization prote  27.4      37 0.00079   25.1   1.4   38   13-58      8-45  (227)
114 cd02338 ZZ_PCMF_like Zinc fing  27.2      56  0.0012   17.9   1.8   11   97-107    24-34  (49)
115 PF13717 zinc_ribbon_4:  zinc-r  27.0      21 0.00046   18.4   0.0    7   77-83     27-33  (36)
116 TIGR02098 MJ0042_CXXC MJ0042 f  26.7      20 0.00044   18.3  -0.1    9   49-57     27-35  (38)
117 PF09723 Zn-ribbon_8:  Zinc rib  26.7      24 0.00052   18.8   0.2   11   11-21      6-16  (42)
118 PF13894 zf-C2H2_4:  C2H2-type   26.4      30 0.00065   14.9   0.5   10   11-20      1-10  (24)
119 smart00834 CxxC_CXXC_SSSS Puta  25.7      26 0.00056   18.0   0.2   10   11-20      6-15  (41)
120 TIGR00270 conserved hypothetic  25.6      68  0.0015   22.4   2.4   28   12-40      2-31  (154)
121 KOG2893|consensus               24.9      29 0.00063   26.3   0.4   48   49-105    12-59  (341)
122 PF02591 DUF164:  Putative zinc  23.5      14 0.00031   20.9  -1.2   11   49-59     24-34  (56)
123 PF05920 Homeobox_KN:  Homeobox  23.4      63  0.0014   17.0   1.5   17  138-154     5-21  (40)
124 TIGR02605 CxxC_CxxC_SSSS putat  23.3      32 0.00069   18.9   0.3   10   11-20      6-15  (52)
125 PF00320 GATA:  GATA zinc finge  22.6      79  0.0017   16.1   1.7   28   13-42      1-29  (36)
126 PRK00085 recO DNA repair prote  22.5      51  0.0011   24.4   1.4   31    8-40    147-177 (247)
127 COG4416 Com Mu-like prophage p  21.3      27  0.0006   19.9  -0.2   14   11-24      5-18  (60)
128 COG0266 Nei Formamidopyrimidin  21.1      60  0.0013   25.1   1.5   25   49-75    247-271 (273)
129 KOG4443|consensus               21.0      43 0.00093   29.0   0.7   19   67-85    107-125 (694)
130 PF10080 DUF2318:  Predicted me  21.0      88  0.0019   20.3   2.0   17   26-42     45-61  (102)
131 PF13912 zf-C2H2_6:  C2H2-type   21.0      42 0.00091   15.4   0.4   10   11-20      2-11  (27)
132 PF02428 Prot_inhib_II:  Potato  20.9 1.2E+02  0.0026   17.1   2.3   15   23-37     37-51  (52)
133 cd02345 ZZ_dah Zinc finger, ZZ  20.7      75  0.0016   17.5   1.5   10   98-107    25-34  (49)
134 PF01246 Ribosomal_L24e:  Ribos  20.6      68  0.0015   19.4   1.4   24   12-35      5-29  (71)
135 PF10170 C6_DPF:  Cysteine-rich  20.4      81  0.0018   20.3   1.7   31   77-107    51-81  (97)
136 KOG3476|consensus               20.1      24 0.00052   22.2  -0.7   26   30-59     66-91  (100)
137 PF07649 C1_3:  C1-like domain;  20.0      70  0.0015   15.4   1.1   11   11-21      1-11  (30)

No 1  
>KOG4577|consensus
Probab=99.95  E-value=5.1e-29  Score=184.34  Aligned_cols=146  Identities=35%  Similarity=0.729  Sum_probs=123.9

Q ss_pred             CCCccccccCcccccCCcccccCCCeEEEeCCeeecccchhccccccccccccccccccCceEEeccCcccccccccccc
Q psy12215          1 ALDLFWHEDCLKCGCCDCRLGEVGSTLYQKANLILCKRDYLRLFGTTGYCAACTKVIPAFEMVMRAKNNVYHLECFACQQ   80 (155)
Q Consensus         1 A~~~~~H~~Cf~C~~C~~~l~~~~~~~~~~~~~~~C~~c~~~~~~~~~~C~~C~~~I~~~~~~~~~~~~~~H~~Cf~C~~   80 (155)
                      ++++.||..|++|++|..+|.+   .+|.++|.+||++++.++|+.  +|..|...|.+...+..+.+..||..||.|..
T Consensus        51 vl~R~wHs~CLkCs~C~~qL~d---rCFsR~~s~yCkedFfKrfGT--KCsaC~~GIpPtqVVRkAqd~VYHl~CF~C~i  125 (383)
T KOG4577|consen   51 VLDRHWHSSCLKCSDCHDQLAD---RCFSREGSVYCKEDFFKRFGT--KCSACQEGIPPTQVVRKAQDFVYHLHCFACFI  125 (383)
T ss_pred             HHhhhhhhhhcchhhhhhHHHH---HHhhcCCceeehHHHHHHhCC--cchhhcCCCChHHHHHHhhcceeehhhhhhHh
Confidence            4689999999999999999953   689999999999999999999  99999999999766777889999999999999


Q ss_pred             CCcccccCCeEEe-eCCeeecHHhHHhhhcccCCCeee----ecCCeecchhhHHHHHHHHhhcCC--CCchHHHhhhhh
Q psy12215         81 CNHRFCVGDRFYL-CDNKILCEYDYEERQVFCVGDRFY----LCDNKILCEYDYEERQVFANIAYN--PSSLAHLRRQVT  153 (155)
Q Consensus        81 C~~~l~~~~~~~~-~~~~~~C~~c~~~~~~~~~~~~c~----~c~~~i~c~~~~~~~~~~~~~~~h--p~~~~~~~~~~~  153 (155)
                      |++.|..+..|+. .|+++.|+.+|+...    ...|.    -=.++-+.++...++++..+.+|.  |+|+||||||||
T Consensus       126 C~R~L~TGdEFYLmeD~rLvCK~DYE~Ak----~k~~~~l~gd~~nKRPRTTItAKqLETLK~AYn~SpKPARHVREQLs  201 (383)
T KOG4577|consen  126 CKRQLATGDEFYLMEDARLVCKDDYETAK----QKHCNELEGDASNKRPRTTITAKQLETLKQAYNTSPKPARHVREQLS  201 (383)
T ss_pred             hhcccccCCeeEEeccceeehhhhHHHHH----hccccccccccccCCCcceeeHHHHHHHHHHhcCCCchhHHHHHHhh
Confidence            9999998999885 569999999999876    34432    222333334455899999999898  899999999998


Q ss_pred             cC
Q psy12215        154 LQ  155 (155)
Q Consensus       154 ~~  155 (155)
                      -+
T Consensus       202 se  203 (383)
T KOG4577|consen  202 SE  203 (383)
T ss_pred             hc
Confidence            53


No 2  
>KOG1701|consensus
Probab=99.93  E-value=8.6e-29  Score=191.48  Aligned_cols=141  Identities=26%  Similarity=0.540  Sum_probs=123.5

Q ss_pred             CCCccccccCcccccCCcccccCCCeEEEeCCeeecccchhccccccccccccccccccCceEEeccCcccccccccccc
Q psy12215          1 ALDLFWHEDCLKCGCCDCRLGEVGSTLYQKANLILCKRDYLRLFGTTGYCAACTKVIPAFEMVMRAKNNVYHLECFACQQ   80 (155)
Q Consensus         1 A~~~~~H~~Cf~C~~C~~~l~~~~~~~~~~~~~~~C~~c~~~~~~~~~~C~~C~~~I~~~~~~~~~~~~~~H~~Cf~C~~   80 (155)
                      ||++.||..||+|..|++.|  .++.||..|+++||+.||.....   +|..|++.|.  |+++.+.|+.||+.||+|..
T Consensus       293 Am~~~fHv~CFtC~~C~r~L--~Gq~FY~v~~k~~CE~cyq~tle---kC~~Cg~~I~--d~iLrA~GkayHp~CF~Cv~  365 (468)
T KOG1701|consen  293 AMDQLFHVQCFTCRTCRRQL--AGQSFYQVDGKPYCEGCYQDTLE---KCNKCGEPIM--DRILRALGKAYHPGCFTCVV  365 (468)
T ss_pred             HhhhhhcccceehHhhhhhh--ccccccccCCcccchHHHHHHHH---HHhhhhhHHH--HHHHHhcccccCCCceEEEE
Confidence            79999999999999999999  78899999999999999998765   7999999997  48999999999999999999


Q ss_pred             CCcccccCCeEEee-CCeeecHHhHHhhhcccCCCeeeecCCeecchhhHHH--HHHHHhhcCCCCc--hHHHhhhhh
Q psy12215         81 CNHRFCVGDRFYLC-DNKILCEYDYEERQVFCVGDRFYLCDNKILCEYDYEE--RQVFANIAYNPSS--LAHLRRQVT  153 (155)
Q Consensus        81 C~~~l~~~~~~~~~-~~~~~C~~c~~~~~~~~~~~~c~~c~~~i~c~~~~~~--~~~~~~~~~hp~~--~~~~~~~~~  153 (155)
                      |.+.| .+..|++. ++++||-.+|.++|    +++|.+|.++|+...--++  +|+.+++.||=++  +.-.+-+||
T Consensus       366 C~r~l-dgipFtvd~~n~v~Cv~dfh~kf----APrCs~C~~PI~P~~G~~etvRvvamdr~fHv~CY~CEDCg~~LS  438 (468)
T KOG1701|consen  366 CARCL-DGIPFTVDSQNNVYCVPDFHKKF----APRCSVCGNPILPRDGKDETVRVVAMDRDFHVNCYKCEDCGLLLS  438 (468)
T ss_pred             ecccc-CCccccccCCCceeeehhhhhhc----CcchhhccCCccCCCCCcceEEEEEccccccccceehhhcCcccc
Confidence            99999 88888764 59999999999999    9999999999986554333  3556778999764  666666666


No 3  
>KOG2272|consensus
Probab=99.87  E-value=2e-24  Score=157.47  Aligned_cols=131  Identities=27%  Similarity=0.627  Sum_probs=112.8

Q ss_pred             CCccccccCcccccCCcccccCCCeEEEeCCeeecccchhccccccccccccccccccCceEEeccCccccccccccccC
Q psy12215          2 LDLFWHEDCLKCGCCDCRLGEVGSTLYQKANLILCKRDYLRLFGTTGYCAACTKVIPAFEMVMRAKNNVYHLECFACQQC   81 (155)
Q Consensus         2 ~~~~~H~~Cf~C~~C~~~l~~~~~~~~~~~~~~~C~~c~~~~~~~~~~C~~C~~~I~~~~~~~~~~~~~~H~~Cf~C~~C   81 (155)
                      .|..||.+||.|+.|-.|++  +..|+..+|+.||+.|+..+|+|  .|..|++.|.+  ++|.+.+.+||+.||+|..|
T Consensus        32 ~ge~wH~~CFvCAQCf~pf~--~g~~~efEgRkYCEhDF~~LfaP--cC~kC~EFiiG--rVikamnnSwHp~CF~Cd~C  105 (332)
T KOG2272|consen   32 NGELWHEQCFVCAQCFRPFP--DGIFYEFEGRKYCEHDFHVLFAP--CCGKCGEFIIG--RVIKAMNNSWHPACFRCDLC  105 (332)
T ss_pred             CchhhHHHHHHHHHhcCcCC--CceeEEecCcccccccchhhhch--hhcccccchhh--HHHHhhccccCcccchhHHH
Confidence            46799999999999999995  56899999999999999999999  99999999987  78899999999999999999


Q ss_pred             CcccccCCeEEeeCCeeecHHhHHhhhcccCCCeeeecCCeecchhhHHHHHHHHhhcCCCC
Q psy12215         82 NHRFCVGDRFYLCDNKILCEYDYEERQVFCVGDRFYLCDNKILCEYDYEERQVFANIAYNPS  143 (155)
Q Consensus        82 ~~~l~~~~~~~~~~~~~~C~~c~~~~~~~~~~~~c~~c~~~i~c~~~~~~~~~~~~~~~hp~  143 (155)
                      ++.| .+..|+...|+.+|..|..+..  +.+..-+.|++... -++ ++.+.++|++|||.
T Consensus       106 n~~L-ad~gf~rnqgr~LC~~Cn~k~K--a~~~g~YvC~KCh~-~iD-~~~l~fr~d~yH~y  162 (332)
T KOG2272|consen  106 NKHL-ADQGFYRNQGRALCRECNQKEK--AKGRGRYVCQKCHA-HID-EQPLTFRGDPYHPY  162 (332)
T ss_pred             HHHH-hhhhhHhhcchHHhhhhhhhhc--ccccceeehhhhhh-hcc-cccccccCCCCCcc
Confidence            9999 6777777779999999988754  33555677777333 222 68899999999995


No 4  
>KOG1701|consensus
Probab=99.82  E-value=5.1e-21  Score=148.57  Aligned_cols=104  Identities=25%  Similarity=0.560  Sum_probs=91.3

Q ss_pred             CCCccccccCcccccCCcccccCCCeEEE-eCCeeecccchhccccccccccccccccccCce-----EEeccCcccccc
Q psy12215          1 ALDLFWHEDCLKCGCCDCRLGEVGSTLYQ-KANLILCKRDYLRLFGTTGYCAACTKVIPAFEM-----VMRAKNNVYHLE   74 (155)
Q Consensus         1 A~~~~~H~~Cf~C~~C~~~l~~~~~~~~~-~~~~~~C~~c~~~~~~~~~~C~~C~~~I~~~~~-----~~~~~~~~~H~~   74 (155)
                      |+|+.||+.||+|..|++.|+  +-.|.+ .++++||-+||+++|++  +|+.|+++|++.+-     -|.+.++.||.+
T Consensus       351 A~GkayHp~CF~Cv~C~r~ld--gipFtvd~~n~v~Cv~dfh~kfAP--rCs~C~~PI~P~~G~~etvRvvamdr~fHv~  426 (468)
T KOG1701|consen  351 ALGKAYHPGCFTCVVCARCLD--GIPFTVDSQNNVYCVPDFHKKFAP--RCSVCGNPILPRDGKDETVRVVAMDRDFHVN  426 (468)
T ss_pred             hcccccCCCceEEEEeccccC--CccccccCCCceeeehhhhhhcCc--chhhccCCccCCCCCcceEEEEEcccccccc
Confidence            799999999999999999995  456774 77889999999999999  99999999986431     466889999999


Q ss_pred             ccccccCCcccc---cCCeEEeeCCeeecHHhHHhhh
Q psy12215         75 CFACQQCNHRFC---VGDRFYLCDNKILCEYDYEERQ  108 (155)
Q Consensus        75 Cf~C~~C~~~l~---~~~~~~~~~~~~~C~~c~~~~~  108 (155)
                      |++|..|+..|+   ++..++..||.++|+.|..++.
T Consensus       427 CY~CEDCg~~LS~e~e~qgCyPld~HllCk~Ch~~Rl  463 (468)
T KOG1701|consen  427 CYKCEDCGLLLSSEEEGQGCYPLDGHLLCKTCHLKRL  463 (468)
T ss_pred             ceehhhcCccccccCCCCcceeccCceeechhhhhhh
Confidence            999999999995   4556899999999999988765


No 5  
>KOG1044|consensus
Probab=99.82  E-value=5.2e-21  Score=153.08  Aligned_cols=135  Identities=20%  Similarity=0.459  Sum_probs=116.5

Q ss_pred             CCCccccccCcccccCCcccccCCCeEEEeCCeeecccchhccc-------cccccccccccccccCceEEeccCccccc
Q psy12215          1 ALDLFWHEDCLKCGCCDCRLGEVGSTLYQKANLILCKRDYLRLF-------GTTGYCAACTKVIPAFEMVMRAKNNVYHL   73 (155)
Q Consensus         1 A~~~~~H~~Cf~C~~C~~~l~~~~~~~~~~~~~~~C~~c~~~~~-------~~~~~C~~C~~~I~~~~~~~~~~~~~~H~   73 (155)
                      |+|++||+.||.|+.|..++.++ ...........|+.|..-..       ++ ..|++|++.|.. ..++.++++.||.
T Consensus        82 a~gktyh~~cf~cs~ck~pf~~g-~~vt~~gk~~~c~~c~~~~~~~p~~~~~p-s~cagc~~~lk~-gq~llald~qwhv  158 (670)
T KOG1044|consen   82 TLGKTYHPKCFSCSTCKSPFKSG-DKVTFSGKECLCQTCSQPMPVSPAESYGP-STCAGCGEELKN-GQALLALDKQWHV  158 (670)
T ss_pred             cccceeccccceecccCCCCCCC-CeeeecchhhhhhhhcCcccCCcccccCC-ccccchhhhhhc-cceeeeeccceee
Confidence            68999999999999999999864 35566666788888874321       22 269999999986 4677899999999


Q ss_pred             cccccccCCcccccCCeEEeeCCeeecHHhHHhhhcccCCCeeeecCCeecchhhHHHHHHHHhhcCCCCchHHHh
Q psy12215         74 ECFACQQCNHRFCVGDRFYLCDNKILCEYDYEERQVFCVGDRFYLCDNKILCEYDYEERQVFANIAYNPSSLAHLR  149 (155)
Q Consensus        74 ~Cf~C~~C~~~l~~~~~~~~~~~~~~C~~c~~~~~~~~~~~~c~~c~~~i~c~~~~~~~~~~~~~~~hp~~~~~~~  149 (155)
                      .||+|..|...|  ...|+..+|.+||..+|...|    |.+|..|.+-|.     ++.++..|++|||.++|.+|
T Consensus       159 ~cfkc~~c~~vL--~gey~skdg~pyce~dy~~~f----gvkc~~c~~fis-----gkvLqag~kh~HPtCARCsR  223 (670)
T KOG1044|consen  159 SCFKCKSCSAVL--NGEYMSKDGVPYCEKDYQAKF----GVKCEECEKFIS-----GKVLQAGDKHFHPTCARCSR  223 (670)
T ss_pred             eeeehhhhcccc--cceeeccCCCcchhhhhhhhc----CeehHHhhhhhh-----hhhhhccCcccCcchhhhhh
Confidence            999999999999  667999999999999999999    999999999888     88999999999999998876


No 6  
>KOG1703|consensus
Probab=99.78  E-value=4e-20  Score=150.36  Aligned_cols=130  Identities=20%  Similarity=0.416  Sum_probs=116.0

Q ss_pred             CCCccccccCcccccCCcccccCCCeEEEeCCeeecccchhccccccccccccccccccCceEEeccCcccccccccccc
Q psy12215          1 ALDLFWHEDCLKCGCCDCRLGEVGSTLYQKANLILCKRDYLRLFGTTGYCAACTKVIPAFEMVMRAKNNVYHLECFACQQ   80 (155)
Q Consensus         1 A~~~~~H~~Cf~C~~C~~~l~~~~~~~~~~~~~~~C~~c~~~~~~~~~~C~~C~~~I~~~~~~~~~~~~~~H~~Cf~C~~   80 (155)
                      |+++.||+.+|.|..|...+..  ..+...+|++||.+|+...+.+  .|.+|.++|.+  ..|.+.+..||++||.|..
T Consensus       321 ~~~~~~h~~~~~c~~~~~~~~~--~~~~~~~g~~~c~~~~~~~~~p--~C~~C~~~i~~--~~v~a~~~~wH~~cf~C~~  394 (479)
T KOG1703|consen  321 ALGKEWHPEHFSCEVCAIVILD--GGPRELDGKILCHECFHAPFRP--NCKRCLLPILE--EGVCALGRLWHPECFVCAD  394 (479)
T ss_pred             eccccccccceeeccccccccC--CCccccCCCccHHHHHHHhhCc--cccccCCchHH--hHhhhccCeechhceeeec
Confidence            6889999999999999999954  4578999999999999999999  99999999986  6778889999999999999


Q ss_pred             CCcccccCCeEEeeCCeeecHHhHHhhhcccCCCeeeecCCeecchhhHHHHHHHHhhcCCCCc
Q psy12215         81 CNHRFCVGDRFYLCDNKILCEYDYEERQVFCVGDRFYLCDNKILCEYDYEERQVFANIAYNPSS  144 (155)
Q Consensus        81 C~~~l~~~~~~~~~~~~~~C~~c~~~~~~~~~~~~c~~c~~~i~c~~~~~~~~~~~~~~~hp~~  144 (155)
                      |.+++ .+..|+..++.+||..||.+++    +.+|..|..++.   ..+..+...|..||+..
T Consensus       395 C~~~~-~~~~~~~~~~~pyce~~~~~~~----~~~~~~~~~p~~---~~~~~ie~~~~~~h~~~  450 (479)
T KOG1703|consen  395 CGKPL-KNSSFFESDGEPYCEDHYKKLF----TTKCDYCKKPVE---FGSRQIEADGSPFHGDC  450 (479)
T ss_pred             ccCCC-CCCcccccCCccchhhhHhhhc----cccchhccchhH---hhhhHhhccCccccccc
Confidence            99999 8888999999999999999999    788999988654   33677888888999874


No 7  
>KOG2272|consensus
Probab=99.77  E-value=3.5e-20  Score=135.43  Aligned_cols=125  Identities=25%  Similarity=0.438  Sum_probs=113.0

Q ss_pred             CccccccCcccccCCcccccCCCeEEEeCCeeecccchhccccccccccccccccccCceEEeccCccccccccccccCC
Q psy12215          3 DLFWHEDCLKCGCCDCRLGEVGSTLYQKANLILCKRDYLRLFGTTGYCAACTKVIPAFEMVMRAKNNVYHLECFACQQCN   82 (155)
Q Consensus         3 ~~~~H~~Cf~C~~C~~~l~~~~~~~~~~~~~~~C~~c~~~~~~~~~~C~~C~~~I~~~~~~~~~~~~~~H~~Cf~C~~C~   82 (155)
                      |..||+-+|+|+.|++.|++.   -....|.+||..|+.+.--|  .|..|.++|.  ++++.+.|+.||.++|+|..|.
T Consensus       156 ~d~yH~yHFkCt~C~keL~sd---aRevk~eLyClrChD~mgip--iCgaC~rpIe--ervi~amgKhWHveHFvCa~Ce  228 (332)
T KOG2272|consen  156 GDPYHPYHFKCTTCGKELTSD---AREVKGELYCLRCHDKMGIP--ICGACRRPIE--ERVIFAMGKHWHVEHFVCAKCE  228 (332)
T ss_pred             CCCCCccceecccccccccch---hhhhccceeccccccccCCc--ccccccCchH--HHHHHHhccccchhheeehhcC
Confidence            678999999999999999643   34677899999999988777  8999999996  5788999999999999999999


Q ss_pred             cccccCCeEEeeCCeeecHHhHHhhhcccCCCeeeecCCeecchhhHHHHHHHHhhcCCCCc
Q psy12215         83 HRFCVGDRFYLCDNKILCEYDYEERQVFCVGDRFYLCDNKILCEYDYEERQVFANIAYNPSS  144 (155)
Q Consensus        83 ~~l~~~~~~~~~~~~~~C~~c~~~~~~~~~~~~c~~c~~~i~c~~~~~~~~~~~~~~~hp~~  144 (155)
                      +++ -|-+-+.+.|..||+.+|.+++    |..|++|+..|-     ++.+.+.+++|-|+.
T Consensus       229 kPF-lGHrHYEkkGlaYCe~h~~qLf----G~~CF~C~~~i~-----G~vv~al~KawCv~c  280 (332)
T KOG2272|consen  229 KPF-LGHRHYEKKGLAYCETHYHQLF----GNLCFICNRVIG-----GDVVSALNKAWCVEC  280 (332)
T ss_pred             Ccc-cchhhhhhcCchhHHHHHHHHh----hhhheecCCccC-----ccHHHHhhhhhcccc
Confidence            999 8888999999999999999999    999999999998     788888888888763


No 8  
>KOG1044|consensus
Probab=99.70  E-value=2e-18  Score=138.35  Aligned_cols=98  Identities=32%  Similarity=0.707  Sum_probs=91.1

Q ss_pred             CCCccccccCcccccCCcccccCCCeEEEeCCeeecccchhccccccccccccccccccCceEEeccCcccccccccccc
Q psy12215          1 ALDLFWHEDCLKCGCCDCRLGEVGSTLYQKANLILCKRDYLRLFGTTGYCAACTKVIPAFEMVMRAKNNVYHLECFACQQ   80 (155)
Q Consensus         1 A~~~~~H~~Cf~C~~C~~~l~~~~~~~~~~~~~~~C~~c~~~~~~~~~~C~~C~~~I~~~~~~~~~~~~~~H~~Cf~C~~   80 (155)
                      |+++.||..||+|..|+..|.   ..|..+||.+||+.||...|+.  +|..|.+.|.+  .++.+.+++||+.|-+|+.
T Consensus       151 ald~qwhv~cfkc~~c~~vL~---gey~skdg~pyce~dy~~~fgv--kc~~c~~fisg--kvLqag~kh~HPtCARCsR  223 (670)
T KOG1044|consen  151 ALDKQWHVSCFKCKSCSAVLN---GEYMSKDGVPYCEKDYQAKFGV--KCEECEKFISG--KVLQAGDKHFHPTCARCSR  223 (670)
T ss_pred             eeccceeeeeeehhhhccccc---ceeeccCCCcchhhhhhhhcCe--ehHHhhhhhhh--hhhhccCcccCcchhhhhh
Confidence            789999999999999999994   3599999999999999999999  99999999987  7889999999999999999


Q ss_pred             CCcccccCCeEEeeCCeeecHHhHH
Q psy12215         81 CNHRFCVGDRFYLCDNKILCEYDYE  105 (155)
Q Consensus        81 C~~~l~~~~~~~~~~~~~~C~~c~~  105 (155)
                      |+..+..|+..++.++.++-..|-.
T Consensus       224 CgqmF~eGEEMYlQGs~iWHP~C~q  248 (670)
T KOG1044|consen  224 CGQMFGEGEEMYLQGSEIWHPDCKQ  248 (670)
T ss_pred             hccccccchheeeccccccCCcccc
Confidence            9999999999999999999777743


No 9  
>KOG1703|consensus
Probab=99.63  E-value=4.3e-17  Score=132.72  Aligned_cols=99  Identities=27%  Similarity=0.672  Sum_probs=90.8

Q ss_pred             CCCccccccCcccccCCcccccCCCeEEEeCCeeecccchhccccccccccccccccccCceEEeccCcccccccccccc
Q psy12215          1 ALDLFWHEDCLKCGCCDCRLGEVGSTLYQKANLILCKRDYLRLFGTTGYCAACTKVIPAFEMVMRAKNNVYHLECFACQQ   80 (155)
Q Consensus         1 A~~~~~H~~Cf~C~~C~~~l~~~~~~~~~~~~~~~C~~c~~~~~~~~~~C~~C~~~I~~~~~~~~~~~~~~H~~Cf~C~~   80 (155)
                      |++..||+.||+|..|.++|  ....|+..+|.+||+.||.+++.+  +|..|..++...+..+.+.+..||..||+|..
T Consensus       380 a~~~~wH~~cf~C~~C~~~~--~~~~~~~~~~~pyce~~~~~~~~~--~~~~~~~p~~~~~~~ie~~~~~~h~~~F~c~~  455 (479)
T KOG1703|consen  380 ALGRLWHPECFVCADCGKPL--KNSSFFESDGEPYCEDHYKKLFTT--KCDYCKKPVEFGSRQIEADGSPFHGDCFRCAN  455 (479)
T ss_pred             hccCeechhceeeecccCCC--CCCcccccCCccchhhhHhhhccc--cchhccchhHhhhhHhhccCccccccceehhh
Confidence            67899999999999999999  556799999999999999999997  89999999875567889999999999999999


Q ss_pred             CCcccccCCeEEeeCCeeecHHhH
Q psy12215         81 CNHRFCVGDRFYLCDNKILCEYDY  104 (155)
Q Consensus        81 C~~~l~~~~~~~~~~~~~~C~~c~  104 (155)
                      |...| .+..|+...++++|..|+
T Consensus       456 c~~~l-~~~~~~~~~~~p~c~~~~  478 (479)
T KOG1703|consen  456 CMKKL-TKKTFFETLDKPLCQKHF  478 (479)
T ss_pred             hhccc-cCCceeecCCccccccCC
Confidence            99999 888999999999998875


No 10 
>PF00412 LIM:  LIM domain;  InterPro: IPR001781 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents LIM-type zinc finger (Znf) domains. LIM domains coordinate one or more zinc atoms, and are named after the three proteins (LIN-11, Isl1 and MEC-3) in which they were first found. They consist of two zinc-binding motifs that resemble GATA-like Znf's, however the residues holding the zinc atom(s) are variable, involving Cys, His, Asp or Glu residues. LIM domains are involved in proteins with differing functions, including gene expression, and cytoskeleton organisation and development [, ]. Protein containing LIM Znf domains include:    Caenorhabditis elegans mec-3; a protein required for the differentiation of the set of six touch receptor neurons in this nematode. C. elegans. lin-11; a protein required for the asymmetric division of vulval blast cells. Vertebrate insulin gene enhancer binding protein isl-1. Isl-1 binds to one of the two cis-acting protein-binding domains of the insulin gene. Vertebrate homeobox proteins lim-1, lim-2 (lim-5) and lim3. Vertebrate lmx-1, which acts as a transcriptional activator by binding to the FLAT element; a beta-cell-specific transcriptional enhancer found in the insulin gene. Mammalian LH-2, a transcriptional regulatory protein involved in the control of cell differentiation in developing lymphoid and neural cell types.  Drosophila melanogaster (Fruit fly) protein apterous, required for the normal development of the wing and halter imaginal discs. Vertebrate protein kinases LIMK-1 and LIMK-2. Mammalian rhombotins. Rhombotin 1 (RBTN1 or TTG-1) and rhombotin-2 (RBTN2 or TTG-2) are proteins of about 160 amino acids whose genes are disrupted by chromosomal translocations in T-cell leukemia. Mammalian and avian cysteine-rich protein (CRP), a 192 amino-acid protein of unknown function. Seems to interact with zyxin. Mammalian cysteine-rich intestinal protein (CRIP), a small protein which seems to have a role in zinc absorption and may function as an intracellular zinc transport protein. Vertebrate paxillin, a cytoskeletal focal adhesion protein.  Mus musculus (Mouse) testin which should not be confused with rat testin which is a thiol protease homologue (see IPR000169 from INTERPRO).  Helianthus annuus (Common sunflower) pollen specific protein SF3. Chicken zyxin. Zyxin is a low-abundance adhesion plaque protein which has been shown to interact with CRP. Yeast protein LRG1 which is involved in sporulation [].  Saccharomyces cerevisiae (Baker's yeast) rho-type GTPase activating protein RGA1/DBM1. C. elegans homeobox protein ceh-14. C. elegans homeobox protein unc-97. S. cerevisiae hypothetical protein YKR090w. C. elegans hypothetical proteins C28H8.6.   These proteins generally contain two tandem copies of the LIM domain in their N-terminal section. Zyxin and paxillin are exceptions in that they contain respectively three and four LIM domains at their C-terminal extremity. In apterous, isl-1, LH-2, lin-11, lim-1 to lim-3, lmx-1 and ceh-14 and mec-3 there is a homeobox domain some 50 to 95 amino acids after the LIM domains. LIM domains contain seven conserved cysteine residues and a histidine. The arrangement followed by these conserved residues is:  C-x(2)-C-x(16,23)-H-x(2)-[CH]-x(2)-C-x(2)-C-x(16,21)-C-x(2,3)-[CHD]  LIM domains bind two zinc ions []. LIM does not bind DNA, rather it seems to act as an interface for protein-protein interaction. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 2CO8_A 2EGQ_A 2CUR_A 3IXE_B 1CTL_A 1B8T_A 1X62_A 2DFY_C 1IML_A 2CUQ_A ....
Probab=99.56  E-value=7.3e-15  Score=86.51  Aligned_cols=58  Identities=36%  Similarity=0.745  Sum_probs=52.2

Q ss_pred             ccccccccccCceEEeccCccccccccccccCCcccccCCeEEeeCCeeecHHhHHhhh
Q psy12215         50 CAACTKVIPAFEMVMRAKNNVYHLECFACQQCNHRFCVGDRFYLCDNKILCEYDYEERQ  108 (155)
Q Consensus        50 C~~C~~~I~~~~~~~~~~~~~~H~~Cf~C~~C~~~l~~~~~~~~~~~~~~C~~c~~~~~  108 (155)
                      |.+|+++|.+.+.++.+.++.||++||+|..|+++| .+..++..++++||..||.++|
T Consensus         1 C~~C~~~I~~~~~~~~~~~~~~H~~Cf~C~~C~~~l-~~~~~~~~~~~~~C~~c~~~~f   58 (58)
T PF00412_consen    1 CARCGKPIYGTEIVIKAMGKFWHPECFKCSKCGKPL-NDGDFYEKDGKPYCKDCYQKRF   58 (58)
T ss_dssp             BTTTSSBESSSSEEEEETTEEEETTTSBETTTTCBT-TTSSEEEETTEEEEHHHHHHHT
T ss_pred             CCCCCCCccCcEEEEEeCCcEEEccccccCCCCCcc-CCCeeEeECCEEECHHHHhhhC
Confidence            789999999877777899999999999999999999 5555999999999999999875


No 11 
>KOG4577|consensus
Probab=99.29  E-value=1.6e-13  Score=102.36  Aligned_cols=95  Identities=20%  Similarity=0.517  Sum_probs=78.4

Q ss_pred             cccccccccccCceEEeccCccccccccccccCCcccccCCeEEeeCCeeecHHhHHhhhcccCCCeeeecCCeecchhh
Q psy12215         49 YCAACTKVIPAFEMVMRAKNNVYHLECFACQQCNHRFCVGDRFYLCDNKILCEYDYEERQVFCVGDRFYLCDNKILCEYD  128 (155)
Q Consensus        49 ~C~~C~~~I~~~~~~~~~~~~~~H~~Cf~C~~C~~~l~~~~~~~~~~~~~~C~~c~~~~~~~~~~~~c~~c~~~i~c~~~  128 (155)
                      .|++|.+.|.+ ..++.++++.||..|++|+.|..+|  +.+++.+++.+||+.+|.++|    |.+|..|+.-|...+.
T Consensus        35 ~CagC~q~IlD-rFilKvl~R~wHs~CLkCs~C~~qL--~drCFsR~~s~yCkedFfKrf----GTKCsaC~~GIpPtqV  107 (383)
T KOG4577|consen   35 ICAGCDQHILD-RFILKVLDRHWHSSCLKCSDCHDQL--ADRCFSREGSVYCKEDFFKRF----GTKCSACQEGIPPTQV  107 (383)
T ss_pred             cccchHHHHHH-HHHHHHHhhhhhhhhcchhhhhhHH--HHHHhhcCCceeehHHHHHHh----CCcchhhcCCCChHHH
Confidence            79999999986 5688899999999999999999999  788999999999999999999    9999999999984443


Q ss_pred             HHHHHHHHhhcCCCCc--hHHHhhhhh
Q psy12215        129 YEERQVFANIAYNPSS--LAHLRRQVT  153 (155)
Q Consensus       129 ~~~~~~~~~~~~hp~~--~~~~~~~~~  153 (155)
                      ..+.   ...+||=.+  +-..+++|.
T Consensus       108 VRkA---qd~VYHl~CF~C~iC~R~L~  131 (383)
T KOG4577|consen  108 VRKA---QDFVYHLHCFACFICKRQLA  131 (383)
T ss_pred             HHHh---hcceeehhhhhhHhhhcccc
Confidence            3222   223788643  555566654


No 12 
>PF00412 LIM:  LIM domain;  InterPro: IPR001781 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents LIM-type zinc finger (Znf) domains. LIM domains coordinate one or more zinc atoms, and are named after the three proteins (LIN-11, Isl1 and MEC-3) in which they were first found. They consist of two zinc-binding motifs that resemble GATA-like Znf's, however the residues holding the zinc atom(s) are variable, involving Cys, His, Asp or Glu residues. LIM domains are involved in proteins with differing functions, including gene expression, and cytoskeleton organisation and development [, ]. Protein containing LIM Znf domains include:    Caenorhabditis elegans mec-3; a protein required for the differentiation of the set of six touch receptor neurons in this nematode. C. elegans. lin-11; a protein required for the asymmetric division of vulval blast cells. Vertebrate insulin gene enhancer binding protein isl-1. Isl-1 binds to one of the two cis-acting protein-binding domains of the insulin gene. Vertebrate homeobox proteins lim-1, lim-2 (lim-5) and lim3. Vertebrate lmx-1, which acts as a transcriptional activator by binding to the FLAT element; a beta-cell-specific transcriptional enhancer found in the insulin gene. Mammalian LH-2, a transcriptional regulatory protein involved in the control of cell differentiation in developing lymphoid and neural cell types.  Drosophila melanogaster (Fruit fly) protein apterous, required for the normal development of the wing and halter imaginal discs. Vertebrate protein kinases LIMK-1 and LIMK-2. Mammalian rhombotins. Rhombotin 1 (RBTN1 or TTG-1) and rhombotin-2 (RBTN2 or TTG-2) are proteins of about 160 amino acids whose genes are disrupted by chromosomal translocations in T-cell leukemia. Mammalian and avian cysteine-rich protein (CRP), a 192 amino-acid protein of unknown function. Seems to interact with zyxin. Mammalian cysteine-rich intestinal protein (CRIP), a small protein which seems to have a role in zinc absorption and may function as an intracellular zinc transport protein. Vertebrate paxillin, a cytoskeletal focal adhesion protein.  Mus musculus (Mouse) testin which should not be confused with rat testin which is a thiol protease homologue (see IPR000169 from INTERPRO).  Helianthus annuus (Common sunflower) pollen specific protein SF3. Chicken zyxin. Zyxin is a low-abundance adhesion plaque protein which has been shown to interact with CRP. Yeast protein LRG1 which is involved in sporulation [].  Saccharomyces cerevisiae (Baker's yeast) rho-type GTPase activating protein RGA1/DBM1. C. elegans homeobox protein ceh-14. C. elegans homeobox protein unc-97. S. cerevisiae hypothetical protein YKR090w. C. elegans hypothetical proteins C28H8.6.   These proteins generally contain two tandem copies of the LIM domain in their N-terminal section. Zyxin and paxillin are exceptions in that they contain respectively three and four LIM domains at their C-terminal extremity. In apterous, isl-1, LH-2, lin-11, lim-1 to lim-3, lmx-1 and ceh-14 and mec-3 there is a homeobox domain some 50 to 95 amino acids after the LIM domains. LIM domains contain seven conserved cysteine residues and a histidine. The arrangement followed by these conserved residues is:  C-x(2)-C-x(16,23)-H-x(2)-[CH]-x(2)-C-x(2)-C-x(16,21)-C-x(2,3)-[CHD]  LIM domains bind two zinc ions []. LIM does not bind DNA, rather it seems to act as an interface for protein-protein interaction. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 2CO8_A 2EGQ_A 2CUR_A 3IXE_B 1CTL_A 1B8T_A 1X62_A 2DFY_C 1IML_A 2CUQ_A ....
Probab=99.27  E-value=1.9e-12  Score=76.12  Aligned_cols=42  Identities=36%  Similarity=0.863  Sum_probs=37.5

Q ss_pred             CCCccccccCcccccCCcccccCCCeEEEeCCeeecccchhccc
Q psy12215          1 ALDLFWHEDCLKCGCCDCRLGEVGSTLYQKANLILCKRDYLRLF   44 (155)
Q Consensus         1 A~~~~~H~~Cf~C~~C~~~l~~~~~~~~~~~~~~~C~~c~~~~~   44 (155)
                      |+|+.||++||+|+.|+++|.+  ..|+..+|++||++||.++|
T Consensus        17 ~~~~~~H~~Cf~C~~C~~~l~~--~~~~~~~~~~~C~~c~~~~f   58 (58)
T PF00412_consen   17 AMGKFWHPECFKCSKCGKPLND--GDFYEKDGKPYCKDCYQKRF   58 (58)
T ss_dssp             ETTEEEETTTSBETTTTCBTTT--SSEEEETTEEEEHHHHHHHT
T ss_pred             eCCcEEEccccccCCCCCccCC--CeeEeECCEEECHHHHhhhC
Confidence            5789999999999999999964  44999999999999998865


No 13 
>KOG1700|consensus
Probab=99.11  E-value=1.3e-11  Score=89.97  Aligned_cols=103  Identities=23%  Similarity=0.564  Sum_probs=85.2

Q ss_pred             CCccccccCcccccCCcccccCCCeEEEeCCeeecccchhccccccc---------------------------------
Q psy12215          2 LDLFWHEDCLKCGCCDCRLGEVGSTLYQKANLILCKRDYLRLFGTTG---------------------------------   48 (155)
Q Consensus         2 ~~~~~H~~Cf~C~~C~~~l~~~~~~~~~~~~~~~C~~c~~~~~~~~~---------------------------------   48 (155)
                      .|..||..||.|..|.+.|..  ..+...++.+||+.+|...+++.+                                 
T Consensus        26 ~g~~~hk~c~~c~~~~k~l~~--~~~~~~e~~~yc~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  103 (200)
T KOG1700|consen   26 DGVDFHKECFKCEKCKKTLTL--SGYSEHEGVPYCKNCHVAQFGPKGGGFGKGFQKAGGLGKDGKSLNESKPNQSAKFQV  103 (200)
T ss_pred             cCcchhhhHHhcccccccccc--ccccccccccccccchHhhhCcccccccccccccCCCCcccccccccccccchhHHh
Confidence            478999999999999999964  457889999999998755554421                                 


Q ss_pred             ------cccccccccccCceEEeccCccccccccccccCCcccccCCeEEeeCCeeecHHhHHhhh
Q psy12215         49 ------YCAACTKVIPAFEMVMRAKNNVYHLECFACQQCNHRFCVGDRFYLCDNKILCEYDYEERQ  108 (155)
Q Consensus        49 ------~C~~C~~~I~~~~~~~~~~~~~~H~~Cf~C~~C~~~l~~~~~~~~~~~~~~C~~c~~~~~  108 (155)
                            .|..|++.+++.+.+ ...+..||..||+|..|+..| ....+....+.++|..++...+
T Consensus       104 ~~g~~~~c~~c~k~vy~~Ek~-~~~~~~~hk~cfrc~~~~~~l-s~~~~~~~~g~l~~~~~~~~~~  167 (200)
T KOG1700|consen  104 FAGEKEKCARCQKTVYPLEKV-TGNGLEFHKSCFRCTHCGKKL-SPKNYAALEGVLYCKHHFAQLF  167 (200)
T ss_pred             hhccccccccccceeeehHHH-hhhhhhhhhhheeeccccccc-CCcchhhcCCccccchhhheee
Confidence                  299999999986655 677999999999999999999 6777888888999988876654


No 14 
>smart00132 LIM Zinc-binding domain present in Lin-11, Isl-1, Mec-3. Zinc-binding domain family. Some LIM domains bind protein partners via tyrosine-containing motifs. LIM domains are found in many key regulators of developmental pathways.
Probab=98.68  E-value=1.4e-08  Score=54.38  Aligned_cols=37  Identities=43%  Similarity=0.909  Sum_probs=33.3

Q ss_pred             cccccccccccCceEEeccCccccccccccccCCccc
Q psy12215         49 YCAACTKVIPAFEMVMRAKNNVYHLECFACQQCNHRF   85 (155)
Q Consensus        49 ~C~~C~~~I~~~~~~~~~~~~~~H~~Cf~C~~C~~~l   85 (155)
                      +|.+|+++|.+.+..+.+.+..||+.||+|..|+++|
T Consensus         1 ~C~~C~~~i~~~~~~~~~~~~~~H~~Cf~C~~C~~~L   37 (39)
T smart00132        1 KCAGCGKPIRGGELVLRALGKVWHPECFKCSKCGKPL   37 (39)
T ss_pred             CccccCCcccCCcEEEEeCCccccccCCCCcccCCcC
Confidence            4889999998855778889999999999999999988


No 15 
>KOG0490|consensus
Probab=97.87  E-value=1.9e-06  Score=63.86  Aligned_cols=101  Identities=40%  Similarity=0.738  Sum_probs=82.5

Q ss_pred             CccccccCcccccCCcccccCCCeEEEeCCeeecccchhc--cccccccccccccccccCceEEeccCcccccccccccc
Q psy12215          3 DLFWHEDCLKCGCCDCRLGEVGSTLYQKANLILCKRDYLR--LFGTTGYCAACTKVIPAFEMVMRAKNNVYHLECFACQQ   80 (155)
Q Consensus         3 ~~~~H~~Cf~C~~C~~~l~~~~~~~~~~~~~~~C~~c~~~--~~~~~~~C~~C~~~I~~~~~~~~~~~~~~H~~Cf~C~~   80 (155)
                      +..||..|..|..|..+|.... ..+..+|..||..+|..  .+..  +|.+|...+...+.+..+..+. |..||.|..
T Consensus        16 ~~~~~~~~~~~~~~~~~~~~~~-~~~~~~g~~~~~~d~~~~~~~~~--rr~rt~~~~~ql~~ler~f~~~-h~Pd~~~r~   91 (235)
T KOG0490|consen   16 DRYWHASCLKCAECDNPLGVGD-TCFSKDGSIYCKRDYQREFKFSK--RCARCKFTISQLDELERAFEKV-HLPCFACRE   91 (235)
T ss_pred             cHHHHHHHHhhhhhcchhccCC-CcccCCCcccccccchhhhhccc--cccCCCCCcCHHHHHHHhhcCC-CcCccchHH
Confidence            5789999999999999996333 34544999999999998  5554  8999999997667777777777 999999999


Q ss_pred             CCcccccCCeEEeeCC-eeecHHhHHhh
Q psy12215         81 CNHRFCVGDRFYLCDN-KILCEYDYEER  107 (155)
Q Consensus        81 C~~~l~~~~~~~~~~~-~~~C~~c~~~~  107 (155)
                      |...+..+..+.+... +..|...+...
T Consensus        92 ~la~~~~~~e~rVqvwFqnrrak~r~~~  119 (235)
T KOG0490|consen   92 CLALLLTGDEFRVQVWFQNRRAKDRKEE  119 (235)
T ss_pred             HHhhcCCCCeeeeehhhhhhcHhhhhhh
Confidence            9998767777877775 88898887554


No 16 
>smart00132 LIM Zinc-binding domain present in Lin-11, Isl-1, Mec-3. Zinc-binding domain family. Some LIM domains bind protein partners via tyrosine-containing motifs. LIM domains are found in many key regulators of developmental pathways.
Probab=97.76  E-value=1e-05  Score=42.93  Aligned_cols=20  Identities=45%  Similarity=1.076  Sum_probs=18.4

Q ss_pred             CCCccccccCcccccCCccc
Q psy12215          1 ALDLFWHEDCLKCGCCDCRL   20 (155)
Q Consensus         1 A~~~~~H~~Cf~C~~C~~~l   20 (155)
                      ++++.||+.||+|..|+.+|
T Consensus        18 ~~~~~~H~~Cf~C~~C~~~L   37 (39)
T smart00132       18 ALGKVWHPECFKCSKCGKPL   37 (39)
T ss_pred             eCCccccccCCCCcccCCcC
Confidence            46889999999999999998


No 17 
>KOG1702|consensus
Probab=97.42  E-value=9.6e-06  Score=58.52  Aligned_cols=58  Identities=24%  Similarity=0.529  Sum_probs=48.8

Q ss_pred             cccccccccccCceEEeccCccccccccccccCCcccccCCeEEeeCCeeecHHhHHhhh
Q psy12215         49 YCAACTKVIPAFEMVMRAKNNVYHLECFACQQCNHRFCVGDRFYLCDNKILCEYDYEERQ  108 (155)
Q Consensus        49 ~C~~C~~~I~~~~~~~~~~~~~~H~~Cf~C~~C~~~l~~~~~~~~~~~~~~C~~c~~~~~  108 (155)
                      -|..|++.+++.+.+ ..+++.||..||+|..|+..| .-..+-..+.++||..+|.+..
T Consensus         6 n~~~cgk~vYPvE~v-~cldk~whk~cfkce~c~mtl-nmKnyKgy~kkpycn~hYpkq~   63 (264)
T KOG1702|consen    6 NREDCGKTVYPVEEV-KCLDKVWHKQCFKCEVCGMTL-NMKNYKGYDKKPYCNPHYPKQV   63 (264)
T ss_pred             hhhhhccccccHHHH-hhHHHHHHHHhheeeeccCCh-hhhhccccccCCCcCcccccce
Confidence            477889988886544 788999999999999999999 6666777889999999998654


No 18 
>KOG1700|consensus
Probab=97.26  E-value=5.9e-05  Score=55.11  Aligned_cols=58  Identities=22%  Similarity=0.469  Sum_probs=48.5

Q ss_pred             cccccccccccCceEEeccCccccccccccccCCcccccCCeEEeeCCeeecHHhHHhhh
Q psy12215         49 YCAACTKVIPAFEMVMRAKNNVYHLECFACQQCNHRFCVGDRFYLCDNKILCEYDYEERQ  108 (155)
Q Consensus        49 ~C~~C~~~I~~~~~~~~~~~~~~H~~Cf~C~~C~~~l~~~~~~~~~~~~~~C~~c~~~~~  108 (155)
                      +|..|++.++..+++ ...+..||..||+|..|.+.| ....+...++.+||+.++...+
T Consensus         9 kc~~c~k~vy~~e~~-~~~g~~~hk~c~~c~~~~k~l-~~~~~~~~e~~~yc~~~~~~~~   66 (200)
T KOG1700|consen    9 KCNACGKTVYFVEKV-QKDGVDFHKECFKCEKCKKTL-TLSGYSEHEGVPYCKNCHVAQF   66 (200)
T ss_pred             hhhhccCcchHHHHH-hccCcchhhhHHhcccccccc-ccccccccccccccccchHhhh
Confidence            799999999876555 477999999999999999999 6666777899999999665544


No 19 
>KOG1702|consensus
Probab=96.13  E-value=0.0008  Score=48.77  Aligned_cols=42  Identities=26%  Similarity=0.631  Sum_probs=35.8

Q ss_pred             CCccccccCcccccCCcccccCCCeEEEeCCeeecccchhcccc
Q psy12215          2 LDLFWHEDCLKCGCCDCRLGEVGSTLYQKANLILCKRDYLRLFG   45 (155)
Q Consensus         2 ~~~~~H~~Cf~C~~C~~~l~~~~~~~~~~~~~~~C~~c~~~~~~   45 (155)
                      +++.||..||+|..|+-+|+.  ..|-..+.++||...|.+..+
T Consensus        23 ldk~whk~cfkce~c~mtlnm--KnyKgy~kkpycn~hYpkq~a   64 (264)
T KOG1702|consen   23 LDKVWHKQCFKCEVCGMTLNM--KNYKGYDKKPYCNPHYPKQVA   64 (264)
T ss_pred             HHHHHHHHhheeeeccCChhh--hhccccccCCCcCccccccee
Confidence            468899999999999999964  457788999999999987654


No 20 
>KOG0490|consensus
Probab=93.48  E-value=0.027  Score=41.55  Aligned_cols=66  Identities=27%  Similarity=0.673  Sum_probs=48.2

Q ss_pred             cccccccCceEEeccCccccccccccccCCcccccCCeEEeeCCeeecHHhHHh--hhcccCCCeeeecCCee
Q psy12215         53 CTKVIPAFEMVMRAKNNVYHLECFACQQCNHRFCVGDRFYLCDNKILCEYDYEE--RQVFCVGDRFYLCDNKI  123 (155)
Q Consensus        53 C~~~I~~~~~~~~~~~~~~H~~Cf~C~~C~~~l~~~~~~~~~~~~~~C~~c~~~--~~~~~~~~~c~~c~~~i  123 (155)
                      |+..|.+ ...+.+.+..||..|..|..|...+......+..+|.++|...|.+  .+    ..+|..|...+
T Consensus         2 ~~~~~~~-~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~~~d~~~~~~~----~~rr~rt~~~~   69 (235)
T KOG0490|consen    2 CGRQILD-RYLLRVLDRYWHASCLKCAECDNPLGVGDTCFSKDGSIYCKRDYQREFKF----SKRCARCKFTI   69 (235)
T ss_pred             CCccccc-hHHhhcccHHHHHHHHhhhhhcchhccCCCcccCCCcccccccchhhhhc----cccccCCCCCc
Confidence            4556654 3445566899999999999999999433444444999999999987  44    66777766654


No 21 
>PF06677 Auto_anti-p27:  Sjogren's syndrome/scleroderma autoantigen 1 (Autoantigen p27);  InterPro: IPR009563 The proteins in this entry are functionally uncharacterised and include several proteins that characterise Sjogren's syndrome/scleroderma autoantigen 1 (Autoantigen p27). It is thought that the potential association of anti-p27 with anti-centromere antibodies suggests that autoantigen p27 might play a role in mitosis [].
Probab=87.80  E-value=0.39  Score=25.87  Aligned_cols=22  Identities=27%  Similarity=0.531  Sum_probs=16.4

Q ss_pred             ccccCCcccccCCCeEEEeCCeeecccc
Q psy12215         12 KCGCCDCRLGEVGSTLYQKANLILCKRD   39 (155)
Q Consensus        12 ~C~~C~~~l~~~~~~~~~~~~~~~C~~c   39 (155)
                      .|..|+.||      +-.++|++||..|
T Consensus        19 ~Cp~C~~PL------~~~k~g~~~Cv~C   40 (41)
T PF06677_consen   19 HCPDCGTPL------MRDKDGKIYCVSC   40 (41)
T ss_pred             ccCCCCCee------EEecCCCEECCCC
Confidence            577788888      3467888988765


No 22 
>PF11781 RRN7:  RNA polymerase I-specific transcription initiation factor Rrn7;  InterPro: IPR021752  Rrn7 is a transcription binding factor that associates strongly with both Rrn6 and Rrn11 to form a complex which itself binds the TATA-binding protein and is required for transcription by the core domain of the RNA PolI promoter [],[]. 
Probab=86.75  E-value=0.49  Score=24.72  Aligned_cols=24  Identities=25%  Similarity=0.580  Sum_probs=18.1

Q ss_pred             ccccCCcccccCCCeEEEeCCeeecccchh
Q psy12215         12 KCGCCDCRLGEVGSTLYQKANLILCKRDYL   41 (155)
Q Consensus        12 ~C~~C~~~l~~~~~~~~~~~~~~~C~~c~~   41 (155)
                      .|..|+..      .|...||..||..|..
T Consensus        10 ~C~~C~~~------~~~~~dG~~yC~~cG~   33 (36)
T PF11781_consen   10 PCPVCGSR------WFYSDDGFYYCDRCGH   33 (36)
T ss_pred             cCCCCCCe------EeEccCCEEEhhhCce
Confidence            47777554      4789999999987754


No 23 
>smart00504 Ubox Modified RING finger domain. Modified RING finger domain, without the full complement of Zn2+-binding ligands. Probable involvement in E2-dependent ubiquitination.
Probab=86.70  E-value=0.43  Score=27.59  Aligned_cols=46  Identities=7%  Similarity=0.046  Sum_probs=35.0

Q ss_pred             cccccCCcccccCCCeEEEeCCeeecccchhcccccccccccccccccc
Q psy12215         11 LKCGCCDCRLGEVGSTLYQKANLILCKRDYLRLFGTTGYCAACTKVIPA   59 (155)
Q Consensus        11 f~C~~C~~~l~~~~~~~~~~~~~~~C~~c~~~~~~~~~~C~~C~~~I~~   59 (155)
                      |.|..|+..+.+   ......|..||++|..+.+...+.|..|++++..
T Consensus         2 ~~Cpi~~~~~~~---Pv~~~~G~v~~~~~i~~~~~~~~~cP~~~~~~~~   47 (63)
T smart00504        2 FLCPISLEVMKD---PVILPSGQTYERRAIEKWLLSHGTDPVTGQPLTH   47 (63)
T ss_pred             cCCcCCCCcCCC---CEECCCCCEEeHHHHHHHHHHCCCCCCCcCCCCh
Confidence            678899998853   4667889999999988765434479888888854


No 24 
>PF08394 Arc_trans_TRASH:  Archaeal TRASH domain;  InterPro: IPR013603 This region is found in the C terminus of a number of archaeal transcriptional regulators. It is thought to function as a metal-sensing regulatory module []. 
Probab=86.40  E-value=0.42  Score=25.15  Aligned_cols=24  Identities=29%  Similarity=0.563  Sum_probs=15.6

Q ss_pred             ccccccccccCceEEeccCccccc
Q psy12215         50 CAACTKVIPAFEMVMRAKNNVYHL   73 (155)
Q Consensus        50 C~~C~~~I~~~~~~~~~~~~~~H~   73 (155)
                      |.-|+.+|.+.-.++...++.|+.
T Consensus         1 Cd~CG~~I~~eP~~~k~~~~~y~f   24 (37)
T PF08394_consen    1 CDYCGGEITGEPIVVKIGNKVYYF   24 (37)
T ss_pred             CCccCCcccCCEEEEEECCeEEEE
Confidence            566777777644455666777763


No 25 
>PF07191 zinc-ribbons_6:  zinc-ribbons;  InterPro: IPR010807 This family consists of several short, hypothetical bacterial proteins of around 70 residues in length. Members of this family 8 highly conserved cysteine residues. The function of the family is unknown.; PDB: 2JRP_A 2JNE_A.
Probab=84.44  E-value=2.1  Score=25.82  Aligned_cols=58  Identities=19%  Similarity=0.450  Sum_probs=30.4

Q ss_pred             ccccCCcccccCCCeEEEeCCeeecccchhccccccccccccccccccCceEEeccCccccccccccccCCccc
Q psy12215         12 KCGCCDCRLGEVGSTLYQKANLILCKRDYLRLFGTTGYCAACTKVIPAFEMVMRAKNNVYHLECFACQQCNHRF   85 (155)
Q Consensus        12 ~C~~C~~~l~~~~~~~~~~~~~~~C~~c~~~~~~~~~~C~~C~~~I~~~~~~~~~~~~~~H~~Cf~C~~C~~~l   85 (155)
                      .|..|..+|..       .++..+|..|...... ...|+.|++++    .++.+-|..=    |.|..|+..+
T Consensus         3 ~CP~C~~~L~~-------~~~~~~C~~C~~~~~~-~a~CPdC~~~L----e~LkACGAvd----YFC~~c~gLi   60 (70)
T PF07191_consen    3 TCPKCQQELEW-------QGGHYHCEACQKDYKK-EAFCPDCGQPL----EVLKACGAVD----YFCNHCHGLI   60 (70)
T ss_dssp             B-SSS-SBEEE-------ETTEEEETTT--EEEE-EEE-TTT-SB-----EEEEETTEEE----EE-TTTT-EE
T ss_pred             cCCCCCCccEE-------eCCEEECcccccccee-cccCCCcccHH----HHHHHhcccc----eeeccCCcee
Confidence            57788888843       3367788887765321 22799999999    3445555321    4677777766


No 26 
>PF06906 DUF1272:  Protein of unknown function (DUF1272);  InterPro: IPR010696 This family consists of several hypothetical bacterial proteins of around 80 residues in length. This family contains a number of conserved cysteine residues and its function is unknown.
Probab=83.39  E-value=1  Score=25.84  Aligned_cols=46  Identities=17%  Similarity=0.410  Sum_probs=32.6

Q ss_pred             ccccCCcccccCC-CeEEEeCCeeecccchhcccccccccccccccccc
Q psy12215         12 KCGCCDCRLGEVG-STLYQKANLILCKRDYLRLFGTTGYCAACTKVIPA   59 (155)
Q Consensus        12 ~C~~C~~~l~~~~-~~~~~~~~~~~C~~c~~~~~~~~~~C~~C~~~I~~   59 (155)
                      .|..|++.|...+ ..++-.-.=.||.+|....+..  +|..|+..+..
T Consensus         7 nCE~C~~dLp~~s~~A~ICSfECTFC~~C~e~~l~~--~CPNCgGelv~   53 (57)
T PF06906_consen    7 NCECCDKDLPPDSPEAYICSFECTFCADCAETMLNG--VCPNCGGELVR   53 (57)
T ss_pred             CccccCCCCCCCCCcceEEeEeCcccHHHHHHHhcC--cCcCCCCcccc
Confidence            3667888887433 3455444557899999988655  89999887753


No 27 
>COG1645 Uncharacterized Zn-finger containing protein [General function prediction only]
Probab=83.38  E-value=0.78  Score=31.18  Aligned_cols=23  Identities=22%  Similarity=0.427  Sum_probs=18.0

Q ss_pred             ccccCCcccccCCCeEEEeCCeeecccchh
Q psy12215         12 KCGCCDCRLGEVGSTLYQKANLILCKRDYL   41 (155)
Q Consensus        12 ~C~~C~~~l~~~~~~~~~~~~~~~C~~c~~   41 (155)
                      .|..|+.||      |- ++|.+||.-|-.
T Consensus        30 hCp~Cg~PL------F~-KdG~v~CPvC~~   52 (131)
T COG1645          30 HCPKCGTPL------FR-KDGEVFCPVCGY   52 (131)
T ss_pred             hCcccCCcc------ee-eCCeEECCCCCc
Confidence            478889988      44 999999877654


No 28 
>KOG1813|consensus
Probab=83.27  E-value=1.2  Score=34.41  Aligned_cols=50  Identities=18%  Similarity=0.382  Sum_probs=38.6

Q ss_pred             cccccCCcccccCCeEEeeCCeeecHHhHHhhhcccCCCeeeecCCeecchhhH
Q psy12215         76 FACQQCNHRFCVGDRFYLCDNKILCEYDYEERQVFCVGDRFYLCDNKILCEYDY  129 (155)
Q Consensus        76 f~C~~C~~~l~~~~~~~~~~~~~~C~~c~~~~~~~~~~~~c~~c~~~i~c~~~~  129 (155)
                      |.|..|.+.+  -......-+..+|..|..+.+  ..++.|++|++.+......
T Consensus       242 f~c~icr~~f--~~pVvt~c~h~fc~~ca~~~~--qk~~~c~vC~~~t~g~~~~  291 (313)
T KOG1813|consen  242 FKCFICRKYF--YRPVVTKCGHYFCEVCALKPY--QKGEKCYVCSQQTHGSFNV  291 (313)
T ss_pred             cccccccccc--ccchhhcCCceeehhhhcccc--ccCCcceecccccccccch
Confidence            7788888888  445556668899999987765  5689999999988755544


No 29 
>PF14835 zf-RING_6:  zf-RING of BARD1-type protein; PDB: 1JM7_B.
Probab=82.36  E-value=1.5  Score=26.07  Aligned_cols=47  Identities=21%  Similarity=0.358  Sum_probs=23.4

Q ss_pred             cccccCCcccccCCCeEEEeCCeeecccchhccccccccccccccccccCc
Q psy12215         11 LKCGCCDCRLGEVGSTLYQKANLILCKRDYLRLFGTTGYCAACTKVIPAFE   61 (155)
Q Consensus        11 f~C~~C~~~l~~~~~~~~~~~~~~~C~~c~~~~~~~~~~C~~C~~~I~~~~   61 (155)
                      ++|+.|..-|.+.  .....=..+||..|....++.  .|+.|..+.+..|
T Consensus         8 LrCs~C~~~l~~p--v~l~~CeH~fCs~Ci~~~~~~--~CPvC~~Paw~qD   54 (65)
T PF14835_consen    8 LRCSICFDILKEP--VCLGGCEHIFCSSCIRDCIGS--ECPVCHTPAWIQD   54 (65)
T ss_dssp             TS-SSS-S--SS---B---SSS--B-TTTGGGGTTT--B-SSS--B-S-SS
T ss_pred             cCCcHHHHHhcCC--ceeccCccHHHHHHhHHhcCC--CCCCcCChHHHHH
Confidence            6789998888532  223445578999999888887  7999999886533


No 30 
>PF14446 Prok-RING_1:  Prokaryotic RING finger family 1
Probab=82.32  E-value=0.72  Score=26.39  Aligned_cols=28  Identities=21%  Similarity=0.529  Sum_probs=19.7

Q ss_pred             cccccccccccCceEEec--cCcccccccc
Q psy12215         49 YCAACTKVIPAFEMVMRA--KNNVYHLECF   76 (155)
Q Consensus        49 ~C~~C~~~I~~~~~~~~~--~~~~~H~~Cf   76 (155)
                      +|..|++.|.+.+.++.-  -+..||.+|+
T Consensus         7 ~C~~Cg~~~~~~dDiVvCp~CgapyHR~C~   36 (54)
T PF14446_consen    7 KCPVCGKKFKDGDDIVVCPECGAPYHRDCW   36 (54)
T ss_pred             cChhhCCcccCCCCEEECCCCCCcccHHHH
Confidence            799999999644445442  3677888887


No 31 
>COG5152 Uncharacterized conserved protein, contains RING and CCCH-type Zn-fingers [General function prediction only]
Probab=82.18  E-value=0.88  Score=33.15  Aligned_cols=48  Identities=15%  Similarity=0.335  Sum_probs=38.2

Q ss_pred             cccccCCcccccCCeEEeeCCeeecHHhHHhhhcccCCCeeeecCCeecchh
Q psy12215         76 FACQQCNHRFCVGDRFYLCDNKILCEYDYEERQVFCVGDRFYLCDNKILCEY  127 (155)
Q Consensus        76 f~C~~C~~~l~~~~~~~~~~~~~~C~~c~~~~~~~~~~~~c~~c~~~i~c~~  127 (155)
                      |.|..|.+..  ....+..-|..||..|+.+.+  ..|+.|.+|+....+..
T Consensus       197 F~C~iCKkdy--~spvvt~CGH~FC~~Cai~~y--~kg~~C~~Cgk~t~G~f  244 (259)
T COG5152         197 FLCGICKKDY--ESPVVTECGHSFCSLCAIRKY--QKGDECGVCGKATYGRF  244 (259)
T ss_pred             eeehhchhhc--cchhhhhcchhHHHHHHHHHh--ccCCcceecchhhccce
Confidence            7899999887  444555568999999998876  66999999998776544


No 32 
>PF10367 Vps39_2:  Vacuolar sorting protein 39 domain 2;  InterPro: IPR019453  This entry represents a domain found in the vacuolar sorting protein Vps39 and transforming growth factor beta receptor-associated protein Trap1. Vps39, a component of the C-Vps complex, is thought to be required for the fusion of endosomes and other types of transport intermediates with the vacuole [, ]. In Saccharomyces cerevisiae (Baker's yeast), Vps39 has been shown to stimulate nucleotide exchange []. Trap1 plays a role in the TGF-beta/activin signaling pathway. It associates with inactive heteromeric TGF-beta and activin receptor complexes, mainly through the type II receptor, and is released upon activation of signaling [, ]. The precise function of this domain has not been characterised In Vps39 this domain is involved in localisation and in mediating the interactions with Vps11 []. 
Probab=81.18  E-value=1.2  Score=28.63  Aligned_cols=28  Identities=25%  Similarity=0.502  Sum_probs=16.9

Q ss_pred             cccccccccccCceEEeccCcccccccc
Q psy12215         49 YCAACTKVIPAFEMVMRAKNNVYHLECF   76 (155)
Q Consensus        49 ~C~~C~~~I~~~~~~~~~~~~~~H~~Cf   76 (155)
                      .|..|+++|.....++-..|..+|..|+
T Consensus        80 ~C~vC~k~l~~~~f~~~p~~~v~H~~C~  107 (109)
T PF10367_consen   80 KCSVCGKPLGNSVFVVFPCGHVVHYSCI  107 (109)
T ss_pred             CccCcCCcCCCceEEEeCCCeEEecccc
Confidence            5777777776533334444566676664


No 33 
>PF14634 zf-RING_5:  zinc-RING finger domain
Probab=81.11  E-value=1.9  Score=23.25  Aligned_cols=41  Identities=20%  Similarity=0.425  Sum_probs=25.3

Q ss_pred             cccCCcccccCCeEEeeC-CeeecHHhHHhhhcccCCCeeeecC
Q psy12215         78 CQQCNHRFCVGDRFYLCD-NKILCEYDYEERQVFCVGDRFYLCD  120 (155)
Q Consensus        78 C~~C~~~l~~~~~~~~~~-~~~~C~~c~~~~~~~~~~~~c~~c~  120 (155)
                      |..|...+.....+.+.. |.++|..|..+..  .....|.+|.
T Consensus         2 C~~C~~~~~~~~~~~l~~CgH~~C~~C~~~~~--~~~~~CP~C~   43 (44)
T PF14634_consen    2 CNICFEKYSEERRPRLTSCGHIFCEKCLKKLK--GKSVKCPICR   43 (44)
T ss_pred             CcCcCccccCCCCeEEcccCCHHHHHHHHhhc--CCCCCCcCCC
Confidence            455666663344455555 8899999987764  3445555554


No 34 
>PF14835 zf-RING_6:  zf-RING of BARD1-type protein; PDB: 1JM7_B.
Probab=80.14  E-value=1  Score=26.72  Aligned_cols=43  Identities=16%  Similarity=0.390  Sum_probs=19.5

Q ss_pred             cccccCCcccccCCeEEeeC-CeeecHHhHHhhhcccCCCeeeecCCeec
Q psy12215         76 FACQQCNHRFCVGDRFYLCD-NKILCEYDYEERQVFCVGDRFYLCDNKIL  124 (155)
Q Consensus        76 f~C~~C~~~l~~~~~~~~~~-~~~~C~~c~~~~~~~~~~~~c~~c~~~i~  124 (155)
                      .+|+.|...|  .+.+...+ +.+||..|-.+..    |..|..|..|-.
T Consensus         8 LrCs~C~~~l--~~pv~l~~CeH~fCs~Ci~~~~----~~~CPvC~~Paw   51 (65)
T PF14835_consen    8 LRCSICFDIL--KEPVCLGGCEHIFCSSCIRDCI----GSECPVCHTPAW   51 (65)
T ss_dssp             TS-SSS-S----SS-B---SSS--B-TTTGGGGT----TTB-SSS--B-S
T ss_pred             cCCcHHHHHh--cCCceeccCccHHHHHHhHHhc----CCCCCCcCChHH
Confidence            5677777776  44443333 6788888887766    777888876654


No 35 
>PF04570 DUF581:  Protein of unknown function (DUF581);  InterPro: IPR007650 This is a family of uncharacterised proteins.
Probab=79.48  E-value=1.4  Score=25.64  Aligned_cols=27  Identities=15%  Similarity=0.351  Sum_probs=21.3

Q ss_pred             ccccCCcccccCCCeEEEeCCeeeccc
Q psy12215         12 KCGCCDCRLGEVGSTLYQKANLILCKR   38 (155)
Q Consensus        12 ~C~~C~~~l~~~~~~~~~~~~~~~C~~   38 (155)
                      .|..|+++|.++.-.|..+..+.||..
T Consensus        18 ~C~~C~k~L~~~~DiymYrGd~aFCS~   44 (58)
T PF04570_consen   18 FCYLCKKKLDPGKDIYMYRGDKAFCSE   44 (58)
T ss_pred             HHHccCCCCCCCCCeeeeccccccccH
Confidence            478899999865557778888999963


No 36 
>KOG0320|consensus
Probab=78.27  E-value=1.3  Score=31.69  Aligned_cols=50  Identities=12%  Similarity=0.191  Sum_probs=37.2

Q ss_pred             ccccccccCCcccccCCeEEeeCCeeecHHhHHhhhcccCCCeeeecCCeec
Q psy12215         73 LECFACQQCNHRFCVGDRFYLCDNKILCEYDYEERQVFCVGDRFYLCDNKIL  124 (155)
Q Consensus        73 ~~Cf~C~~C~~~l~~~~~~~~~~~~~~C~~c~~~~~~~~~~~~c~~c~~~i~  124 (155)
                      ..++.|-.|-........+...=|.+||+.|-....  ..+..|..|.++|.
T Consensus       129 ~~~~~CPiCl~~~sek~~vsTkCGHvFC~~Cik~al--k~~~~CP~C~kkIt  178 (187)
T KOG0320|consen  129 EGTYKCPICLDSVSEKVPVSTKCGHVFCSQCIKDAL--KNTNKCPTCRKKIT  178 (187)
T ss_pred             ccccCCCceecchhhccccccccchhHHHHHHHHHH--HhCCCCCCcccccc
Confidence            457888888777733333445669999999987654  55788999998777


No 37 
>PF14471 DUF4428:  Domain of unknown function (DUF4428)
Probab=76.62  E-value=2.4  Score=23.89  Aligned_cols=30  Identities=20%  Similarity=0.490  Sum_probs=22.4

Q ss_pred             ccccCCcccccCCeEEeeCCeeecHHhHHhh
Q psy12215         77 ACQQCNHRFCVGDRFYLCDNKILCEYDYEER  107 (155)
Q Consensus        77 ~C~~C~~~l~~~~~~~~~~~~~~C~~c~~~~  107 (155)
                      .|..|+..++.-..+-..|| ..|..|+.+.
T Consensus         1 ~C~iCg~kigl~~~~k~~DG-~iC~~C~~Kl   30 (51)
T PF14471_consen    1 KCAICGKKIGLFKRFKIKDG-YICKDCLKKL   30 (51)
T ss_pred             CCCccccccccccceeccCc-cchHHHHHHh
Confidence            37788888854444667788 6999999876


No 38 
>PF10235 Cript:  Microtubule-associated protein CRIPT;  InterPro: IPR019367  The CRIPT protein is a cytoskeletal protein involved in microtubule production. This C-terminal domain is essential for binding to the PDZ3 domain of the SAP90 protein, one of a super-family of PDZ-containing proteins that play an important role in coupling the membrane ion channels with their signalling partners []. 
Probab=75.44  E-value=1.5  Score=27.82  Aligned_cols=36  Identities=28%  Similarity=0.617  Sum_probs=23.5

Q ss_pred             ccccCCcccccCCCeEEEeCCeeecccchhcccccccccccccccccc
Q psy12215         12 KCGCCDCRLGEVGSTLYQKANLILCKRDYLRLFGTTGYCAACTKVIPA   59 (155)
Q Consensus        12 ~C~~C~~~l~~~~~~~~~~~~~~~C~~c~~~~~~~~~~C~~C~~~I~~   59 (155)
                      +|..|...+..        .|.-||..|..+.    +.|+-|++.|.+
T Consensus        46 ~C~~CK~~v~q--------~g~~YCq~CAYkk----GiCamCGKki~d   81 (90)
T PF10235_consen   46 KCKICKTKVHQ--------PGAKYCQTCAYKK----GICAMCGKKILD   81 (90)
T ss_pred             ccccccccccc--------CCCccChhhhccc----CcccccCCeecc
Confidence            45666555531        2457888887663    368888888854


No 39 
>PF10367 Vps39_2:  Vacuolar sorting protein 39 domain 2;  InterPro: IPR019453  This entry represents a domain found in the vacuolar sorting protein Vps39 and transforming growth factor beta receptor-associated protein Trap1. Vps39, a component of the C-Vps complex, is thought to be required for the fusion of endosomes and other types of transport intermediates with the vacuole [, ]. In Saccharomyces cerevisiae (Baker's yeast), Vps39 has been shown to stimulate nucleotide exchange []. Trap1 plays a role in the TGF-beta/activin signaling pathway. It associates with inactive heteromeric TGF-beta and activin receptor complexes, mainly through the type II receptor, and is released upon activation of signaling [, ]. The precise function of this domain has not been characterised In Vps39 this domain is involved in localisation and in mediating the interactions with Vps11 []. 
Probab=74.02  E-value=3.1  Score=26.61  Aligned_cols=28  Identities=21%  Similarity=0.343  Sum_probs=20.5

Q ss_pred             ccccCCcccccCCCeEE-EeCCeeecccchh
Q psy12215         12 KCGCCDCRLGEVGSTLY-QKANLILCKRDYL   41 (155)
Q Consensus        12 ~C~~C~~~l~~~~~~~~-~~~~~~~C~~c~~   41 (155)
                      .|..|+++|..  ..|. ..+|.+++..|..
T Consensus        80 ~C~vC~k~l~~--~~f~~~p~~~v~H~~C~~  108 (109)
T PF10367_consen   80 KCSVCGKPLGN--SVFVVFPCGHVVHYSCIK  108 (109)
T ss_pred             CccCcCCcCCC--ceEEEeCCCeEEeccccc
Confidence            59999999953  4555 4667888877764


No 40 
>PF09943 DUF2175:  Uncharacterized protein conserved in archaea (DUF2175);  InterPro: IPR018686  This family of various hypothetical archaeal proteins has no known function. 
Probab=73.58  E-value=1.3  Score=28.76  Aligned_cols=33  Identities=15%  Similarity=0.348  Sum_probs=21.2

Q ss_pred             cccccCCcccccCCeEEeeCCeeecHHhHHhhh
Q psy12215         76 FACQQCNHRFCVGDRFYLCDNKILCEYDYEERQ  108 (155)
Q Consensus        76 f~C~~C~~~l~~~~~~~~~~~~~~C~~c~~~~~  108 (155)
                      ++|..|+..+..|+.|++..+.+.--.||.+..
T Consensus         3 WkC~iCg~~I~~gqlFTF~~kG~VH~~C~~~~~   35 (101)
T PF09943_consen    3 WKCYICGKPIYEGQLFTFTKKGPVHYECFREKA   35 (101)
T ss_pred             eEEEecCCeeeecceEEEecCCcEeHHHHHHHH
Confidence            356677777666666766665666666666544


No 41 
>PF13920 zf-C3HC4_3:  Zinc finger, C3HC4 type (RING finger); PDB: 2YHN_B 2YHO_G 3T6P_A 2CSY_A 2VJE_B 2VJF_B 2HDP_B 2EA5_A 2ECG_A 3EB5_A ....
Probab=73.48  E-value=6.1  Score=21.71  Aligned_cols=44  Identities=20%  Similarity=0.282  Sum_probs=28.3

Q ss_pred             ccccCCcccccCCeEEeeCCee-ecHHhHHhhhcccCCCeeeecCCeec
Q psy12215         77 ACQQCNHRFCVGDRFYLCDNKI-LCEYDYEERQVFCVGDRFYLCDNKIL  124 (155)
Q Consensus        77 ~C~~C~~~l~~~~~~~~~~~~~-~C~~c~~~~~~~~~~~~c~~c~~~i~  124 (155)
                      .|..|....  .......=|.. +|..|+.+...  ....|.+|..+|.
T Consensus         4 ~C~iC~~~~--~~~~~~pCgH~~~C~~C~~~~~~--~~~~CP~Cr~~i~   48 (50)
T PF13920_consen    4 ECPICFENP--RDVVLLPCGHLCFCEECAERLLK--RKKKCPICRQPIE   48 (50)
T ss_dssp             B-TTTSSSB--SSEEEETTCEEEEEHHHHHHHHH--TTSBBTTTTBB-S
T ss_pred             CCccCCccC--CceEEeCCCChHHHHHHhHHhcc--cCCCCCcCChhhc
Confidence            456666654  23333444777 99999988752  5788888888764


No 42 
>PF13240 zinc_ribbon_2:  zinc-ribbon domain
Probab=73.03  E-value=1.6  Score=20.28  Aligned_cols=8  Identities=25%  Similarity=0.974  Sum_probs=3.7

Q ss_pred             cccCCccc
Q psy12215         13 CGCCDCRL   20 (155)
Q Consensus        13 C~~C~~~l   20 (155)
                      |..|+..+
T Consensus         2 Cp~CG~~~    9 (23)
T PF13240_consen    2 CPNCGAEI    9 (23)
T ss_pred             CcccCCCC
Confidence            44444444


No 43 
>PRK00420 hypothetical protein; Validated
Probab=70.99  E-value=2.5  Score=27.98  Aligned_cols=25  Identities=20%  Similarity=0.373  Sum_probs=16.2

Q ss_pred             cccccCCcccccCCCeEEEeCCeeecccchh
Q psy12215         11 LKCGCCDCRLGEVGSTLYQKANLILCKRDYL   41 (155)
Q Consensus        11 f~C~~C~~~l~~~~~~~~~~~~~~~C~~c~~   41 (155)
                      -.|..|+.+|      |-.++|+.||..|-.
T Consensus        24 ~~CP~Cg~pL------f~lk~g~~~Cp~Cg~   48 (112)
T PRK00420         24 KHCPVCGLPL------FELKDGEVVCPVHGK   48 (112)
T ss_pred             CCCCCCCCcc------eecCCCceECCCCCC
Confidence            3577788877      334788887655443


No 44 
>PF13923 zf-C3HC4_2:  Zinc finger, C3HC4 type (RING finger); PDB: 3HCU_A 2ECI_A 2JMD_A 3HCS_B 3HCT_A 3ZTG_A 2YUR_A 3L11_A.
Probab=69.78  E-value=3.3  Score=21.52  Aligned_cols=38  Identities=16%  Similarity=0.329  Sum_probs=21.5

Q ss_pred             cccCCcccccCCCeEEEeCCeeecccchhccccccccccc
Q psy12215         13 CGCCDCRLGEVGSTLYQKANLILCKRDYLRLFGTTGYCAA   52 (155)
Q Consensus        13 C~~C~~~l~~~~~~~~~~~~~~~C~~c~~~~~~~~~~C~~   52 (155)
                      |..|...+.  +......=|..||.+|..+......+|..
T Consensus         1 C~iC~~~~~--~~~~~~~CGH~fC~~C~~~~~~~~~~CP~   38 (39)
T PF13923_consen    1 CPICLDELR--DPVVVTPCGHSFCKECIEKYLEKNPKCPV   38 (39)
T ss_dssp             ETTTTSB-S--SEEEECTTSEEEEHHHHHHHHHCTSB-TT
T ss_pred             CCCCCCccc--CcCEECCCCCchhHHHHHHHHHCcCCCcC
Confidence            455655552  22245677889999998775543224544


No 45 
>KOG1813|consensus
Probab=68.66  E-value=2.7  Score=32.52  Aligned_cols=46  Identities=17%  Similarity=0.369  Sum_probs=34.7

Q ss_pred             cccccCCcccccCCCeEEEeCCeeecccchhcccccccccccccccccc
Q psy12215         11 LKCGCCDCRLGEVGSTLYQKANLILCKRDYLRLFGTTGYCAACTKVIPA   59 (155)
Q Consensus        11 f~C~~C~~~l~~~~~~~~~~~~~~~C~~c~~~~~~~~~~C~~C~~~I~~   59 (155)
                      |.|..|.+...+   ..+..-+.-||+.|..+.+....+|..|++.+.+
T Consensus       242 f~c~icr~~f~~---pVvt~c~h~fc~~ca~~~~qk~~~c~vC~~~t~g  287 (313)
T KOG1813|consen  242 FKCFICRKYFYR---PVVTKCGHYFCEVCALKPYQKGEKCYVCSQQTHG  287 (313)
T ss_pred             cccccccccccc---chhhcCCceeehhhhccccccCCcceeccccccc
Confidence            678888887742   3556677788999998887554589999998875


No 46 
>COG2191 Formylmethanofuran dehydrogenase subunit E [Energy production and conversion]
Probab=68.55  E-value=1.7  Score=31.81  Aligned_cols=32  Identities=22%  Similarity=0.485  Sum_probs=26.0

Q ss_pred             cccccCCcccccCCeEEeeCCeeecHHhHHhhh
Q psy12215         76 FACQQCNHRFCVGDRFYLCDNKILCEYDYEERQ  108 (155)
Q Consensus        76 f~C~~C~~~l~~~~~~~~~~~~~~C~~c~~~~~  108 (155)
                      -+|+.|+..+ ....-...+|+++|..||.+.+
T Consensus       173 v~C~kCGE~~-~e~~~~~~ng~~vC~~C~~~~~  204 (206)
T COG2191         173 VRCSKCGELF-MEPRAVVLNGKPVCKPCAEKKY  204 (206)
T ss_pred             eeccccCccc-ccchhhhcCCceeccccccccc
Confidence            5799999988 5666677899999999987643


No 47 
>PRK14890 putative Zn-ribbon RNA-binding protein; Provisional
Probab=67.19  E-value=3.5  Score=24.01  Aligned_cols=36  Identities=28%  Similarity=0.498  Sum_probs=18.9

Q ss_pred             ccccCCcccccCCCeEEEeCCeeecccchhcccccccccccccc
Q psy12215         12 KCGCCDCRLGEVGSTLYQKANLILCKRDYLRLFGTTGYCAACTK   55 (155)
Q Consensus        12 ~C~~C~~~l~~~~~~~~~~~~~~~C~~c~~~~~~~~~~C~~C~~   55 (155)
                      +|+.|+..|.+.+     +.-...|..|-.....   +|..|.+
T Consensus         9 ~CtSCg~~i~~~~-----~~~~F~CPnCG~~~I~---RC~~CRk   44 (59)
T PRK14890          9 KCTSCGIEIAPRE-----KAVKFLCPNCGEVIIY---RCEKCRK   44 (59)
T ss_pred             cccCCCCcccCCC-----ccCEeeCCCCCCeeEe---echhHHh
Confidence            5888888885432     1123455555443222   3555544


No 48 
>KOG4739|consensus
Probab=64.00  E-value=4.9  Score=30.10  Aligned_cols=42  Identities=26%  Similarity=0.514  Sum_probs=30.8

Q ss_pred             cccCCcccccCCeEEeeC-CeeecHHhHHhhhcccCCCeeeecCCeec
Q psy12215         78 CQQCNHRFCVGDRFYLCD-NKILCEYDYEERQVFCVGDRFYLCDNKIL  124 (155)
Q Consensus        78 C~~C~~~l~~~~~~~~~~-~~~~C~~c~~~~~~~~~~~~c~~c~~~i~  124 (155)
                      |..|...- ....|++.. ..++|..|..-..    ++.|..|.+.|.
T Consensus         6 Cn~C~~~~-~~~~f~LTaC~HvfC~~C~k~~~----~~~C~lCkk~ir   48 (233)
T KOG4739|consen    6 CNKCFRFP-SQDPFFLTACRHVFCEPCLKASS----PDVCPLCKKSIR   48 (233)
T ss_pred             eccccccC-CCCceeeeechhhhhhhhcccCC----ccccccccceee
Confidence            44555554 366677766 8899999976655    779999998875


No 49 
>PF06689 zf-C4_ClpX:  ClpX C4-type zinc finger;  InterPro: IPR010603 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The ClpX heat shock protein of Escherichia coli is a member of the universally conserved Hsp100 family of proteins, and possesses a putative zinc finger motif of the C4 type []. This presumed zinc binding domain (ZBD) is found at the N terminus of the ClpX protein. ClpX is an ATPase which functions both as a substrate specificity component of the ClpXP protease and as a molecular chaperone. ZBD is a member of the treble clef zinc finger family, a motif known to facilitate protein-ligand, protein-DNA, and protein-protein interactions and forms a constitutive dimer that is essential for the degradation of some, but not all, ClpX substrates []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0016887 ATPase activity, 0046983 protein dimerization activity, 0006200 ATP catabolic process, 0019538 protein metabolic process; PDB: 2DS8_B 2DS6_B 2DS5_A 1OVX_A 2DS7_A.
Probab=63.75  E-value=8.2  Score=20.56  Aligned_cols=31  Identities=19%  Similarity=0.421  Sum_probs=18.7

Q ss_pred             ccccCCcccccCCCeEEEeCCeeecccchhc
Q psy12215         12 KCGCCDCRLGEVGSTLYQKANLILCKRDYLR   42 (155)
Q Consensus        12 ~C~~C~~~l~~~~~~~~~~~~~~~C~~c~~~   42 (155)
                      .|+-|+++-++.+......++...|.+|...
T Consensus         3 ~CSFCgr~~~~v~~li~g~~~~~IC~~Cv~~   33 (41)
T PF06689_consen    3 RCSFCGRPESEVGRLISGPNGAYICDECVEQ   33 (41)
T ss_dssp             B-TTT--BTTTSSSEEEES-SEEEEHHHHHH
T ss_pred             CccCCCCCHHHHhceecCCCCcEECHHHHHH
Confidence            5888999987665544445467778888754


No 50 
>PF13834 DUF4193:  Domain of unknown function (DUF4193)
Probab=63.55  E-value=2.5  Score=27.30  Aligned_cols=29  Identities=14%  Similarity=0.230  Sum_probs=16.5

Q ss_pred             CcccccCCcccccCCCeEEEeCCeeecccc
Q psy12215         10 CLKCGCCDCRLGEVGSTLYQKANLILCKRD   39 (155)
Q Consensus        10 Cf~C~~C~~~l~~~~~~~~~~~~~~~C~~c   39 (155)
                      =|+|+.|.---. .++.-...+|.++|.+|
T Consensus        70 EFTCssCFLV~H-RSqLa~~~~g~~iC~DC   98 (99)
T PF13834_consen   70 EFTCSSCFLVHH-RSQLAREKDGQPICRDC   98 (99)
T ss_pred             ceeeeeeeeEec-hhhhccccCCCEecccc
Confidence            478887744322 11122356678888776


No 51 
>COG1645 Uncharacterized Zn-finger containing protein [General function prediction only]
Probab=62.13  E-value=4.7  Score=27.46  Aligned_cols=21  Identities=24%  Similarity=0.667  Sum_probs=16.5

Q ss_pred             cccCCcccccCCeEEeeCCeeecHHhH
Q psy12215         78 CQQCNHRFCVGDRFYLCDNKILCEYDY  104 (155)
Q Consensus        78 C~~C~~~l~~~~~~~~~~~~~~C~~c~  104 (155)
                      |..|+.+|     |- .+|.+||..|=
T Consensus        31 Cp~Cg~PL-----F~-KdG~v~CPvC~   51 (131)
T COG1645          31 CPKCGTPL-----FR-KDGEVFCPVCG   51 (131)
T ss_pred             CcccCCcc-----ee-eCCeEECCCCC
Confidence            67788888     44 78999998884


No 52 
>PF13639 zf-RING_2:  Ring finger domain; PDB: 2KIZ_A 4EPO_C 1IYM_A 2EP4_A 2ECT_A 2JRJ_A 2ECN_A 2ECM_A 3NG2_A 2EA6_A ....
Probab=62.09  E-value=5.7  Score=21.12  Aligned_cols=32  Identities=6%  Similarity=0.128  Sum_probs=15.7

Q ss_pred             cccCCcccccCCCeEEEeCCeeecccchhccc
Q psy12215         13 CGCCDCRLGEVGSTLYQKANLILCKRDYLRLF   44 (155)
Q Consensus        13 C~~C~~~l~~~~~~~~~~~~~~~C~~c~~~~~   44 (155)
                      |..|-..+.+........=+..||.+|..+.+
T Consensus         3 C~IC~~~~~~~~~~~~l~C~H~fh~~Ci~~~~   34 (44)
T PF13639_consen    3 CPICLEEFEDGEKVVKLPCGHVFHRSCIKEWL   34 (44)
T ss_dssp             ETTTTCBHHTTSCEEEETTSEEEEHHHHHHHH
T ss_pred             CcCCChhhcCCCeEEEccCCCeeCHHHHHHHH
Confidence            55555555433333334445566666655443


No 53 
>PF12773 DZR:  Double zinc ribbon
Probab=61.96  E-value=3.8  Score=22.54  Aligned_cols=38  Identities=18%  Similarity=0.384  Sum_probs=22.4

Q ss_pred             cccCCcccccCCCeEEEeCCeeecccchhccc---ccccccccccccccc
Q psy12215         13 CGCCDCRLGEVGSTLYQKANLILCKRDYLRLF---GTTGYCAACTKVIPA   59 (155)
Q Consensus        13 C~~C~~~l~~~~~~~~~~~~~~~C~~c~~~~~---~~~~~C~~C~~~I~~   59 (155)
                      |..|+.++++         +..||..|-..+.   .....|..|+..+..
T Consensus         1 Cp~Cg~~~~~---------~~~fC~~CG~~l~~~~~~~~~C~~Cg~~~~~   41 (50)
T PF12773_consen    1 CPHCGTPNPD---------DAKFCPHCGTPLPPPDQSKKICPNCGAENPP   41 (50)
T ss_pred             CCCcCCcCCc---------cccCChhhcCChhhccCCCCCCcCCcCCCcC
Confidence            4566666642         2457777776655   111258888887654


No 54 
>KOG0320|consensus
Probab=61.80  E-value=2.9  Score=29.97  Aligned_cols=51  Identities=24%  Similarity=0.432  Sum_probs=34.7

Q ss_pred             ccCcccccCCcccccCCCeEEEeCCeeecccchhcccccccccccccccccc
Q psy12215          8 EDCLKCGCCDCRLGEVGSTLYQKANLILCKRDYLRLFGTTGYCAACTKVIPA   59 (155)
Q Consensus         8 ~~Cf~C~~C~~~l~~~~~~~~~~~~~~~C~~c~~~~~~~~~~C~~C~~~I~~   59 (155)
                      ..+++|-.|=....+. ..+..+=|.+||+.|.........+|..|++.|.-
T Consensus       129 ~~~~~CPiCl~~~sek-~~vsTkCGHvFC~~Cik~alk~~~~CP~C~kkIt~  179 (187)
T KOG0320|consen  129 EGTYKCPICLDSVSEK-VPVSTKCGHVFCSQCIKDALKNTNKCPTCRKKITH  179 (187)
T ss_pred             ccccCCCceecchhhc-cccccccchhHHHHHHHHHHHhCCCCCCcccccch
Confidence            3567777774444221 23446778899999998876555589999998853


No 55 
>PRK00807 50S ribosomal protein L24e; Validated
Probab=61.24  E-value=8.8  Score=21.67  Aligned_cols=24  Identities=25%  Similarity=0.534  Sum_probs=14.7

Q ss_pred             ccccCCccccc-CCCeEEEeCCeee
Q psy12215         12 KCGCCDCRLGE-VGSTLYQKANLIL   35 (155)
Q Consensus        12 ~C~~C~~~l~~-~~~~~~~~~~~~~   35 (155)
                      .|+.|+..+.+ .+..|+..||++|
T Consensus         3 ~C~fcG~~I~pg~G~~~vr~Dgkv~   27 (52)
T PRK00807          3 TCSFCGKEIEPGTGKMYVKKDGTIL   27 (52)
T ss_pred             ccCCCCCeEcCCCCeEEEEeCCcEE
Confidence            46777777763 3444556777755


No 56 
>PF09943 DUF2175:  Uncharacterized protein conserved in archaea (DUF2175);  InterPro: IPR018686  This family of various hypothetical archaeal proteins has no known function. 
Probab=61.21  E-value=8.9  Score=24.90  Aligned_cols=32  Identities=28%  Similarity=0.445  Sum_probs=23.2

Q ss_pred             cccccccccccCceEEeccCcccccccccccc
Q psy12215         49 YCAACTKVIPAFEMVMRAKNNVYHLECFACQQ   80 (155)
Q Consensus        49 ~C~~C~~~I~~~~~~~~~~~~~~H~~Cf~C~~   80 (155)
                      +|..|+++|..++...-..+..-|-.||+=..
T Consensus         4 kC~iCg~~I~~gqlFTF~~kG~VH~~C~~~~~   35 (101)
T PF09943_consen    4 KCYICGKPIYEGQLFTFTKKGPVHYECFREKA   35 (101)
T ss_pred             EEEecCCeeeecceEEEecCCcEeHHHHHHHH
Confidence            69999999987655444445667888887544


No 57 
>PF14570 zf-RING_4:  RING/Ubox like zinc-binding domain; PDB: 1E4U_A 1UR6_B.
Probab=60.15  E-value=4.4  Score=22.60  Aligned_cols=43  Identities=23%  Similarity=0.597  Sum_probs=16.8

Q ss_pred             ccCCcccccCCCeEEE-eCCeeecccchhcccc-ccccccccccc
Q psy12215         14 GCCDCRLGEVGSTLYQ-KANLILCKRDYLRLFG-TTGYCAACTKV   56 (155)
Q Consensus        14 ~~C~~~l~~~~~~~~~-~~~~~~C~~c~~~~~~-~~~~C~~C~~~   56 (155)
                      ..|...|+..+..|.. .=|--+|..||.+... ..++|.+|.++
T Consensus         2 p~C~e~~d~~d~~~~PC~Cgf~IC~~C~~~i~~~~~g~CPgCr~~   46 (48)
T PF14570_consen    2 PLCDEELDETDKDFYPCECGFQICRFCYHDILENEGGRCPGCREP   46 (48)
T ss_dssp             TTTS-B--CCCTT--SSTTS----HHHHHHHTTSS-SB-TTT--B
T ss_pred             CCcccccccCCCccccCcCCCcHHHHHHHHHHhccCCCCCCCCCC
Confidence            3455556544444442 2233467888876552 34578888764


No 58 
>PF01258 zf-dskA_traR:  Prokaryotic dksA/traR C4-type zinc finger;  InterPro: IPR000962 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents domains identified in zinc finger-containing members of the DksA/TraR family. DksA is a critical component of the rRNA transcription initiation machinery that potentiates the regulation of rRNA promoters by ppGpp and the initiating NTP. In delta-dksA mutants, rRNA promoters are unresponsive to changes in amino acid availability, growth rate, or growth phase. In vitro, DksA binds to RNAP, reduces open complex lifetime, inhibits rRNA promoter activity, and amplifies effects of ppGpp and the initiating NTP on rRNA transcription [, ]. The dksA gene product suppresses the temperature-sensitive growth and filamentation of a dnaK deletion mutant of Escherichia coli. Gene knockout [] and deletion [] experiments have shown the gene to be non-essential, mutations causing a mild sensitivity to UV light, but not affecting DNA recombination []. In Pseudomonas aeruginosa, dksA is a novel regulator involved in the post-transcriptional control of extracellular virulence factor production [].  The proteins contain a C-terminal region thought to fold into a 4-cysteine zinc finger. Other proteins found to contain a similar zinc finger domain include:  the traR gene products encoded on the E. coli F and R100 plasmids [, ]  the traR gene products encoded on Salmonella spp. plasmids pED208 and pSLT  the dnaK suppressor  hypothetical proteins from bacteria and bacteriophage  FHL4, LIM proteins from Homo sapiens (Human) and Mus musculus (Mouse) []  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 2GVI_A 2KQ9_A 2KGO_A 1TJL_I.
Probab=59.71  E-value=1.4  Score=22.80  Aligned_cols=27  Identities=22%  Similarity=0.486  Sum_probs=10.1

Q ss_pred             cccCCcccccCCeEEeeCCeeecHHhHH
Q psy12215         78 CQQCNHRFCVGDRFYLCDNKILCEYDYE  105 (155)
Q Consensus        78 C~~C~~~l~~~~~~~~~~~~~~C~~c~~  105 (155)
                      |..|+..+ ...+....++..+|..|..
T Consensus         6 C~~CGe~I-~~~Rl~~~p~~~~C~~C~~   32 (36)
T PF01258_consen    6 CEDCGEPI-PEERLVAVPGATLCVECQE   32 (36)
T ss_dssp             -TTTSSBE-EHHHHHHCTTECS-HHHHH
T ss_pred             ccccCChH-HHHHHHhCCCcEECHHHhC
Confidence            34444444 2222333344455555543


No 59 
>COG5152 Uncharacterized conserved protein, contains RING and CCCH-type Zn-fingers [General function prediction only]
Probab=57.49  E-value=2.6  Score=30.81  Aligned_cols=46  Identities=17%  Similarity=0.428  Sum_probs=34.0

Q ss_pred             cccccCCcccccCCCeEEEeCCeeecccchhcccccccccccccccccc
Q psy12215         11 LKCGCCDCRLGEVGSTLYQKANLILCKRDYLRLFGTTGYCAACTKVIPA   59 (155)
Q Consensus        11 f~C~~C~~~l~~~~~~~~~~~~~~~C~~c~~~~~~~~~~C~~C~~~I~~   59 (155)
                      |.|..|.+...+   +.+..=|.-||..|+++.+.....|..|++...+
T Consensus       197 F~C~iCKkdy~s---pvvt~CGH~FC~~Cai~~y~kg~~C~~Cgk~t~G  242 (259)
T COG5152         197 FLCGICKKDYES---PVVTECGHSFCSLCAIRKYQKGDECGVCGKATYG  242 (259)
T ss_pred             eeehhchhhccc---hhhhhcchhHHHHHHHHHhccCCcceecchhhcc
Confidence            778888877642   3455667788999998877544489999888776


No 60 
>cd02249 ZZ Zinc finger, ZZ type. Zinc finger present in dystrophin, CBP/p300 and many other proteins. The ZZ motif coordinates one or two zinc ions and most likely participates in ligand binding or molecular scaffolding. Many proteins containing ZZ motifs have other zinc-binding motifs as well, and the majority serve as scaffolds in pathways involving acetyltransferase, protein kinase, or ubiqitin-related activity. ZZ proteins can be grouped into the following functional classes: chromatin modifying, cytoskeletal scaffolding, ubiquitin binding or conjugating, and membrane receptor or ion-channel modifying proteins.
Probab=56.97  E-value=10  Score=20.54  Aligned_cols=10  Identities=30%  Similarity=0.418  Sum_probs=6.3

Q ss_pred             eeecHHhHHh
Q psy12215         97 KILCEYDYEE  106 (155)
Q Consensus        97 ~~~C~~c~~~  106 (155)
                      --+|..||..
T Consensus        23 ~dLC~~Cf~~   32 (46)
T cd02249          23 FDLCSSCYAK   32 (46)
T ss_pred             CcCHHHHHCc
Confidence            4467777764


No 61 
>cd00162 RING RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H)
Probab=56.87  E-value=5.9  Score=20.32  Aligned_cols=41  Identities=12%  Similarity=0.400  Sum_probs=19.9

Q ss_pred             cccCCcccccCCCeEEEeCCeeecccchhccccc-ccccccccc
Q psy12215         13 CGCCDCRLGEVGSTLYQKANLILCKRDYLRLFGT-TGYCAACTK   55 (155)
Q Consensus        13 C~~C~~~l~~~~~~~~~~~~~~~C~~c~~~~~~~-~~~C~~C~~   55 (155)
                      |..|...+.  .......=|..||.+|....+.. ..+|..|..
T Consensus         2 C~iC~~~~~--~~~~~~~C~H~~c~~C~~~~~~~~~~~Cp~C~~   43 (45)
T cd00162           2 CPICLEEFR--EPVVLLPCGHVFCRSCIDKWLKSGKNTCPLCRT   43 (45)
T ss_pred             CCcCchhhh--CceEecCCCChhcHHHHHHHHHhCcCCCCCCCC
Confidence            555655552  11222225566777776544321 124666554


No 62 
>COG4847 Uncharacterized protein conserved in archaea [Function unknown]
Probab=55.44  E-value=11  Score=24.12  Aligned_cols=31  Identities=16%  Similarity=0.329  Sum_probs=20.4

Q ss_pred             cccccCCcccccCCeEEeeCCeeecHHhHHh
Q psy12215         76 FACQQCNHRFCVGDRFYLCDNKILCEYDYEE  106 (155)
Q Consensus        76 f~C~~C~~~l~~~~~~~~~~~~~~C~~c~~~  106 (155)
                      |+|..|+.++..|+.|++....+.--.|+..
T Consensus         7 wkC~VCg~~iieGqkFTF~~kGsVH~eCl~~   37 (103)
T COG4847           7 WKCYVCGGTIIEGQKFTFTKKGSVHYECLAE   37 (103)
T ss_pred             eeEeeeCCEeeeccEEEEeeCCcchHHHHHH
Confidence            5677788777777777665544555556543


No 63 
>PF02069 Metallothio_Pro:  Prokaryotic metallothionein;  InterPro: IPR000518 Metallothioneins (MT) are small proteins that bind heavy metals, such as zinc, copper, cadmium and nickel. They have a high content of cysteine residues that bind the metal ions through clusters of thiolate bonds [, , ]. An empirical classification into three classes was proposed by Kojima [], with class III MTs including atypical polypeptides composed of gamma-glutamylcysteinyl units. Class I and class II MTs (the proteinaceous sequences) have now been grouped into families of phylogenetically-related and thus alignable sequences. The MT superfamily is subdivided into families, subfamilies, subgroups, and isolated isoforms and alleles. The metallothionein superfamily comprises all polypeptides that resemble equine renal metallothionein in several respects [], e.g., low molecular weight; high metal content; amino acid composition with high Cys and low aromatic residue content; unique sequence with characteristic distribution of cysteines, and spectroscopic manifestations indicative of metal thiolate clusters. A MT family subsumes MTs that share particular sequence-specific features and are thought to be evolutionarily related. Fifteen MT families have been characterised, each family being identified by its number and its taxonomic range.  Family 14 consists of prokaryota MTs. Its members are recognised by the sequence pattern K-C-A-C-x(2)-C-L-C.The taxonomic range of the members extends to cyanobacteria. Known characteristics are: 53 to 56 AAs; 9 conserved Cys; one conserved tyrosine residue; one conserved histidine residue; contain other unusual residues. ; GO: 0046872 metal ion binding; PDB: 1JJD_A.
Probab=55.41  E-value=6.5  Score=22.30  Aligned_cols=27  Identities=26%  Similarity=0.511  Sum_probs=14.1

Q ss_pred             cccCCcccccCCCeEEEeCCeeecc-cchh
Q psy12215         13 CGCCDCRLGEVGSTLYQKANLILCK-RDYL   41 (155)
Q Consensus        13 C~~C~~~l~~~~~~~~~~~~~~~C~-~c~~   41 (155)
                      |..|...+++  ..-+.+||+.||. .|..
T Consensus        10 C~~C~C~V~~--~~Ai~~dGk~YCS~aCA~   37 (52)
T PF02069_consen   10 CPSCSCVVSE--EEAIQKDGKYYCSEACAN   37 (52)
T ss_dssp             STT----B-T--TTSEESSS-EESSHHHHH
T ss_pred             CCCCEeEECc--hHhHHhCCEeeecHHHhc
Confidence            5677777753  3468999999985 4443


No 64 
>PRK14873 primosome assembly protein PriA; Provisional
Probab=54.58  E-value=9.5  Score=33.13  Aligned_cols=39  Identities=18%  Similarity=0.249  Sum_probs=28.2

Q ss_pred             cccccCCcccccCCCeEEEeCCeeecccchhccccccccccccccc
Q psy12215         11 LKCGCCDCRLGEVGSTLYQKANLILCKRDYLRLFGTTGYCAACTKV   56 (155)
Q Consensus        11 f~C~~C~~~l~~~~~~~~~~~~~~~C~~c~~~~~~~~~~C~~C~~~   56 (155)
                      ++|..|+-+|     +|...++.+.|..|-......  .|..|+..
T Consensus       393 ~~C~~C~~~L-----~~h~~~~~l~Ch~CG~~~~p~--~Cp~Cgs~  431 (665)
T PRK14873        393 ARCRHCTGPL-----GLPSAGGTPRCRWCGRAAPDW--RCPRCGSD  431 (665)
T ss_pred             eECCCCCCce-----eEecCCCeeECCCCcCCCcCc--cCCCCcCC
Confidence            4566677666     355566788899998766443  89999875


No 65 
>PF13248 zf-ribbon_3:  zinc-ribbon domain
Probab=53.54  E-value=5.9  Score=18.79  Aligned_cols=7  Identities=29%  Similarity=0.980  Sum_probs=2.7

Q ss_pred             cccCCcc
Q psy12215         13 CGCCDCR   19 (155)
Q Consensus        13 C~~C~~~   19 (155)
                      |..|+..
T Consensus         5 Cp~Cg~~   11 (26)
T PF13248_consen    5 CPNCGAE   11 (26)
T ss_pred             CcccCCc
Confidence            3334443


No 66 
>PF00645 zf-PARP:  Poly(ADP-ribose) polymerase and DNA-Ligase Zn-finger region;  InterPro: IPR001510 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents PARP (Poly(ADP) polymerase) type zinc finger domains. NAD(+) ADP-ribosyltransferase(2.4.2.30 from EC) [, ] is a eukaryotic enzyme that catalyses the covalent attachment of ADP-ribose units from NAD(+) to various nuclear acceptor proteins. This post-translational modification of nuclear proteins is dependent on DNA. It appears to be involved in the regulation of various important cellular processes such as differentiation, proliferation and tumour transformation as well as in the regulation of the molecular events involved in the recovery of the cell from DNA damage. Structurally, NAD(+) ADP-ribosyltransferase consists of three distinct domains: an N-terminal zinc-dependent DNA-binding domain, a central automodification domain and a C-terminal NAD-binding domain. The DNA-binding region contains a pair of PARP-type zinc finger domains which have been shown to bind DNA in a zinc-dependent manner. The PARP-type zinc finger domains seem to bind specifically to single-stranded DNA and to act as a DNA nick sensor. DNA ligase III [] contains, in its N-terminal section, a single copy of a zinc finger highly similar to those of PARP. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003677 DNA binding, 0008270 zinc ion binding; PDB: 1UW0_A 3OD8_D 3ODA_A 4AV1_A 2DMJ_A 4DQY_D 2L30_A 2CS2_A 2L31_A 3ODE_B ....
Probab=53.18  E-value=5.6  Score=24.39  Aligned_cols=13  Identities=38%  Similarity=0.639  Sum_probs=8.9

Q ss_pred             cccccccccccCc
Q psy12215         49 YCAACTKVIPAFE   61 (155)
Q Consensus        49 ~C~~C~~~I~~~~   61 (155)
                      +|..|+..|.-++
T Consensus         9 ~Ck~C~~~I~kg~   21 (82)
T PF00645_consen    9 KCKGCKKKIAKGE   21 (82)
T ss_dssp             BETTTSCBE-TTS
T ss_pred             cCcccCCcCCCCC
Confidence            6888888886544


No 67 
>PF12674 Zn_ribbon_2:  Putative zinc ribbon domain
Probab=52.60  E-value=4.6  Score=25.11  Aligned_cols=30  Identities=17%  Similarity=0.264  Sum_probs=19.4

Q ss_pred             ccccCCcccccCCCeEE--EeCC---eeecccchhcc
Q psy12215         12 KCGCCDCRLGEVGSTLY--QKAN---LILCKRDYLRL   43 (155)
Q Consensus        12 ~C~~C~~~l~~~~~~~~--~~~~---~~~C~~c~~~~   43 (155)
                      .|+.|+-||....  .+  ..||   .-||..||..-
T Consensus         2 ~CQSCGMPl~~~~--~~Gte~dGs~s~~YC~yCy~~G   36 (81)
T PF12674_consen    2 FCQSCGMPLSKDE--DFGTEADGSKSEDYCSYCYQNG   36 (81)
T ss_pred             cCCcCcCccCCcc--ccccccCCCCchhHHHHHhcCC
Confidence            4889999996432  22  2233   36999998753


No 68 
>PF08792 A2L_zn_ribbon:  A2L zinc ribbon domain;  InterPro: IPR014900 This zinc ribbon protein is found associated with some viral A2L transcription factors []. 
Probab=52.38  E-value=16  Score=18.52  Aligned_cols=24  Identities=17%  Similarity=0.283  Sum_probs=15.8

Q ss_pred             ccccCCcccccCCCeEEEeCCeeecccch
Q psy12215         12 KCGCCDCRLGEVGSTLYQKANLILCKRDY   40 (155)
Q Consensus        12 ~C~~C~~~l~~~~~~~~~~~~~~~C~~c~   40 (155)
                      .|..|+.++     .+...++..+|..|-
T Consensus         5 ~C~~C~~~~-----i~~~~~~~~~C~~Cg   28 (33)
T PF08792_consen    5 KCSKCGGNG-----IVNKEDDYEVCIFCG   28 (33)
T ss_pred             EcCCCCCCe-----EEEecCCeEEcccCC
Confidence            477777765     244677777777664


No 69 
>PF12156 ATPase-cat_bd:  Putative metal-binding domain of cation transport ATPase;  InterPro: IPR021993  This domain is found in bacteria, and is approximately 90 amino acids in length. It is found associated with PF00403 from PFAM, PF00122 from PFAM, PF00702 from PFAM. The cysteine-rich nature and composition suggest this might be a cation-binding domain; most members are annotated as being cation transport ATPases. 
Probab=51.64  E-value=12  Score=23.47  Aligned_cols=25  Identities=20%  Similarity=0.336  Sum_probs=12.6

Q ss_pred             ccccCCcccccCCCeEEEeCC--eeec
Q psy12215         12 KCGCCDCRLGEVGSTLYQKAN--LILC   36 (155)
Q Consensus        12 ~C~~C~~~l~~~~~~~~~~~~--~~~C   36 (155)
                      .|..|+.++++....-...+|  +.||
T Consensus         2 ~C~HCg~~~p~~~~~~~~~~g~~~~FC   28 (88)
T PF12156_consen    2 KCYHCGLPVPEGAKITVEIDGEERPFC   28 (88)
T ss_pred             CCCCCCCCCCCCCCeeeeeCCCccccc
Confidence            466677777533222223444  4554


No 70 
>COG2075 RPL24A Ribosomal protein L24E [Translation, ribosomal structure and biogenesis]
Probab=50.77  E-value=17  Score=21.58  Aligned_cols=24  Identities=17%  Similarity=0.498  Sum_probs=15.8

Q ss_pred             ccccCCcccccCCCeEE-EeCCeee
Q psy12215         12 KCGCCDCRLGEVGSTLY-QKANLIL   35 (155)
Q Consensus        12 ~C~~C~~~l~~~~~~~~-~~~~~~~   35 (155)
                      +|+-|+..+.++....+ ..||.++
T Consensus         5 ~CsFcG~~I~PGtG~m~Vr~Dg~v~   29 (66)
T COG2075           5 VCSFCGKKIEPGTGIMYVRNDGKVL   29 (66)
T ss_pred             EecCcCCccCCCceEEEEecCCeEE
Confidence            57888888876544444 4666654


No 71 
>COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair]
Probab=49.76  E-value=13  Score=32.68  Aligned_cols=40  Identities=23%  Similarity=0.368  Sum_probs=30.8

Q ss_pred             cccccCCcccccCCCeEEEeCCeeecccchhccccccccccccccc
Q psy12215         11 LKCGCCDCRLGEVGSTLYQKANLILCKRDYLRLFGTTGYCAACTKV   56 (155)
Q Consensus        11 f~C~~C~~~l~~~~~~~~~~~~~~~C~~c~~~~~~~~~~C~~C~~~   56 (155)
                      ++|..|+.+|     +|....+.+.|..|-.....| ..|..|+..
T Consensus       445 ~~Cp~Cd~~l-----t~H~~~~~L~CH~Cg~~~~~p-~~Cp~Cgs~  484 (730)
T COG1198         445 AECPNCDSPL-----TLHKATGQLRCHYCGYQEPIP-QSCPECGSE  484 (730)
T ss_pred             ccCCCCCcce-----EEecCCCeeEeCCCCCCCCCC-CCCCCCCCC
Confidence            6777888777     477778899999998874333 379999876


No 72 
>smart00291 ZnF_ZZ Zinc-binding domain, present in Dystrophin, CREB-binding protein. Putative zinc-binding domain present in dystrophin-like proteins,  and CREB-binding protein/p300 homologues. The ZZ in dystrophin appears to bind calmodulin. A missense mutation of one of the conserved cysteines in dystrophin results in a patient with Duchenne muscular dystrophy [3].
Probab=48.80  E-value=19  Score=19.27  Aligned_cols=10  Identities=20%  Similarity=0.418  Sum_probs=7.0

Q ss_pred             eeecHHhHHh
Q psy12215         97 KILCEYDYEE  106 (155)
Q Consensus        97 ~~~C~~c~~~  106 (155)
                      .-+|..||.+
T Consensus        27 ~dlC~~Cf~~   36 (44)
T smart00291       27 YDLCQSCFAK   36 (44)
T ss_pred             ccchHHHHhC
Confidence            4578888765


No 73 
>PF11571 Med27:  Mediator complex subunit 27;  InterPro: IPR021627  Mediator is a large complex of up to 33 proteins that is conserved from plants to fungi to humans - the number and representation of individual subunits varying with species. It is arranged into four different sections, a core, a head, a tail and a kinase-activity part, and the number of subunits within each of these is what varies with species. Overall, Mediator regulates the transcriptional activity of RNA polymerase II but it would appear that each of the four different sections has a slightly different function []. Mediator exists in two major forms in human cells: a smaller form that interacts strongly with pol II and activates transcription, and a large form that does not interact strongly with pol II and does not directly activate transcription. The ubiquitous expression of Med27 mRNA suggests a universal requirement for Med27 in transcriptional initiation. Loss of Crsp34/Med27 decreases amacrine cell number, but increases the number of rod photoreceptor cells []. 
Probab=46.70  E-value=5.4  Score=25.19  Aligned_cols=16  Identities=44%  Similarity=0.949  Sum_probs=12.3

Q ss_pred             hhcccccccccccccccc
Q psy12215         40 YLRLFGTTGYCAACTKVI   57 (155)
Q Consensus        40 ~~~~~~~~~~C~~C~~~I   57 (155)
                      |...|..  +|.+|++.+
T Consensus        49 Y~~lfs~--pC~~C~klL   64 (90)
T PF11571_consen   49 YRNLFST--PCKKCGKLL   64 (90)
T ss_pred             Hhhhccc--hhhHHHhHh
Confidence            4556666  799999988


No 74 
>PF00097 zf-C3HC4:  Zinc finger, C3HC4 type (RING finger);  InterPro: IPR018957 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The C3HC4 type zinc-finger (RING finger) is a cysteine-rich domain of 40 to 60 residues that coordinates two zinc ions, and has the consensus sequence: C-X2-C-X(9-39)-C-X(1-3)-H-X(2-3)-C-X2-C-X(4-48)-C-X2-C where X is any amino acid []. Many proteins containing a RING finger play a key role in the ubiquitination pathway []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 1CHC_A 2ECW_A 2Y43_B 1V87_A 2DJB_A 2H0D_B 3RPG_C 3KNV_A 2CKL_B 1JM7_A ....
Probab=46.56  E-value=24  Score=18.08  Aligned_cols=29  Identities=21%  Similarity=0.393  Sum_probs=17.6

Q ss_pred             cccCCcccccCCeEEeeC-CeeecHHhHHhhh
Q psy12215         78 CQQCNHRFCVGDRFYLCD-NKILCEYDYEERQ  108 (155)
Q Consensus        78 C~~C~~~l~~~~~~~~~~-~~~~C~~c~~~~~  108 (155)
                      |..|...+  .......+ |..||..|..+..
T Consensus         1 C~iC~~~~--~~~~~~~~C~H~fC~~C~~~~~   30 (41)
T PF00097_consen    1 CPICLEPF--EDPVILLPCGHSFCRDCLRKWL   30 (41)
T ss_dssp             ETTTSSBC--SSEEEETTTSEEEEHHHHHHHH
T ss_pred             CCcCCccc--cCCCEEecCCCcchHHHHHHHH
Confidence            44555555  23333444 8889999987665


No 75 
>KOG0978|consensus
Probab=45.58  E-value=3.7  Score=35.55  Aligned_cols=48  Identities=23%  Similarity=0.555  Sum_probs=31.1

Q ss_pred             cccccCCcccccCCCeEEEeCCeeecccchhccccc-cccccccccccccCc
Q psy12215         11 LKCGCCDCRLGEVGSTLYQKANLILCKRDYLRLFGT-TGYCAACTKVIPAFE   61 (155)
Q Consensus        11 f~C~~C~~~l~~~~~~~~~~~~~~~C~~c~~~~~~~-~~~C~~C~~~I~~~~   61 (155)
                      ++|+.|+....+   .....=+.+||..|...++.. .-+|+.|+.+..++|
T Consensus       644 LkCs~Cn~R~Kd---~vI~kC~H~FC~~Cvq~r~etRqRKCP~Cn~aFganD  692 (698)
T KOG0978|consen  644 LKCSVCNTRWKD---AVITKCGHVFCEECVQTRYETRQRKCPKCNAAFGAND  692 (698)
T ss_pred             eeCCCccCchhh---HHHHhcchHHHHHHHHHHHHHhcCCCCCCCCCCCccc
Confidence            578888866532   234455567888888776522 116888888876644


No 76 
>TIGR00595 priA primosomal protein N'. All proteins in this family for which functions are known are components of the primosome which is involved in replication, repair, and recombination.This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=45.17  E-value=17  Score=30.44  Aligned_cols=40  Identities=25%  Similarity=0.368  Sum_probs=28.3

Q ss_pred             cccccCCcccccCCCeEEEeCCeeecccchhccccccccccccccc
Q psy12215         11 LKCGCCDCRLGEVGSTLYQKANLILCKRDYLRLFGTTGYCAACTKV   56 (155)
Q Consensus        11 f~C~~C~~~l~~~~~~~~~~~~~~~C~~c~~~~~~~~~~C~~C~~~   56 (155)
                      .+|..|+.+|     +|...++.+.|..|-...-.+ ..|..|+..
T Consensus       223 ~~C~~C~~~l-----~~h~~~~~l~Ch~Cg~~~~~~-~~Cp~C~s~  262 (505)
T TIGR00595       223 LCCPNCDVSL-----TYHKKEGKLRCHYCGYQEPIP-KTCPQCGSE  262 (505)
T ss_pred             cCCCCCCCce-----EEecCCCeEEcCCCcCcCCCC-CCCCCCCCC
Confidence            3455666665     577778889999998776433 289999874


No 77 
>PF15227 zf-C3HC4_4:  zinc finger of C3HC4-type, RING; PDB: 2EGP_A 2ECV_A 2ECJ_A 2YSL_A 2YSJ_A.
Probab=44.96  E-value=36  Score=18.02  Aligned_cols=29  Identities=24%  Similarity=0.332  Sum_probs=19.1

Q ss_pred             cccCCcccccCCeEEeeCCeeecHHhHHhhh
Q psy12215         78 CQQCNHRFCVGDRFYLCDNKILCEYDYEERQ  108 (155)
Q Consensus        78 C~~C~~~l~~~~~~~~~~~~~~C~~c~~~~~  108 (155)
                      |..|...|  .+.....=|..||..|..+..
T Consensus         1 CpiC~~~~--~~Pv~l~CGH~FC~~Cl~~~~   29 (42)
T PF15227_consen    1 CPICLDLF--KDPVSLPCGHSFCRSCLERLW   29 (42)
T ss_dssp             ETTTTSB---SSEEE-SSSSEEEHHHHHHHH
T ss_pred             CCccchhh--CCccccCCcCHHHHHHHHHHH
Confidence            45566666  556666668999999987765


No 78 
>smart00547 ZnF_RBZ Zinc finger domain. Zinc finger domain in Ran-binding proteins (RanBPs), and other proteins. In RanBPs, this domain binds RanGDP.
Probab=43.69  E-value=11  Score=17.55  Aligned_cols=20  Identities=25%  Similarity=0.512  Sum_probs=10.4

Q ss_pred             cccchhcccccccccccccc
Q psy12215         36 CKRDYLRLFGTTGYCAACTK   55 (155)
Q Consensus        36 C~~c~~~~~~~~~~C~~C~~   55 (155)
                      |..|....+.....|..|+.
T Consensus         5 C~~C~~~N~~~~~~C~~C~~   24 (26)
T smart00547        5 CPACTFLNFASRSKCFACGA   24 (26)
T ss_pred             CCCCCCcChhhhccccccCC
Confidence            45555555444445666654


No 79 
>PF00569 ZZ:  Zinc finger, ZZ type;  InterPro: IPR000433 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents ZZ-type zinc finger domains, named because of their ability to bind two zinc ions []. These domains contain 4-6 Cys residues that participate in zinc binding (plus additional Ser/His residues), including a Cys-X2-Cys motif found in other zinc finger domains. These zinc fingers are thought to be involved in protein-protein interactions. The structure of the ZZ domain shows that it belongs to the family of cross-brace zinc finger motifs that include the PHD, RING, and FYVE domains []. ZZ-type zinc finger domains are found in:   Transcription factors P300 and CBP. Plant proteins involved in light responses, such as Hrb1. E3 ubiquitin ligases MEX and MIB2 (6.3.2 from EC). Dystrophin and its homologues.   Single copies of the ZZ zinc finger occur in the transcriptional adaptor/coactivator proteins P300, in cAMP response element-binding protein (CREB)-binding protein (CBP) and ADA2. CBP provides several binding sites for transcriptional coactivators. The site of interaction with the tumour suppressor protein p53 and the oncoprotein E1A with CBP/P300 is a Cys-rich region that incorporates two zinc-binding motifs: ZZ-type and TAZ2-type. The ZZ-type zinc finger of CBP contains two twisted anti-parallel beta-sheets and a short alpha-helix, and binds two zinc ions []. One zinc ion is coordinated by four cysteine residues via 2 Cys-X2-Cys motifs, and the third zinc ion via a third Cys-X-Cys motif and a His-X-His motif. The first zinc cluster is strictly conserved, whereas the second zinc cluster displays variability in the position of the two His residues. In Arabidopsis thaliana (Mouse-ear cress), the hypersensitive to red and blue 1 (Hrb1) protein, which regulating both red and blue light responses, contains a ZZ-type zinc finger domain [].  ZZ-type zinc finger domains have also been identified in the testis-specific E3 ubiquitin ligase MEX that promotes death receptor-induced apoptosis []. MEX has four putative zinc finger domains: one ZZ-type, one SWIM-type and two RING-type. The region containing the ZZ-type and RING-type zinc fingers is required for interaction with UbcH5a and MEX self-association, whereas the SWIM domain was critical for MEX ubiquitination. In addition, the Cys-rich domains of dystrophin, utrophin and an 87kDa post-synaptic protein contain a ZZ-type zinc finger with high sequence identity to P300/CBP ZZ-type zinc fingers. In dystrophin and utrophin, the ZZ-type zinc finger lies between a WW domain (flanked by and EF hand) and the C-terminal coiled-coil domain. Dystrophin is thought to act as a link between the actin cytoskeleton and the extracellular matrix, and perturbations of the dystrophin-associated complex, for example, between dystrophin and the transmembrane glycoprotein beta-dystroglycan, may lead to muscular dystrophy. Dystrophin and its autosomal homologue utrophin interact with beta-dystroglycan via their C-terminal regions, which are comprised of a WW domain, an EF hand domain and a ZZ-type zinc finger domain []. The WW domain is the primary site of interaction between dystrophin or utrophin and dystroglycan, while the EF hand and ZZ-type zinc finger domains stabilise and strengthen this interaction.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 1TOT_A 2DIP_A 2FC7_A 2E5R_A.
Probab=41.55  E-value=38  Score=18.29  Aligned_cols=10  Identities=30%  Similarity=0.458  Sum_probs=7.2

Q ss_pred             eeecHHhHHh
Q psy12215         97 KILCEYDYEE  106 (155)
Q Consensus        97 ~~~C~~c~~~  106 (155)
                      --+|..||.+
T Consensus        28 ~dLC~~C~~~   37 (46)
T PF00569_consen   28 YDLCEDCFSK   37 (46)
T ss_dssp             -EEEHHHHHH
T ss_pred             CchhhHHHhC
Confidence            4578888876


No 80 
>PRK14559 putative protein serine/threonine phosphatase; Provisional
Probab=40.92  E-value=20  Score=31.08  Aligned_cols=37  Identities=22%  Similarity=0.447  Sum_probs=21.7

Q ss_pred             ccccCCcccccCCCeEEEeCCeeecccchhcccccccccccccccccc
Q psy12215         12 KCGCCDCRLGEVGSTLYQKANLILCKRDYLRLFGTTGYCAACTKVIPA   59 (155)
Q Consensus        12 ~C~~C~~~l~~~~~~~~~~~~~~~C~~c~~~~~~~~~~C~~C~~~I~~   59 (155)
                      .|..|+....+         +..||..|-.+.-..  .|..|+..+..
T Consensus         3 ~Cp~Cg~~n~~---------~akFC~~CG~~l~~~--~Cp~CG~~~~~   39 (645)
T PRK14559          3 ICPQCQFENPN---------NNRFCQKCGTSLTHK--PCPQCGTEVPV   39 (645)
T ss_pred             cCCCCCCcCCC---------CCccccccCCCCCCC--cCCCCCCCCCc
Confidence            56677666532         244677776654333  57777766543


No 81 
>KOG2462|consensus
Probab=40.80  E-value=14  Score=28.35  Aligned_cols=69  Identities=20%  Similarity=0.293  Sum_probs=39.6

Q ss_pred             cCcccccCCcccccCCCeEEEeCCeeecccchhccccccccccccccccccCceEEeccCccccccccccccCCccc
Q psy12215          9 DCLKCGCCDCRLGEVGSTLYQKANLILCKRDYLRLFGTTGYCAACTKVIPAFEMVMRAKNNVYHLECFACQQCNHRF   85 (155)
Q Consensus         9 ~Cf~C~~C~~~l~~~~~~~~~~~~~~~C~~c~~~~~~~~~~C~~C~~~I~~~~~~~~~~~~~~H~~Cf~C~~C~~~l   85 (155)
                      ..++|.+|++.+..  ..=..+..+.-|..+-.+.+    .|..|++.-.... . ...-..-|.-=+.|..|++.+
T Consensus       129 ~r~~c~eCgk~ysT--~snLsrHkQ~H~~~~s~ka~----~C~~C~K~YvSmp-A-LkMHirTH~l~c~C~iCGKaF  197 (279)
T KOG2462|consen  129 PRYKCPECGKSYST--SSNLSRHKQTHRSLDSKKAF----SCKYCGKVYVSMP-A-LKMHIRTHTLPCECGICGKAF  197 (279)
T ss_pred             Cceecccccccccc--ccccchhhcccccccccccc----cCCCCCceeeehH-H-HhhHhhccCCCcccccccccc
Confidence            45789999998842  12234555566655553333    5888887554311 1 111122355456888999988


No 82 
>PF03854 zf-P11:  P-11 zinc finger;  InterPro: IPR003224 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The RING-finger is a specialised type of Zn-finger of 40 to 60 residues that binds two atoms of zinc, and is probably involved in mediating protein-protein interactions [, , ]. There are two different variants, the C3HC4-type and a C3H2C3-type, which is clearly related despite the different cysteine/histidine pattern. The latter type is sometimes referred to as 'RING-H2 finger'. The RING domain is a protein interaction domain which has been implicated in a range of diverse biological processes. Several 3D-structures for RING-fingers are known [, ]. The 3D structure of the zinc ligation system is unique to the RING domain and is referred to as the 'cross-brace' motif. The spacing of the cysteines in such a domain is:  C-x(2)-C-x(9 to 39)-C-x(1 to 3)-H-x(2 to 3)-C-x(2)-C-x(4 to 48)-C-x(2)-C  Metal ligand pairs one and three co-ordinate to bind one zinc ion, whilst pairs two and four bind the second. This entry represents RING finger protein Z, a small polypeptide found in some negative-strand RNA viruses including Lassa fever virus, which plays a crucial role in virion assembly and budding. RING finger Z has been shown to interact with several host proteins, including promyelocytic leukemia protein and the eukaryotic translation initiation factor 4E [, ]. It is sufficient in the absence of any other viral proteins to release virus-like particles from the infected cell []. This protein is also responsible for arenavirus superinfection exclusion; expression of this protein in a host cell strongly and specifically inhibits areanavirus transcription and replication []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003723 RNA binding, 0008270 zinc ion binding; PDB: 2KO5_A.
Probab=40.18  E-value=41  Score=18.73  Aligned_cols=28  Identities=18%  Similarity=0.364  Sum_probs=17.3

Q ss_pred             CCeeecHHhHHhhhcccCCCeeeecCCeec
Q psy12215         95 DNKILCEYDYEERQVFCVGDRFYLCDNKIL  124 (155)
Q Consensus        95 ~~~~~C~~c~~~~~~~~~~~~c~~c~~~i~  124 (155)
                      .+..+|..|...  ++..++.|.+|..+++
T Consensus        19 ~dHYLCl~CLt~--ml~~s~~C~iC~~~LP   46 (50)
T PF03854_consen   19 SDHYLCLNCLTL--MLSRSDRCPICGKPLP   46 (50)
T ss_dssp             SS-EEEHHHHHH--T-SSSSEETTTTEE--
T ss_pred             cchhHHHHHHHH--HhccccCCCcccCcCc
Confidence            345556666554  3477899999998887


No 83 
>COG2888 Predicted Zn-ribbon RNA-binding protein with a function in translation [Translation, ribosomal structure and biogenesis]
Probab=39.68  E-value=14  Score=21.52  Aligned_cols=10  Identities=20%  Similarity=0.730  Sum_probs=6.8

Q ss_pred             ccccCCcccc
Q psy12215         12 KCGCCDCRLG   21 (155)
Q Consensus        12 ~C~~C~~~l~   21 (155)
                      +|+.|+..|.
T Consensus        11 ~CtSCg~~i~   20 (61)
T COG2888          11 VCTSCGREIA   20 (61)
T ss_pred             eeccCCCEec
Confidence            5677777774


No 84 
>cd02336 ZZ_RSC8 Zinc finger, ZZ type. Zinc finger present in RSC8 and related proteins. RSC8 is a component of the RSC complex, which is closely related to the SWI/SNF complex and is involved in remodeling chromatin structure. The ZZ motif coordinates a zinc ion and most likely participates in ligand binding or molecular scaffolding.
Probab=37.00  E-value=40  Score=18.37  Aligned_cols=30  Identities=23%  Similarity=0.409  Sum_probs=18.0

Q ss_pred             ccccCCcccccCCeEEee--CCeeecHHhHHhh
Q psy12215         77 ACQQCNHRFCVGDRFYLC--DNKILCEYDYEER  107 (155)
Q Consensus        77 ~C~~C~~~l~~~~~~~~~--~~~~~C~~c~~~~  107 (155)
                      .|..|+..+ ...+|.-.  .+..+|..||.+-
T Consensus         2 ~C~~Cg~D~-t~vryh~~~~~~~dLC~~CF~~G   33 (45)
T cd02336           2 HCFTCGNDC-TRVRYHNLKAKKYDLCPSCYQEG   33 (45)
T ss_pred             cccCCCCcc-CceEEEecCCCccccChHHHhCc
Confidence            466677776 33344321  2467899998763


No 85 
>PF04981 NMD3:  NMD3 family ;  InterPro: IPR007064 The NMD3 protein is involved in nonsense mediated mRNA decay. This N-terminal region contains four conserved CXXC motifs that could be metal binding. NMD3 is involved in export of the 60S ribosomal subunit is mediated by the adapter protein Nmd3p in a Crm1p-dependent pathway [].
Probab=36.87  E-value=24  Score=26.32  Aligned_cols=40  Identities=23%  Similarity=0.434  Sum_probs=25.5

Q ss_pred             cccCCcccccCCCeEEEeCCeeecccchhccccccc--------cccccccccccC
Q psy12215         13 CGCCDCRLGEVGSTLYQKANLILCKRDYLRLFGTTG--------YCAACTKVIPAF   60 (155)
Q Consensus        13 C~~C~~~l~~~~~~~~~~~~~~~C~~c~~~~~~~~~--------~C~~C~~~I~~~   60 (155)
                      |-.||.+.++.      .  .-+|.+||.+.+....        .|..|+....++
T Consensus         1 C~~CG~~~~~~------~--~~lC~~C~~~~~~i~ei~~~i~v~~C~~Cg~~~~~~   48 (236)
T PF04981_consen    1 CPRCGREIEPL------I--DGLCPDCYLKRFDIIEIPDRIEVTICPKCGRYRIGG   48 (236)
T ss_pred             CCCCCCCCCCc------c--cccChHHhcccCCeeecCCccCceECCCCCCEECCC
Confidence            56788876421      1  1389999988764321        488887776653


No 86 
>PF10122 Mu-like_Com:  Mu-like prophage protein Com;  InterPro: IPR019294  Members of this entry belong to the Com family of proteins that act as translational regulators of mom [, ]. 
Probab=36.57  E-value=21  Score=20.12  Aligned_cols=12  Identities=33%  Similarity=1.019  Sum_probs=9.6

Q ss_pred             cccccCCccccc
Q psy12215         11 LKCGCCDCRLGE   22 (155)
Q Consensus        11 f~C~~C~~~l~~   22 (155)
                      ++|..|++.|..
T Consensus         5 iRC~~CnklLa~   16 (51)
T PF10122_consen    5 IRCGHCNKLLAK   16 (51)
T ss_pred             eeccchhHHHhh
Confidence            678889998854


No 87 
>PF10886 DUF2685:  Protein of unknown function (DUF2685);  InterPro: IPR024362 This is a family of uncharacterised bacteriophage proteins. Their function in unknown.
Probab=36.18  E-value=31  Score=19.67  Aligned_cols=24  Identities=21%  Similarity=0.488  Sum_probs=13.7

Q ss_pred             cccccccccccCceEEeccCccccc
Q psy12215         49 YCAACTKVIPAFEMVMRAKNNVYHL   73 (155)
Q Consensus        49 ~C~~C~~~I~~~~~~~~~~~~~~H~   73 (155)
                      +|..|+++|.+. ..+...+..-|+
T Consensus         3 ~CvVCKqpi~~a-~~v~T~~G~VH~   26 (54)
T PF10886_consen    3 ICVVCKQPIDDA-LVVETESGPVHP   26 (54)
T ss_pred             eeeeeCCccCcc-eEEEcCCCccCc
Confidence            577777777654 344444445554


No 88 
>COG3813 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=35.80  E-value=34  Score=20.79  Aligned_cols=45  Identities=20%  Similarity=0.395  Sum_probs=28.5

Q ss_pred             cccCCcccccCCC-eEEEeCCeeecccchhcccccccccccccccccc
Q psy12215         13 CGCCDCRLGEVGS-TLYQKANLILCKRDYLRLFGTTGYCAACTKVIPA   59 (155)
Q Consensus        13 C~~C~~~l~~~~~-~~~~~~~~~~C~~c~~~~~~~~~~C~~C~~~I~~   59 (155)
                      |.-|++.|+..+. ..+-.-.-.||.+|...++..  .|..|+..+..
T Consensus         8 CECCDrDLpp~s~dA~ICtfEcTFCadCae~~l~g--~CPnCGGelv~   53 (84)
T COG3813           8 CECCDRDLPPDSTDARICTFECTFCADCAENRLHG--LCPNCGGELVA   53 (84)
T ss_pred             CcccCCCCCCCCCceeEEEEeeehhHhHHHHhhcC--cCCCCCchhhc
Confidence            4446777763221 222222346899999977765  79999987753


No 89 
>PF00641 zf-RanBP:  Zn-finger in Ran binding protein and others;  InterPro: IPR001876 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents the zinc finger domain found in RanBP2 proteins. Ran is an evolutionary conserved member of the Ras superfamily that regulates all receptor-mediated transport between the nucleus and the cytoplasm. Ran binding protein 2 (RanBP2) is a 358kDa nucleoporin located on the cytoplasmic side of the nuclear pore complex which plays a role in nuclear protein import []. RanBP2 contains multiple zinc fingers which mediate binding to RanGDP []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0005622 intracellular; PDB: 2D9G_A 2EBR_A 2WX0_C 2WX1_C 2WWZ_C 3GJ6_B 2LK0_A 2LK1_A 3GJ5_B 3GJ8_B ....
Probab=33.75  E-value=27  Score=16.86  Aligned_cols=24  Identities=17%  Similarity=0.189  Sum_probs=12.2

Q ss_pred             eeecccchhccccccccccccccc
Q psy12215         33 LILCKRDYLRLFGTTGYCAACTKV   56 (155)
Q Consensus        33 ~~~C~~c~~~~~~~~~~C~~C~~~   56 (155)
                      .=.|..|...++....+|..|+.+
T Consensus         4 ~W~C~~C~~~N~~~~~~C~~C~~~   27 (30)
T PF00641_consen    4 DWKCPSCTFMNPASRSKCVACGAP   27 (30)
T ss_dssp             SEEETTTTEEEESSSSB-TTT--B
T ss_pred             CccCCCCcCCchHHhhhhhCcCCC
Confidence            344666666665554467777654


No 90 
>smart00659 RPOLCX RNA polymerase subunit CX. present in RNA polymerase I, II and III
Probab=33.74  E-value=26  Score=19.01  Aligned_cols=11  Identities=27%  Similarity=0.576  Sum_probs=8.2

Q ss_pred             cccccCCcccc
Q psy12215         11 LKCGCCDCRLG   21 (155)
Q Consensus        11 f~C~~C~~~l~   21 (155)
                      +.|..|+..+.
T Consensus         3 Y~C~~Cg~~~~   13 (44)
T smart00659        3 YICGECGRENE   13 (44)
T ss_pred             EECCCCCCEee
Confidence            57888888763


No 91 
>cd02340 ZZ_NBR1_like Zinc finger, ZZ type. Zinc finger present in Drosophila ref(2)P, NBR1, Human sequestosome 1 and related proteins. The ZZ motif coordinates two zinc ions and most likely participates in ligand binding or molecular scaffolding. Drosophila ref(2)P appears to control the multiplication of sigma rhabdovirus. NBR1 (Next to BRCA1 gene 1 protein) interacts with fasciculation and elongation protein zeta-1 (FEZ1) and calcium and integrin binding protein (CIB), and may function in cell signalling pathways. Sequestosome 1 is a phosphotyrosine independent ligand for the Lck SH2 domain and binds noncovalently to ubiquitin via its UBA domain.
Probab=33.68  E-value=38  Score=18.12  Aligned_cols=11  Identities=27%  Similarity=0.676  Sum_probs=6.0

Q ss_pred             ccccccccccc
Q psy12215         49 YCAACTKVIPA   59 (155)
Q Consensus        49 ~C~~C~~~I~~   59 (155)
                      .|..|+++|.+
T Consensus         2 ~Cd~C~~~i~G   12 (43)
T cd02340           2 ICDGCQGPIVG   12 (43)
T ss_pred             CCCCCCCcCcC
Confidence            36666665543


No 92 
>PF10764 Gin:  Inhibitor of sigma-G Gin;  InterPro: IPR019700  Gin allows sigma-F to delay late forespore transcription by preventing sigma-G to take over before the cell has reached a critical stage of development. Gin is also known as CsfB []. 
Probab=33.27  E-value=35  Score=18.74  Aligned_cols=28  Identities=21%  Similarity=0.363  Sum_probs=16.4

Q ss_pred             ccccCCcccccCCCeEEEeCCeeecccchhcc
Q psy12215         12 KCGCCDCRLGEVGSTLYQKANLILCKRDYLRL   43 (155)
Q Consensus        12 ~C~~C~~~l~~~~~~~~~~~~~~~C~~c~~~~   43 (155)
                      +|..|+++..+ |   ....|+..|.+|-.+.
T Consensus         1 ~CiiC~~~~~~-G---I~I~~~fIC~~CE~~i   28 (46)
T PF10764_consen    1 KCIICGKEKEE-G---IHIYGKFICSDCEKEI   28 (46)
T ss_pred             CeEeCCCcCCC-C---EEEECeEehHHHHHHh
Confidence            46677887754 2   4445566666655443


No 93 
>cd00472 Ribosomal_L24e_L24 Ribosomal protein L24e/L24 is a ribosomal protein found in eukaryotes (L24) and in archaea (L24e, distinct from archaeal L24). L24e/L24 is located on the surface of the large subunit, adjacent to proteins L14 and L3, and near the translation factor binding site.  L24e/L24 appears to play a role in the kinetics of peptide synthesis, and may be involved in interactions between the large and small subunits, either directly or through other factors. In mouse, a deletion mutation in L24 has been identified as the cause for the belly spot and tail (Bst) mutation that results in disrupted pigmentation, somitogenesis and retinal cell fate determination.  L24 may be an important protein in eukaryotic reproduction:  in shrimp, L24 expression is elevated in the ovary, suggesting a role in oogenesis, and in Arabidopsis, L24 has been proposed to have a specific function in gynoecium development. No protein with sequence or structural homology to L24e/L24 has been identifi
Probab=33.25  E-value=42  Score=19.10  Aligned_cols=24  Identities=17%  Similarity=0.484  Sum_probs=14.8

Q ss_pred             ccccCCccccc-CCCeEEEeCCeee
Q psy12215         12 KCGCCDCRLGE-VGSTLYQKANLIL   35 (155)
Q Consensus        12 ~C~~C~~~l~~-~~~~~~~~~~~~~   35 (155)
                      .|+-|+..+.+ .+..|+..||+++
T Consensus         5 ~C~f~g~~I~PG~G~~~Vr~Dgkv~   29 (54)
T cd00472           5 KCSFCGYKIYPGHGKMYVRNDGKVF   29 (54)
T ss_pred             EecCcCCeecCCCccEEEecCCCEE
Confidence            46777777754 3445666777654


No 94 
>PF08271 TF_Zn_Ribbon:  TFIIB zinc-binding;  InterPro: IPR013137 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents a zinc finger motif found in transcription factor IIB (TFIIB). In eukaryotes the initiation of transcription of protein encoding genes by the polymerase II complexe (Pol II) is modulated by general and specific transcription factors. The general transcription factors operate through common promoters elements (such as the TATA box). At least seven different proteins associate to form the general transcription factors: TFIIA, -IIB, -IID, -IIE, -IIF, -IIG, and -IIH [].  TFIIB and TFIID are responsible for promoter recognition and interaction with pol II; together with Pol II, they form a minimal initiation complex capable of transcription under certain conditions. The TATA box of a Pol II promoter is bound in the initiation complex by the TBP subunit of TFIID, which bends the DNA around the C-terminal domain of TFIIB whereas the N-terminal zinc finger of TFIIB interacts with Pol II [, ]. The TFIIB zinc finger adopts a zinc ribbon fold characterised by two beta-hairpins forming two structurally similar zinc-binding sub-sites []. The zinc finger contacts the rbp1 subunit of Pol II through its dock domain, a conserved region of about 70 amino acids located close to the polymerase active site []. In the Pol II complex this surface is located near the RNA exit groove. Interestingly this sequence is best conserved in the three polymerases that utilise a TFIIB-like general transcription factor (Pol II, Pol III, and archaeal RNA polymerase) but not in Pol I [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0006355 regulation of transcription, DNA-dependent; PDB: 1VD4_A 1PFT_A 3K1F_M 3K7A_M 1RO4_A 1RLY_A 1DL6_A.
Probab=33.19  E-value=29  Score=18.41  Aligned_cols=10  Identities=30%  Similarity=0.813  Sum_probs=5.4

Q ss_pred             cccccccccc
Q psy12215         49 YCAACTKVIP   58 (155)
Q Consensus        49 ~C~~C~~~I~   58 (155)
                      .|..|+..|.
T Consensus        21 vC~~CG~Vl~   30 (43)
T PF08271_consen   21 VCPNCGLVLE   30 (43)
T ss_dssp             EETTT-BBEE
T ss_pred             ECCCCCCEee
Confidence            4666666664


No 95 
>PRK12495 hypothetical protein; Provisional
Probab=33.11  E-value=21  Score=26.61  Aligned_cols=26  Identities=12%  Similarity=0.194  Sum_probs=17.0

Q ss_pred             ccCcccccCCcccccCCCeEEEeCCeeecccch
Q psy12215          8 EDCLKCGCCDCRLGEVGSTLYQKANLILCKRDY   40 (155)
Q Consensus         8 ~~Cf~C~~C~~~l~~~~~~~~~~~~~~~C~~c~   40 (155)
                      +.-+.|..|+.||.       ...|..+|..|-
T Consensus        40 msa~hC~~CG~PIp-------a~pG~~~Cp~CQ   65 (226)
T PRK12495         40 MTNAHCDECGDPIF-------RHDGQEFCPTCQ   65 (226)
T ss_pred             cchhhcccccCccc-------CCCCeeECCCCC
Confidence            34467888999983       336777665554


No 96 
>PF04564 U-box:  U-box domain;  InterPro: IPR003613 Quality control of intracellular proteins is essential for cellular homeostasis. Molecular chaperones recognise and contribute to the refolding of misfolded or unfolded proteins, whereas the ubiquitin-proteasome system mediates the degradation of such abnormal proteins. Ubiquitin-protein ligases (E3s) determine the substrate specificity for ubiquitylation and have been classified into HECT and RING-finger families. More recently, however, U-box proteins, which contain a domain (the U box) of about 70 amino acids that is conserved from yeast to humans, have been identified as a new type of E3 []. Members of the U-box family of proteins constitute a class of ubiquitin-protein ligases (E3s) distinct from the HECT-type and RING finger-containing E3 families []. Using yeast two-hybrid technology, all mammalian U-box proteins have been reported to interact with molecular chaperones or co-chaperones, including Hsp90, Hsp70, DnaJc7, EKN1, CRN, and VCP. This suggests that the function of U box-type E3s is to mediate the degradation of unfolded or misfolded proteins in conjunction with molecular chaperones as receptors that recognise such abnormal proteins [, ]. Unlike the RING finger domain, IPR001841 from INTERPRO, that is stabilised by Zn2+ ions coordinated by the cysteines and a histidine, the U-box scaffold is probably stabilised by a system of salt-bridges and hydrogen bonds. The charged and polar residues that participate in this network of bonds are more strongly conserved in the U-box proteins than in classic RING fingers, which supports their role in maintaining the stability of the U box. Thus, the U box appears to have evolved from a RING finger domain by appropriation of a new set of residues required to stabilise its structure, concomitant with the loss of the original, metal-chelating residues [].; GO: 0004842 ubiquitin-protein ligase activity, 0016567 protein ubiquitination, 0000151 ubiquitin ligase complex; PDB: 1T1H_A 2C2L_D 2C2V_V 1WGM_A 2KR4_A 3L1Z_B 3L1X_A 2KRE_A 3M63_A 2QIZ_A ....
Probab=32.54  E-value=63  Score=19.23  Aligned_cols=48  Identities=8%  Similarity=0.048  Sum_probs=31.2

Q ss_pred             cCcccccCCcccccCCCeEEEeCCeeecccchhccccc-ccccccccccccc
Q psy12215          9 DCLKCGCCDCRLGEVGSTLYQKANLILCKRDYLRLFGT-TGYCAACTKVIPA   59 (155)
Q Consensus         9 ~Cf~C~~C~~~l~~~~~~~~~~~~~~~C~~c~~~~~~~-~~~C~~C~~~I~~   59 (155)
                      .=|.|..++..+.   ......+|..|...+..+-+.. ...|..++.++..
T Consensus         3 ~~f~CpIt~~lM~---dPVi~~~G~tyer~~I~~~l~~~~~~~P~t~~~l~~   51 (73)
T PF04564_consen    3 DEFLCPITGELMR---DPVILPSGHTYERSAIERWLEQNGGTDPFTRQPLSE   51 (73)
T ss_dssp             GGGB-TTTSSB-S---SEEEETTSEEEEHHHHHHHHCTTSSB-TTT-SB-SG
T ss_pred             cccCCcCcCcHhh---CceeCCcCCEEcHHHHHHHHHcCCCCCCCCCCcCCc
Confidence            4588888888774   3578889999998877665433 3378888888865


No 97 
>PF06827 zf-FPG_IleRS:  Zinc finger found in FPG and IleRS;  InterPro: IPR010663 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents a zinc finger domain found at the C-terminal in both DNA glycosylase/AP lyase enzymes and in isoleucyl tRNA synthetase. In these two types of enzymes, the C-terminal domain forms a zinc finger. Some related proteins may not bind zinc.  DNA glycosylase/AP lyase enzymes are involved in base excision repair of DNA damaged by oxidation or by mutagenic agents. These enzymes have both DNA glycosylase activity (3.2.2 from EC) and AP lyase activity (4.2.99.18 from EC) []. Examples include formamidopyrimidine-DNA glycosylases (Fpg; MutM) and endonuclease VIII (Nei). Formamidopyrimidine-DNA glycosylases (Fpg, MutM) is a trifunctional DNA base excision repair enzyme that removes a wide range of oxidation-damaged bases (N-glycosylase activity; 3.2.2.23 from EC) and cleaves both the 3'- and 5'-phosphodiester bonds of the resulting apurinic/apyrimidinic site (AP lyase activity; 4.2.99.18 from EC). Fpg has a preference for oxidised purines, excising oxidized purine bases such as 7,8-dihydro-8-oxoguanine (8-oxoG). ITs AP (apurinic/apyrimidinic) lyase activity introduces nicks in the DNA strand, cleaving the DNA backbone by beta-delta elimination to generate a single-strand break at the site of the removed base with both 3'- and 5'-phosphates. Fpg is a monomer composed of 2 domains connected by a flexible hinge []. The two DNA-binding motifs (a zinc finger and the helix-two-turns-helix motifs) suggest that the oxidized base is flipped out from double-stranded DNA in the binding mode and excised by a catalytic mechanism similar to that of bifunctional base excision repair enzymes []. Fpg binds one ion of zinc at the C terminus, which contains four conserved and essential cysteines []. Endonuclease VIII (Nei) has the same enzyme activities as Fpg above, but with a preference for oxidized pyrimidines, such as thymine glycol, 5,6-dihydrouracil and 5,6-dihydrothymine [, ].  An Fpg-type zinc finger is also found at the C terminus of isoleucyl tRNA synthetase (6.1.1.5 from EC) [, ]. This enzyme catalyses the attachment of isoleucine to tRNA(Ile). As IleRS can inadvertently accommodate and process structurally similar amino acids such as valine, to avoid such errors it has two additional distinct tRNA(Ile)-dependent editing activities. One activity is designated as 'pre-transfer' editing and involves the hydrolysis of activated Val-AMP. The other activity is designated 'post-transfer' editing and involves deacylation of mischarged Val-tRNA(Ile) [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003824 catalytic activity; PDB: 1K82_C 1Q39_A 2OQ4_B 2OPF_A 1K3X_A 1K3W_A 1Q3B_A 2EA0_A 1Q3C_A 2XZF_A ....
Probab=32.34  E-value=26  Score=16.92  Aligned_cols=10  Identities=30%  Similarity=0.677  Sum_probs=4.9

Q ss_pred             cccccccccc
Q psy12215         49 YCAACTKVIP   58 (155)
Q Consensus        49 ~C~~C~~~I~   58 (155)
                      +|.+|...|.
T Consensus         3 ~C~rC~~~~~   12 (30)
T PF06827_consen    3 KCPRCWNYIE   12 (30)
T ss_dssp             B-TTT--BBE
T ss_pred             cCccCCCcce
Confidence            5777777774


No 98 
>PF07754 DUF1610:  Domain of unknown function (DUF1610);  InterPro: IPR011668 This domain is found in archaeal species. It is likely to bind zinc via its four well-conserved cysteine residues.
Probab=31.73  E-value=32  Score=16.16  Aligned_cols=9  Identities=22%  Similarity=0.652  Sum_probs=4.1

Q ss_pred             ccccccccc
Q psy12215         51 AACTKVIPA   59 (155)
Q Consensus        51 ~~C~~~I~~   59 (155)
                      ..|+..|.+
T Consensus         2 ~sC~~~i~~   10 (24)
T PF07754_consen    2 TSCGRPIAP   10 (24)
T ss_pred             ccCCCcccC
Confidence            344444443


No 99 
>PRK00398 rpoP DNA-directed RNA polymerase subunit P; Provisional
Probab=31.62  E-value=26  Score=18.87  Aligned_cols=11  Identities=27%  Similarity=0.721  Sum_probs=8.4

Q ss_pred             cccccCCcccc
Q psy12215         11 LKCGCCDCRLG   21 (155)
Q Consensus        11 f~C~~C~~~l~   21 (155)
                      |+|..|+..+.
T Consensus         4 y~C~~CG~~~~   14 (46)
T PRK00398          4 YKCARCGREVE   14 (46)
T ss_pred             EECCCCCCEEE
Confidence            67888888773


No 100
>PF04810 zf-Sec23_Sec24:  Sec23/Sec24 zinc finger;  InterPro: IPR006895 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  COPII (coat protein complex II)-coated vesicles carry proteins from the endoplasmic reticulum (ER) to the Golgi complex []. COPII-coated vesicles form on the ER by the stepwise recruitment of three cytosolic components: Sar1-GTP to initiate coat formation, Sec23/24 heterodimer to select SNARE and cargo molecules, and Sec13/31 to induce coat polymerisation and membrane deformation [].  Sec23 p and Sec24p are structurally related, folding into five distinct domains: a beta-barrel, a zinc-finger, an alpha/beta trunk domain (IPR006896 from INTERPRO), an all-helical region (IPR006900 from INTERPRO), and a C-terminal gelsolin-like domain (IPR007123 from INTERPRO). This entry describes an approximately 55-residue Sec23/24 zinc-binding domain, which lies against the beta-barrel at the periphery of the complex. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0006886 intracellular protein transport, 0006888 ER to Golgi vesicle-mediated transport, 0030127 COPII vesicle coat; PDB: 3EFO_B 3EG9_B 3EGD_A 2YRC_A 2NUP_A 2YRD_A 3EGX_A 2NUT_A 3EH1_A 1PD0_A ....
Probab=31.41  E-value=40  Score=17.67  Aligned_cols=29  Identities=17%  Similarity=0.583  Sum_probs=12.5

Q ss_pred             cccccccccccCceEEeccCccccccccccccCCc
Q psy12215         49 YCAACTKVIPAFEMVMRAKNNVYHLECFACQQCNH   83 (155)
Q Consensus        49 ~C~~C~~~I~~~~~~~~~~~~~~H~~Cf~C~~C~~   83 (155)
                      +|..|+..|.+- ..+...++.|     .|..|+.
T Consensus         4 rC~~C~aylNp~-~~~~~~~~~w-----~C~~C~~   32 (40)
T PF04810_consen    4 RCRRCRAYLNPF-CQFDDGGKTW-----ICNFCGT   32 (40)
T ss_dssp             B-TTT--BS-TT-SEEETTTTEE-----EETTT--
T ss_pred             ccCCCCCEECCc-ceEcCCCCEE-----ECcCCCC
Confidence            677787777662 2333434443     6666654


No 101
>PF01286 XPA_N:  XPA protein N-terminal;  InterPro: IPR022652 Xeroderma pigmentosum (XP) [] is a human autosomal recessive disease, characterised by a high incidence of sunlight-induced skin cancer. Skin cells of individual's with this condition are hypersensitive to ultraviolet light, due to defects in the incision step of DNA excision repair. There are a minimum of seven genetic complementation groups involved in this pathway: XP-A to XP-G. XP-A is the most severe form of the disease and is due to defects in a 30 kDa nuclear protein called XPA (or XPAC) []. The sequence of the XPA protein is conserved from higher eukaryotes [] to yeast (gene RAD14) []. XPA is a hydrophilic protein of 247 to 296 amino-acid residues which has a C4-type zinc finger motif in its central section. This entry contains the zinc-finger containing region in the XPA protein. It is found N-terminal to PF05181 from PFAM ; PDB: 1D4U_A 1XPA_A.
Probab=31.38  E-value=16  Score=18.78  Aligned_cols=10  Identities=30%  Similarity=0.607  Sum_probs=4.5

Q ss_pred             ccccCCcccc
Q psy12215         12 KCGCCDCRLG   21 (155)
Q Consensus        12 ~C~~C~~~l~   21 (155)
                      .|..|++++.
T Consensus         5 ~C~eC~~~f~   14 (34)
T PF01286_consen    5 KCDECGKPFM   14 (34)
T ss_dssp             E-TTT--EES
T ss_pred             hHhHhCCHHH
Confidence            4667777773


No 102
>cd02335 ZZ_ADA2 Zinc finger, ZZ type. Zinc finger present in ADA2, a putative transcriptional adaptor, and related proteins. The ZZ motif coordinates two zinc ions and most likely participates in ligand binding or molecular scaffolding.
Probab=30.24  E-value=49  Score=18.12  Aligned_cols=10  Identities=20%  Similarity=0.245  Sum_probs=6.5

Q ss_pred             eecHHhHHhh
Q psy12215         98 ILCEYDYEER  107 (155)
Q Consensus        98 ~~C~~c~~~~  107 (155)
                      -+|..||...
T Consensus        25 dLC~~Cf~~g   34 (49)
T cd02335          25 DLCLECFSAG   34 (49)
T ss_pred             chhHHhhhCc
Confidence            4677777653


No 103
>PRK14891 50S ribosomal protein L24e/unknown domain fusion protein; Provisional
Probab=30.08  E-value=45  Score=22.65  Aligned_cols=24  Identities=17%  Similarity=0.400  Sum_probs=14.5

Q ss_pred             ccccCCccccc-CCCeEEEeCCeee
Q psy12215         12 KCGCCDCRLGE-VGSTLYQKANLIL   35 (155)
Q Consensus        12 ~C~~C~~~l~~-~~~~~~~~~~~~~   35 (155)
                      +|+-|+.+|.+ .|..|+..||++|
T Consensus         6 ~CsFcG~kIyPG~G~~fVR~DGkvf   30 (131)
T PRK14891          6 TCDYTGEEIEPGTGTMFVRKDGTVL   30 (131)
T ss_pred             eecCcCCcccCCCCcEEEecCCCEE
Confidence            47777777753 3445556666654


No 104
>PF10083 DUF2321:  Uncharacterized protein conserved in bacteria (DUF2321);  InterPro: IPR016891 This entry is represented by Bacteriophage 'Lactobacillus prophage Lj928', Orf-Ljo1454. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches. There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function.
Probab=30.05  E-value=5.7  Score=27.81  Aligned_cols=34  Identities=15%  Similarity=0.138  Sum_probs=20.4

Q ss_pred             eeecHHhHHhhhcccCCCeeeecCCeecchhhHHHHHHH
Q psy12215         97 KILCEYDYEERQVFCVGDRFYLCDNKILCEYDYEERQVF  135 (155)
Q Consensus        97 ~~~C~~c~~~~~~~~~~~~c~~c~~~i~c~~~~~~~~~~  135 (155)
                      .-||..|=.+..     ..|..|+.+|.+..+.++.+.+
T Consensus        28 ~~fC~kCG~~tI-----~~Cp~C~~~IrG~y~v~gv~~~   61 (158)
T PF10083_consen   28 EKFCSKCGAKTI-----TSCPNCSTPIRGDYHVEGVFGL   61 (158)
T ss_pred             HHHHHHhhHHHH-----HHCcCCCCCCCCceecCCeeee
Confidence            346666655543     5666677777666665555555


No 105
>PF00096 zf-C2H2:  Zinc finger, C2H2 type;  InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger: #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C], where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter []. This entry represents the classical C2H2 zinc finger domain.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0005622 intracellular; PDB: 2D9H_A 2EPC_A 1SP1_A 1VA3_A 2WBT_B 2ELR_A 2YTP_A 2YTT_A 1VA1_A 2ELO_A ....
Probab=29.94  E-value=20  Score=15.79  Aligned_cols=10  Identities=30%  Similarity=0.753  Sum_probs=6.1

Q ss_pred             cccccCCccc
Q psy12215         11 LKCGCCDCRL   20 (155)
Q Consensus        11 f~C~~C~~~l   20 (155)
                      |+|..|++.+
T Consensus         1 y~C~~C~~~f   10 (23)
T PF00096_consen    1 YKCPICGKSF   10 (23)
T ss_dssp             EEETTTTEEE
T ss_pred             CCCCCCCCcc
Confidence            4566666655


No 106
>PRK05580 primosome assembly protein PriA; Validated
Probab=29.60  E-value=43  Score=29.20  Aligned_cols=39  Identities=23%  Similarity=0.397  Sum_probs=25.9

Q ss_pred             ccccCCcccccCCCeEEEeCCeeecccchhccccccccccccccc
Q psy12215         12 KCGCCDCRLGEVGSTLYQKANLILCKRDYLRLFGTTGYCAACTKV   56 (155)
Q Consensus        12 ~C~~C~~~l~~~~~~~~~~~~~~~C~~c~~~~~~~~~~C~~C~~~   56 (155)
                      +|..|+.+|     +|....+.+.|..|-.....+ ..|..|+..
T Consensus       392 ~C~~C~~~l-----~~h~~~~~l~Ch~Cg~~~~~~-~~Cp~Cg~~  430 (679)
T PRK05580        392 ECPHCDASL-----TLHRFQRRLRCHHCGYQEPIP-KACPECGST  430 (679)
T ss_pred             CCCCCCCce-----eEECCCCeEECCCCcCCCCCC-CCCCCCcCC
Confidence            445555555     455667788899998775322 279999775


No 107
>PRK04136 rpl40e 50S ribosomal protein L40e; Provisional
Probab=28.66  E-value=27  Score=19.37  Aligned_cols=24  Identities=25%  Similarity=0.297  Sum_probs=16.4

Q ss_pred             Ceeecccchhcccccccccccccc
Q psy12215         32 NLILCKRDYLRLFGTTGYCAACTK   55 (155)
Q Consensus        32 ~~~~C~~c~~~~~~~~~~C~~C~~   55 (155)
                      ++..|-.||.++...+..|..|+-
T Consensus        13 ~k~ICrkC~ARnp~~A~~CRKCg~   36 (48)
T PRK04136         13 NKKICMRCNARNPWRATKCRKCGY   36 (48)
T ss_pred             cccchhcccCCCCccccccccCCC
Confidence            355688888877655557877764


No 108
>TIGR00570 cdk7 CDK-activating kinase assembly factor MAT1. All proteins in this family for which functions are known are cyclin dependent protein kinases that are components of TFIIH, a complex that is involved in nucleotide excision repair and transcription initiation. Also known as MAT1 (menage a trois 1). This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=28.63  E-value=52  Score=25.86  Aligned_cols=28  Identities=21%  Similarity=0.203  Sum_probs=16.0

Q ss_pred             CeeecHHhHHhhhcccCCCeeeecCCeec
Q psy12215         96 NKILCEYDYEERQVFCVGDRFYLCDNKIL  124 (155)
Q Consensus        96 ~~~~C~~c~~~~~~~~~~~~c~~c~~~i~  124 (155)
                      |..+|..|....+... ...|..|...+.
T Consensus        27 GH~~C~sCv~~l~~~~-~~~CP~C~~~lr   54 (309)
T TIGR00570        27 GHTLCESCVDLLFVRG-SGSCPECDTPLR   54 (309)
T ss_pred             CCcccHHHHHHHhcCC-CCCCCCCCCccc
Confidence            6667777776654221 225666665543


No 109
>PLN03208 E3 ubiquitin-protein ligase RMA2; Provisional
Probab=28.15  E-value=56  Score=23.85  Aligned_cols=48  Identities=13%  Similarity=0.212  Sum_probs=28.5

Q ss_pred             ccccccCCcccccCCeEEeeCCeeecHHhHHhhhc--------------ccCCCeeeecCCeec
Q psy12215         75 CFACQQCNHRFCVGDRFYLCDNKILCEYDYEERQV--------------FCVGDRFYLCDNKIL  124 (155)
Q Consensus        75 Cf~C~~C~~~l~~~~~~~~~~~~~~C~~c~~~~~~--------------~~~~~~c~~c~~~i~  124 (155)
                      -|.|.+|...+  .......=|..||..|..+...              ......|..|...|.
T Consensus        18 ~~~CpICld~~--~dPVvT~CGH~FC~~CI~~wl~~s~~s~~~~~~~~~~k~~~~CPvCR~~Is   79 (193)
T PLN03208         18 DFDCNICLDQV--RDPVVTLCGHLFCWPCIHKWTYASNNSRQRVDQYDHKREPPKCPVCKSDVS   79 (193)
T ss_pred             ccCCccCCCcC--CCcEEcCCCchhHHHHHHHHHHhccccccccccccccCCCCcCCCCCCcCC
Confidence            36677777665  3334444577888888754321              112357888877775


No 110
>PF14445 Prok-RING_2:  Prokaryotic RING finger family 2
Probab=27.97  E-value=4.5  Score=22.75  Aligned_cols=44  Identities=16%  Similarity=0.347  Sum_probs=24.1

Q ss_pred             cccccCCcccccCCCeEEEeCCeeecccchhcccccccccccccccc
Q psy12215         11 LKCGCCDCRLGEVGSTLYQKANLILCKRDYLRLFGTTGYCAACTKVI   57 (155)
Q Consensus        11 f~C~~C~~~l~~~~~~~~~~~~~~~C~~c~~~~~~~~~~C~~C~~~I   57 (155)
                      |+|..|+...+-.+..=-+.=|+--|..|+...+-.   |..|+..|
T Consensus         8 y~CDLCn~~~p~~~LRQCvlCGRWaC~sCW~deYY~---CksC~Gii   51 (57)
T PF14445_consen    8 YSCDLCNSSHPISELRQCVLCGRWACNSCWQDEYYT---CKSCNGII   51 (57)
T ss_pred             HhHHhhcccCcHHHHHHHhhhchhhhhhhhhhhHhH---HHhhhchh
Confidence            567777664432221111233445567777766653   77777666


No 111
>cd02341 ZZ_ZZZ3 Zinc finger, ZZ type. Zinc finger present in ZZZ3 (ZZ finger containing 3) and related proteins. The ZZ motif coordinates two zinc ions and most likely participates in ligand binding or molecular scaffolding.
Probab=27.95  E-value=64  Score=17.80  Aligned_cols=10  Identities=20%  Similarity=0.079  Sum_probs=6.5

Q ss_pred             eeecHHhHHh
Q psy12215         97 KILCEYDYEE  106 (155)
Q Consensus        97 ~~~C~~c~~~  106 (155)
                      --+|..||..
T Consensus        26 ~DlC~~C~~~   35 (48)
T cd02341          26 FDLCQDCVVK   35 (48)
T ss_pred             CccCHHHHhC
Confidence            3467777764


No 112
>KOG3002|consensus
Probab=27.49  E-value=40  Score=26.33  Aligned_cols=43  Identities=19%  Similarity=0.364  Sum_probs=33.4

Q ss_pred             cccccCCcccccCCCeEEEeCCeeecccchhccccccccccccccccc
Q psy12215         11 LKCGCCDCRLGEVGSTLYQKANLILCKRDYLRLFGTTGYCAACTKVIP   58 (155)
Q Consensus        11 f~C~~C~~~l~~~~~~~~~~~~~~~C~~c~~~~~~~~~~C~~C~~~I~   58 (155)
                      +.|-.|.-.|.  ...|.=.+|.+.|..|-.++..   +|+.|..+|.
T Consensus        49 leCPvC~~~l~--~Pi~QC~nGHlaCssC~~~~~~---~CP~Cr~~~g   91 (299)
T KOG3002|consen   49 LDCPVCFNPLS--PPIFQCDNGHLACSSCRTKVSN---KCPTCRLPIG   91 (299)
T ss_pred             ccCchhhccCc--ccceecCCCcEehhhhhhhhcc---cCCccccccc
Confidence            56777777774  3457778899999999976655   6999999886


No 113
>PRK11595 DNA utilization protein GntX; Provisional
Probab=27.43  E-value=37  Score=25.14  Aligned_cols=38  Identities=18%  Similarity=0.273  Sum_probs=23.2

Q ss_pred             cccCCcccccCCCeEEEeCCeeecccchhccccccccccccccccc
Q psy12215         13 CGCCDCRLGEVGSTLYQKANLILCKRDYLRLFGTTGYCAACTKVIP   58 (155)
Q Consensus        13 C~~C~~~l~~~~~~~~~~~~~~~C~~c~~~~~~~~~~C~~C~~~I~   58 (155)
                      |..|+.++...        ...+|..|..........|..|+.++.
T Consensus         8 C~~C~~~~~~~--------~~~lC~~C~~~l~~~~~~C~~Cg~~~~   45 (227)
T PRK11595          8 CWLCRMPLALS--------HWGICSVCSRALRTLKTCCPQCGLPAT   45 (227)
T ss_pred             CccCCCccCCC--------CCcccHHHHhhCCcccCcCccCCCcCC
Confidence            56667777321        124799887765322227999987653


No 114
>cd02338 ZZ_PCMF_like Zinc finger, ZZ type. Zinc finger present in potassium channel modulatory factor (PCMF) 1  and related proteins. The ZZ motif coordinates two zinc ions and most likely participates in ligand binding or molecular scaffolding. Human potassium channel modulatory factor 1 or FIGC has been shown to possess intrinsic E3 ubiquitin ligase activity and to promote ubiquitination.
Probab=27.19  E-value=56  Score=17.95  Aligned_cols=11  Identities=27%  Similarity=0.404  Sum_probs=7.2

Q ss_pred             eeecHHhHHhh
Q psy12215         97 KILCEYDYEER  107 (155)
Q Consensus        97 ~~~C~~c~~~~  107 (155)
                      --+|..||...
T Consensus        24 ~dlC~~Cf~~~   34 (49)
T cd02338          24 YDLCADCYDSG   34 (49)
T ss_pred             CccchhHHhCC
Confidence            34788887754


No 115
>PF13717 zinc_ribbon_4:  zinc-ribbon domain
Probab=26.97  E-value=21  Score=18.35  Aligned_cols=7  Identities=43%  Similarity=1.450  Sum_probs=3.1

Q ss_pred             ccccCCc
Q psy12215         77 ACQQCNH   83 (155)
Q Consensus        77 ~C~~C~~   83 (155)
                      +|..|+.
T Consensus        27 ~C~~C~~   33 (36)
T PF13717_consen   27 RCSKCGH   33 (36)
T ss_pred             ECCCCCC
Confidence            4444443


No 116
>TIGR02098 MJ0042_CXXC MJ0042 family finger-like domain. This domain contains a CXXCX(19)CXXC motif suggestive of both zinc fingers and thioredoxin, usually found at the N-terminus of prokaryotic proteins. One partially characterized gene, agmX, is among a large set in Myxococcus whose interruption affects adventurous gliding motility.
Probab=26.71  E-value=20  Score=18.31  Aligned_cols=9  Identities=33%  Similarity=0.829  Sum_probs=5.6

Q ss_pred             ccccccccc
Q psy12215         49 YCAACTKVI   57 (155)
Q Consensus        49 ~C~~C~~~I   57 (155)
                      +|+.|+..+
T Consensus        27 ~C~~C~~~~   35 (38)
T TIGR02098        27 RCGKCGHVW   35 (38)
T ss_pred             ECCCCCCEE
Confidence            566666655


No 117
>PF09723 Zn-ribbon_8:  Zinc ribbon domain;  InterPro: IPR013429  This entry represents a region of about 41 amino acids found in a number of small proteins in a wide range of bacteria. The region usually begins with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One protein in this entry has been noted as a putative regulatory protein, designated FmdB []. Most proteins in this entry have a C-terminal region containing highly degenerate sequence.
Probab=26.65  E-value=24  Score=18.76  Aligned_cols=11  Identities=18%  Similarity=0.676  Sum_probs=7.9

Q ss_pred             cccccCCcccc
Q psy12215         11 LKCGCCDCRLG   21 (155)
Q Consensus        11 f~C~~C~~~l~   21 (155)
                      |+|..|+..+.
T Consensus         6 y~C~~Cg~~fe   16 (42)
T PF09723_consen    6 YRCEECGHEFE   16 (42)
T ss_pred             EEeCCCCCEEE
Confidence            67888877663


No 118
>PF13894 zf-C2H2_4:  C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A ....
Probab=26.44  E-value=30  Score=14.88  Aligned_cols=10  Identities=20%  Similarity=0.763  Sum_probs=4.9

Q ss_pred             cccccCCccc
Q psy12215         11 LKCGCCDCRL   20 (155)
Q Consensus        11 f~C~~C~~~l   20 (155)
                      |.|..|+..+
T Consensus         1 ~~C~~C~~~~   10 (24)
T PF13894_consen    1 FQCPICGKSF   10 (24)
T ss_dssp             EE-SSTS-EE
T ss_pred             CCCcCCCCcC
Confidence            4566666655


No 119
>smart00834 CxxC_CXXC_SSSS Putative regulatory protein. CxxC_CXXC_SSSS represents a region of about 41 amino acids found in a number of small proteins in a wide range of bacteria. The region usually begins with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One protein in this entry has been noted as a putative regulatory protein, designated FmdB. Most proteins in this entry have a C-terminal region containing highly degenerate sequence.
Probab=25.66  E-value=26  Score=18.03  Aligned_cols=10  Identities=20%  Similarity=0.743  Sum_probs=7.3

Q ss_pred             cccccCCccc
Q psy12215         11 LKCGCCDCRL   20 (155)
Q Consensus        11 f~C~~C~~~l   20 (155)
                      |+|..|+..+
T Consensus         6 y~C~~Cg~~f   15 (41)
T smart00834        6 YRCEDCGHTF   15 (41)
T ss_pred             EEcCCCCCEE
Confidence            5777887766


No 120
>TIGR00270 conserved hypothetical protein TIGR00270.
Probab=25.57  E-value=68  Score=22.41  Aligned_cols=28  Identities=14%  Similarity=0.274  Sum_probs=19.0

Q ss_pred             ccccCCcccccCCCeEEEeCCee--ecccch
Q psy12215         12 KCGCCDCRLGEVGSTLYQKANLI--LCKRDY   40 (155)
Q Consensus        12 ~C~~C~~~l~~~~~~~~~~~~~~--~C~~c~   40 (155)
                      .|..||+++...+ .-+..+|..  .|.+|+
T Consensus         2 ~CEiCG~~i~~~~-~~v~iega~l~vC~~C~   31 (154)
T TIGR00270         2 NCEICGRKIKGKG-FKIVIEGSEMTVCGECR   31 (154)
T ss_pred             ccccCCCccCCCC-eEEEEcCeEEehhhhHH
Confidence            3899999995322 344667764  488888


No 121
>KOG2893|consensus
Probab=24.89  E-value=29  Score=26.28  Aligned_cols=48  Identities=19%  Similarity=0.452  Sum_probs=29.2

Q ss_pred             cccccccccccCceEEeccCccccccccccccCCcccccCCeEEeeCCeeecHHhHH
Q psy12215         49 YCAACTKVIPAFEMVMRAKNNVYHLECFACQQCNHRFCVGDRFYLCDNKILCEYDYE  105 (155)
Q Consensus        49 ~C~~C~~~I~~~~~~~~~~~~~~H~~Cf~C~~C~~~l~~~~~~~~~~~~~~C~~c~~  105 (155)
                      .|.-|++.+.+ |.++....   -..+|+|.+|.+.|     |..-+-.+.|..-..
T Consensus        12 wcwycnrefdd-ekiliqhq---kakhfkchichkkl-----~sgpglsihcmqvhk   59 (341)
T KOG2893|consen   12 WCWYCNREFDD-EKILIQHQ---KAKHFKCHICHKKL-----FSGPGLSIHCMQVHK   59 (341)
T ss_pred             eeeecccccch-hhhhhhhh---hhccceeeeehhhh-----ccCCCceeehhhhhh
Confidence            58888887754 44332212   24569999999988     333344567755443


No 122
>PF02591 DUF164:  Putative zinc ribbon domain;  InterPro: IPR003743 This entry describes proteins of unknown function.
Probab=23.48  E-value=14  Score=20.87  Aligned_cols=11  Identities=27%  Similarity=0.902  Sum_probs=7.3

Q ss_pred             ccccccccccc
Q psy12215         49 YCAACTKVIPA   59 (155)
Q Consensus        49 ~C~~C~~~I~~   59 (155)
                      +|.+|...|.+
T Consensus        24 ~C~gC~~~l~~   34 (56)
T PF02591_consen   24 TCSGCHMELPP   34 (56)
T ss_pred             ccCCCCEEcCH
Confidence            57777776665


No 123
>PF05920 Homeobox_KN:  Homeobox KN domain;  InterPro: IPR008422 This entry represents a homeobox transcription factor KN domain conserved from fungi to human and plants [].; GO: 0003677 DNA binding, 0006355 regulation of transcription, DNA-dependent, 0005634 nucleus; PDB: 3K2A_B 2LK2_A 1X2N_A 2DMN_A.
Probab=23.37  E-value=63  Score=16.98  Aligned_cols=17  Identities=12%  Similarity=0.090  Sum_probs=11.3

Q ss_pred             hcCCCCchHHHhhhhhc
Q psy12215        138 IAYNPSSLAHLRRQVTL  154 (155)
Q Consensus       138 ~~~hp~~~~~~~~~~~~  154 (155)
                      ...||.|+...++.|+-
T Consensus         5 h~~nPYPs~~ek~~L~~   21 (40)
T PF05920_consen    5 HLHNPYPSKEEKEELAK   21 (40)
T ss_dssp             TTTSGS--HHHHHHHHH
T ss_pred             HCCCCCCCHHHHHHHHH
Confidence            45679999988888863


No 124
>TIGR02605 CxxC_CxxC_SSSS putative regulatory protein, FmdB family. This model represents a region of about 50 amino acids found in a number of small proteins in a wide range of bacteria. The region begins usually with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One member of this family is has been noted as a putative regulatory protein, designated FmdB (PubMed:8841393). Most members of this family have a C-terminal region containing highly degenerate sequence, such as SSTSESTKSSGSSGSSGSSESKASGSTEKSTSSTTAAAAV in Mycobacterium tuberculosis and VAVGGSAPAPSPAPRAGGGGGGCCGGGCCG in Streptomyces avermitilis. These low complexity regions, which are not included in the model, resemble low-complexity C-terminal regions of some heterocycle-containing bacteriocin precursors.
Probab=23.33  E-value=32  Score=18.88  Aligned_cols=10  Identities=30%  Similarity=1.019  Sum_probs=7.4

Q ss_pred             cccccCCccc
Q psy12215         11 LKCGCCDCRL   20 (155)
Q Consensus        11 f~C~~C~~~l   20 (155)
                      |+|..|+..+
T Consensus         6 y~C~~Cg~~f   15 (52)
T TIGR02605         6 YRCTACGHRF   15 (52)
T ss_pred             EEeCCCCCEe
Confidence            5788887766


No 125
>PF00320 GATA:  GATA zinc finger;  InterPro: IPR000679 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents GATA-type zinc fingers (Znf). A number of transcription factors (including erythroid-specific transcription factor and nitrogen regulatory proteins), specifically bind the DNA sequence (A/T)GATA(A/G) [] in the regulatory regions of genes. They are consequently termed GATA-binding transcription factors. The interactions occur via highly-conserved Znf domains in which the zinc ion is coordinated by 4 cysteine residues [, ]. NMR studies have shown the core of the Znf to comprise 2 irregular anti-parallel beta-sheets and an alpha-helix, followed by a long loop to the C-terminal end of the finger. The N-terminal part, which includes the helix, is similar in structure, but not sequence, to the N-terminal zinc module of the glucocorticoid receptor DNA-binding domain. The helix and the loop connecting the 2 beta-sheets interact with the major groove of the DNA, while the C-terminal tail wraps around into the minor groove. It is this tail that is the essential determinant of specific binding. Interactions between the Znf and DNA are mainly hydrophobic, explaining the preponderance of thymines in the binding site; a large number of interactions with the phosphate backbone have also been observed []. Two GATA zinc fingers are found in the GATA transcription factors. However there are several proteins which only contains a single copy of the domain. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003700 sequence-specific DNA binding transcription factor activity, 0008270 zinc ion binding, 0043565 sequence-specific DNA binding, 0006355 regulation of transcription, DNA-dependent; PDB: 3GAT_A 2GAT_A 1GAU_A 1GAT_A 1Y0J_A 1GNF_A 2L6Z_A 2L6Y_A 3DFV_D 3DFX_B ....
Probab=22.65  E-value=79  Score=16.08  Aligned_cols=28  Identities=18%  Similarity=0.158  Sum_probs=14.6

Q ss_pred             cccCCcccccCCCeEEEeCCee-ecccchhc
Q psy12215         13 CGCCDCRLGEVGSTLYQKANLI-LCKRDYLR   42 (155)
Q Consensus        13 C~~C~~~l~~~~~~~~~~~~~~-~C~~c~~~   42 (155)
                      |+.|+..-  ....-...+|.. +|..|...
T Consensus         1 C~~C~tt~--t~~WR~~~~g~~~LCn~Cg~~   29 (36)
T PF00320_consen    1 CSNCGTTE--TPQWRRGPNGNRTLCNACGLY   29 (36)
T ss_dssp             -TTT--ST---SSEEEETTSEE-EEHHHHHH
T ss_pred             CcCCcCCC--CchhhcCCCCCCHHHHHHHHH
Confidence            45555544  333444556776 88888754


No 126
>PRK00085 recO DNA repair protein RecO; Reviewed
Probab=22.52  E-value=51  Score=24.41  Aligned_cols=31  Identities=16%  Similarity=0.188  Sum_probs=22.8

Q ss_pred             ccCcccccCCcccccCCCeEEEeCCeeecccch
Q psy12215          8 EDCLKCGCCDCRLGEVGSTLYQKANLILCKRDY   40 (155)
Q Consensus         8 ~~Cf~C~~C~~~l~~~~~~~~~~~~~~~C~~c~   40 (155)
                      +.=..|..|+++++  ...|...+|-++|..|.
T Consensus       147 p~l~~C~~Cg~~~~--~~~f~~~~gg~~c~~c~  177 (247)
T PRK00085        147 LDLDHCAVCGAPGD--HRYFSPKEGGAVCSECG  177 (247)
T ss_pred             cchhhHhcCCCCCC--ceEEecccCCccccccc
Confidence            34457899999984  34566788888888875


No 127
>COG4416 Com Mu-like prophage protein Com [General function prediction only]
Probab=21.30  E-value=27  Score=19.90  Aligned_cols=14  Identities=29%  Similarity=0.733  Sum_probs=10.7

Q ss_pred             cccccCCcccccCC
Q psy12215         11 LKCGCCDCRLGEVG   24 (155)
Q Consensus        11 f~C~~C~~~l~~~~   24 (155)
                      .+|..|++.|.+.+
T Consensus         5 iRC~~CnKlLa~a~   18 (60)
T COG4416           5 IRCAKCNKLLAEAE   18 (60)
T ss_pred             eehHHHhHHHHhcc
Confidence            57889999996543


No 128
>COG0266 Nei Formamidopyrimidine-DNA glycosylase [DNA replication, recombination, and repair]
Probab=21.10  E-value=60  Score=25.06  Aligned_cols=25  Identities=20%  Similarity=0.535  Sum_probs=16.4

Q ss_pred             cccccccccccCceEEeccCccccccc
Q psy12215         49 YCAACTKVIPAFEMVMRAKNNVYHLEC   75 (155)
Q Consensus        49 ~C~~C~~~I~~~~~~~~~~~~~~H~~C   75 (155)
                      .|..|+.+|.-  ..+.-++..|-|.|
T Consensus       247 pC~~CGt~I~k--~~~~gR~t~~CP~C  271 (273)
T COG0266         247 PCRRCGTPIEK--IKLGGRSTFYCPVC  271 (273)
T ss_pred             CCCccCCEeEE--EEEcCCcCEeCCCC
Confidence            59999999953  44555556565544


No 129
>KOG4443|consensus
Probab=21.00  E-value=43  Score=29.03  Aligned_cols=19  Identities=21%  Similarity=0.606  Sum_probs=15.3

Q ss_pred             cCccccccccccccCCccc
Q psy12215         67 KNNVYHLECFACQQCNHRF   85 (155)
Q Consensus        67 ~~~~~H~~Cf~C~~C~~~l   85 (155)
                      .+..+-++|++|..|+..+
T Consensus       107 sg~~~ckk~~~c~qc~~~l  125 (694)
T KOG4443|consen  107 SGPWLCKKCTRCRQCDSTL  125 (694)
T ss_pred             CcccccHHHHhhhhccccc
Confidence            3566678899999999888


No 130
>PF10080 DUF2318:  Predicted membrane protein (DUF2318);  InterPro: IPR018758 This domain of unknown function is found in hypothetical bacterial membrane proteins with no known function. 
Probab=20.99  E-value=88  Score=20.30  Aligned_cols=17  Identities=29%  Similarity=0.600  Sum_probs=11.7

Q ss_pred             eEEEeCCeeecccchhc
Q psy12215         26 TLYQKANLILCKRDYLR   42 (155)
Q Consensus        26 ~~~~~~~~~~C~~c~~~   42 (155)
                      -|+..++.+.|..|-.+
T Consensus        45 GY~q~g~~lvC~~C~~~   61 (102)
T PF10080_consen   45 GYYQEGDQLVCKNCGVR   61 (102)
T ss_pred             ceEEECCEEEEecCCCE
Confidence            47788888876666544


No 131
>PF13912 zf-C2H2_6:  C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B.
Probab=20.96  E-value=42  Score=15.38  Aligned_cols=10  Identities=20%  Similarity=0.747  Sum_probs=6.3

Q ss_pred             cccccCCccc
Q psy12215         11 LKCGCCDCRL   20 (155)
Q Consensus        11 f~C~~C~~~l   20 (155)
                      |+|..|++.+
T Consensus         2 ~~C~~C~~~F   11 (27)
T PF13912_consen    2 FECDECGKTF   11 (27)
T ss_dssp             EEETTTTEEE
T ss_pred             CCCCccCCcc
Confidence            4566666655


No 132
>PF02428 Prot_inhib_II:  Potato type II proteinase inhibitor family;  InterPro: IPR003465 Peptide proteinase inhibitors can be found as single domain proteins or as single or multiple domains within proteins; these are referred to as either simple or compound inhibitors, respectively. In many cases they are synthesised as part of a larger precursor protein, either as a prepropeptide or as an N-terminal domain associated with an inactive peptidase or zymogen. This domain prevents access of the substrate to the active site. Removal of the N-terminal inhibitor domain either by interaction with a second peptidase or by autocatalytic cleavage activates the zymogen. Other inhibitors interact direct with proteinases using a simple noncovalent lock and key mechanism; while yet others use a conformational change-based trapping mechanism that depends on their structural and thermodynamic properties.  Members of the Pin2 family are proteinase inhibitors that belong to MEROPS inhibitor family I20, clan IA and are restricted to plants. They inhibit serine peptidases belonging to MEROPS peptidase family S1 [] (IPR001254 from INTERPRO). They have a multidomain structure [], which permits circular permutation of the sequences. It was been shown that some naturally occurring Pin2 proteins, have an `ancestral' circularly permuted structure []. Circular permutation/ rearrangements of sequences has also been observed between species, such as favin from Vicia faba and the lectin concanavalin A from Canavalia ensiformis [] or amongst members of the plant aspartyl proteinases and human lung surfactant proteins [].  The Pin2 family of proteinase inhibitors are present in seeds, leaves and other organs. Perhaps the best known representatives are the wound-induced proteinase inhibitors [, ], which contain up to eight sequence-repeats (the `IP repeats'). The sequence of the IP repeats is quite variable, only the cysteines constituting the four disulphide bridges and a single proline residue are conserved throughout all the known repeat sequences. The structure of the proteinase inhibitor complex is known [].; GO: 0004867 serine-type endopeptidase inhibitor activity; PDB: 1PJU_C 1OYV_I 1QH2_B 1FYB_A 1CE3_A 2JZM_A 1YTP_A 2JYY_A 1TIH_A 4SGB_I ....
Probab=20.90  E-value=1.2e+02  Score=17.15  Aligned_cols=15  Identities=20%  Similarity=0.631  Sum_probs=12.2

Q ss_pred             CCCeEEEeCCeeecc
Q psy12215         23 VGSTLYQKANLILCK   37 (155)
Q Consensus        23 ~~~~~~~~~~~~~C~   37 (155)
                      .+-.||..||...|+
T Consensus        37 KGC~yy~~dGtfiCe   51 (52)
T PF02428_consen   37 KGCNYYSADGTFICE   51 (52)
T ss_dssp             TTSEEEETTTEEEEE
T ss_pred             cccEEECCCCcEEeC
Confidence            567889999988886


No 133
>cd02345 ZZ_dah Zinc finger, ZZ type. Zinc finger present in Drosophila dah and related proteins. The ZZ motif coordinates two zinc ions and most likely participates in ligand binding or molecular scaffolding. Dah (discontinuous actin hexagon) is a membrane associated protein essential for cortical furrow formation in Drosophila.
Probab=20.67  E-value=75  Score=17.47  Aligned_cols=10  Identities=30%  Similarity=0.388  Sum_probs=6.5

Q ss_pred             eecHHhHHhh
Q psy12215         98 ILCEYDYEER  107 (155)
Q Consensus        98 ~~C~~c~~~~  107 (155)
                      -+|..||...
T Consensus        25 dLC~~Cf~~~   34 (49)
T cd02345          25 SLCLGCYTKG   34 (49)
T ss_pred             CchHHHHhCC
Confidence            4677777643


No 134
>PF01246 Ribosomal_L24e:  Ribosomal protein L24e;  InterPro: IPR000988 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms. The codons of the mRNA are exposed on the ribosome to allow tRNA binding. This leads to the incorporation of amino acids into the growing polypeptide chain in accordance with the genetic information. Incoming amino acid monomers enter the ribosomal A site in the form of aminoacyl-tRNAs complexed with elongation factor Tu (EF-Tu) and GTP. The growing polypeptide chain, situated in the P site as peptidyl-tRNA, is then transferred to aminoacyl-tRNA and the new peptidyl-tRNA, extended by one residue, is translocated to the P site with the aid the elongation factor G (EF-G) and GTP as the deacylated tRNA is released from the ribosome through one or more exit sites [, ]. About 2/3 of the mass of the ribosome consists of RNA and 1/3 of protein. The proteins are named in accordance with the subunit of the ribosome which they belong to - the small (S1 to S31) and the large (L1 to L44). Usually they decorate the rRNA cores of the subunits.  Many ribosomal proteins, particularly those of the large subunit, are composed of a globular, surfaced-exposed domain with long finger-like projections that extend into the rRNA core to stabilise its structure. Most of the proteins interact with multiple RNA elements, often from different domains. In the large subunit, about 1/3 of the 23S rRNA nucleotides are at least in van der Waal's contact with protein, and L22 interacts with all six domains of the 23S rRNA. Proteins S4 and S7, which initiate assembly of the 16S rRNA, are located at junctions of five and four RNA helices, respectively. In this way proteins serve to organise and stabilise the rRNA tertiary structure. While the crucial activities of decoding and peptide transfer are RNA based, proteins play an active role in functions that may have evolved to streamline the process of protein synthesis. In addition to their function in the ribosome, many ribosomal proteins have some function 'outside' the ribosome [, ]. A number of eukaryotic and archaeabacterial ribosomal proteins can be grouped on the basis of sequence similarities. One of these families [] consists of mammalian ribosomal protein L24; yeast ribosomal protein L30A/B (Rp29) (YL21); Kluyveromyces lactis ribosomal protein L30; Arabidopsis thaliana ribosomal protein L24 homolog; Haloarcula marismortui ribosomal protein HL21/HL22; and Methanocaldococcus jannaschii (Methanococcus jannaschii) MJ1201. These proteins have 60 to 160 amino-acid residues. This entry represents proteins related to the L24e ribosomal proteins.; PDB: 2ZKR_u 1VQ9_U 1VQL_U 1KD1_V 1VQP_U 3CCM_U 3CD6_U 3CCL_U 3CCR_U 1Q86_V ....
Probab=20.64  E-value=68  Score=19.38  Aligned_cols=24  Identities=8%  Similarity=0.198  Sum_probs=11.4

Q ss_pred             ccccCCcccccCC-CeEEEeCCeee
Q psy12215         12 KCGCCDCRLGEVG-STLYQKANLIL   35 (155)
Q Consensus        12 ~C~~C~~~l~~~~-~~~~~~~~~~~   35 (155)
                      .|+-|+..+.++. ..|+..||+++
T Consensus         5 ~C~Fsg~~I~PG~G~~~Vr~DG~v~   29 (71)
T PF01246_consen    5 KCSFSGYKIYPGHGKMYVRNDGKVF   29 (71)
T ss_dssp             E-TTT-SEE-SSSSEEEE-TTS-EE
T ss_pred             EecccCCccCCCCCeEEEecCCCeE
Confidence            5777888776533 34445677654


No 135
>PF10170 C6_DPF:  Cysteine-rich domain;  InterPro: IPR018785  This entry represents the N-terminal approximately 100 amino acids of a family of proteins found in a range of organisms, including human, chicken and Drosophila [, , ]. It contains between six and eight highly conserved cysteine residues and a characteristic DPF sequence motif. One member is putatively named as receptor for egg jelly protein but this could not confirmed. 
Probab=20.36  E-value=81  Score=20.33  Aligned_cols=31  Identities=26%  Similarity=0.518  Sum_probs=23.5

Q ss_pred             ccccCCcccccCCeEEeeCCeeecHHhHHhh
Q psy12215         77 ACQQCNHRFCVGDRFYLCDNKILCEYDYEER  107 (155)
Q Consensus        77 ~C~~C~~~l~~~~~~~~~~~~~~C~~c~~~~  107 (155)
                      .|+.|++..-.+..+.+.-.+-+|..|..+.
T Consensus        51 ~CS~C~~~VC~~~~CSlFYtkrFC~pC~~~~   81 (97)
T PF10170_consen   51 PCSICGKPVCVGQDCSLFYTKRFCLPCVKRN   81 (97)
T ss_pred             cccccCCceEcCCCccEEeeCceeHHHHHHH
Confidence            5888888886666776667778898887654


No 136
>KOG3476|consensus
Probab=20.09  E-value=24  Score=22.22  Aligned_cols=26  Identities=27%  Similarity=0.492  Sum_probs=19.3

Q ss_pred             eCCeeecccchhcccccccccccccccccc
Q psy12215         30 KANLILCKRDYLRLFGTTGYCAACTKVIPA   59 (155)
Q Consensus        30 ~~~~~~C~~c~~~~~~~~~~C~~C~~~I~~   59 (155)
                      ..|.-||..|..++    +.|+-|++.|..
T Consensus        66 Q~GshYC~tCAY~K----giCAMCGKki~n   91 (100)
T KOG3476|consen   66 QPGSHYCQTCAYKK----GICAMCGKKILN   91 (100)
T ss_pred             CCcchhHhHhhhhh----hHHHHhhhHhhc
Confidence            34567898887764    369999998865


No 137
>PF07649 C1_3:  C1-like domain;  InterPro: IPR011424 This short domain is rich in cysteines and histidines. The pattern of conservation is similar to that found in IPR002219 from INTERPRO. C1 domains are protein kinase C-like zinc finger structures. Diacylglycerol (DAG) kinases (DGKs) have a two or three commonly conserved cysteine-rich C1 domains []. DGKs modulate the balance between the two signaling lipids, DAG and phosphatidic acid (PA), by phosphorylating DAG to yield PA []. The PKD (protein kinase D) family are novel DAG receptors. They have twin C1 domains, designated C1a and C1b, which bind DAG or phorbol esters. Individual C1 domains differ in ligand-binding activity and selectivity []. ; GO: 0047134 protein-disulfide reductase activity, 0055114 oxidation-reduction process; PDB: 1V5N_A.
Probab=20.05  E-value=70  Score=15.38  Aligned_cols=11  Identities=18%  Similarity=0.836  Sum_probs=3.2

Q ss_pred             cccccCCcccc
Q psy12215         11 LKCGCCDCRLG   21 (155)
Q Consensus        11 f~C~~C~~~l~   21 (155)
                      |+|..|++++.
T Consensus         1 ~~C~~C~~~~~   11 (30)
T PF07649_consen    1 FRCDACGKPID   11 (30)
T ss_dssp             ---TTTS----
T ss_pred             CcCCcCCCcCC
Confidence            56788887773


Done!