Query         psy1222
Match_columns 60
No_of_seqs    135 out of 1002
Neff          7.2 
Searched_HMMs 46136
Date          Fri Aug 16 21:51:15 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy1222.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/1222hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 cd01717 Sm_B The eukaryotic Sm  99.9 6.2E-23 1.4E-27  112.9   3.4   59    1-60     17-75  (79)
  2 cd06168 LSm9 The eukaryotic Sm  99.9 1.5E-22 3.3E-27  110.9   3.7   55    1-60     17-71  (75)
  3 cd01730 LSm3 The eukaryotic Sm  99.9 1.6E-22 3.4E-27  112.0   3.0   60    1-60     18-79  (82)
  4 cd01729 LSm7 The eukaryotic Sm  99.8 7.2E-22 1.6E-26  109.4   3.4   57    1-60     19-75  (81)
  5 cd01720 Sm_D2 The eukaryotic S  99.8 1.1E-21 2.4E-26  110.1   3.2   60    1-60     21-82  (87)
  6 cd01732 LSm5 The eukaryotic Sm  99.8 7.8E-21 1.7E-25  104.3   2.7   52    1-60     20-71  (76)
  7 cd01728 LSm1 The eukaryotic Sm  99.8   1E-20 2.3E-25  103.3   3.2   52    1-60     19-70  (74)
  8 cd01727 LSm8 The eukaryotic Sm  99.8 2.8E-20 6.1E-25  101.3   3.0   53    1-60     16-68  (74)
  9 cd01719 Sm_G The eukaryotic Sm  99.8   7E-20 1.5E-24   99.5   3.4   49    1-60     17-65  (72)
 10 PRK00737 small nuclear ribonuc  99.8 7.9E-20 1.7E-24   99.1   2.8   48    1-59     21-68  (72)
 11 cd01731 archaeal_Sm1 The archa  99.8 8.9E-20 1.9E-24   97.8   2.9   48    1-59     17-64  (68)
 12 cd01718 Sm_E The eukaryotic Sm  99.8 1.1E-19 2.4E-24  100.4   3.3   48    2-59     28-75  (79)
 13 PTZ00138 small nuclear ribonuc  99.7 7.8E-19 1.7E-23   98.9   3.2   48    3-60     37-84  (89)
 14 cd01726 LSm6 The eukaryotic Sm  99.7 2.9E-18 6.2E-23   91.8   3.2   48    1-59     17-64  (67)
 15 cd01722 Sm_F The eukaryotic Sm  99.7 2.4E-18 5.3E-23   92.3   2.9   48    1-59     18-65  (68)
 16 smart00651 Sm snRNP Sm protein  99.7 2.5E-18 5.4E-23   91.1   2.7   49    1-59     15-63  (67)
 17 KOG3168|consensus               99.7 3.1E-19 6.6E-24  109.4  -1.9   59    1-60     21-79  (177)
 18 PF01423 LSM:  LSM domain ;  In  99.7 8.9E-18 1.9E-22   89.1   2.3   49    1-59     15-63  (67)
 19 cd00600 Sm_like The eukaryotic  99.7 3.8E-17 8.3E-22   85.5   3.2   48    1-59     13-60  (63)
 20 KOG1780|consensus               99.7 1.9E-17   4E-22   90.1   1.6   48    1-59     21-68  (77)
 21 COG1958 LSM1 Small nuclear rib  99.7 5.5E-17 1.2E-21   89.1   3.5   52    1-59     24-75  (79)
 22 KOG1781|consensus               99.6 1.3E-17 2.8E-22   94.9  -2.2   57    1-60     34-90  (108)
 23 cd01721 Sm_D3 The eukaryotic S  99.6 4.1E-15 8.9E-20   80.2   3.5   48    1-59     17-64  (70)
 24 cd01723 LSm4 The eukaryotic Sm  99.5 3.9E-15 8.6E-20   81.3   3.3   49    1-59     18-66  (76)
 25 KOG3460|consensus               99.5 3.1E-16 6.8E-21   87.0  -1.7   59    1-59     22-82  (91)
 26 cd01724 Sm_D1 The eukaryotic S  99.5 2.3E-14 4.9E-19   80.7   3.7   48    1-59     18-65  (90)
 27 cd01733 LSm10 The eukaryotic S  99.5 4.9E-14 1.1E-18   77.5   3.6   48    1-59     26-73  (78)
 28 KOG1782|consensus               99.5 1.5E-15 3.2E-20   89.3  -3.5   51    1-59     26-76  (129)
 29 KOG1784|consensus               99.4   2E-13 4.3E-18   76.9   3.1   51    2-59     18-68  (96)
 30 cd01725 LSm2 The eukaryotic Sm  99.4 2.5E-13 5.5E-18   75.1   3.5   50    1-59     18-67  (81)
 31 KOG1774|consensus               99.3 5.2E-13 1.1E-17   73.9   1.0   46    4-59     36-81  (88)
 32 KOG3482|consensus               99.2 4.7E-12   1E-16   68.9   2.4   48    1-59     25-72  (79)
 33 KOG1775|consensus               99.2 2.8E-12   6E-17   70.3  -0.1   51    1-59     24-74  (84)
 34 KOG3459|consensus               99.2 2.1E-12 4.6E-17   74.8  -1.6   59    1-59     43-103 (114)
 35 KOG1783|consensus               99.1 6.7E-12 1.4E-16   68.2  -1.6   48    1-59     23-70  (77)
 36 cd01739 LSm11_C The eukaryotic  98.7   1E-08 2.2E-13   54.8   1.8   26    6-31     24-49  (66)
 37 KOG3448|consensus               97.7 3.8E-05 8.1E-10   43.3   3.0   49    1-58     19-67  (96)
 38 KOG3293|consensus               97.7 1.7E-05 3.7E-10   47.1   1.6   48    1-58     19-66  (134)
 39 KOG3172|consensus               97.4 0.00026 5.7E-09   41.2   3.6   46    2-58     23-68  (119)
 40 KOG3428|consensus               97.4 0.00031 6.7E-09   40.8   3.5   46    1-58     19-64  (109)
 41 PF14438 SM-ATX:  Ataxin 2 SM d  96.7  0.0021 4.5E-08   34.6   2.7   56    1-60     19-77  (77)
 42 cd01716 Hfq Hfq, an abundant,   92.2    0.16 3.5E-06   26.8   2.3   21    1-21     18-38  (61)
 43 TIGR02383 Hfq RNA chaperone Hf  91.6     0.2 4.4E-06   26.4   2.2   21    1-21     22-42  (61)
 44 PRK00395 hfq RNA-binding prote  91.0    0.25 5.5E-06   27.3   2.3   24    1-24     26-49  (79)
 45 PF02237 BPL_C:  Biotin protein  89.9    0.75 1.6E-05   22.5   3.3   25    3-27     11-35  (48)
 46 PF14563 DUF4444:  Domain of un  89.1    0.67 1.4E-05   22.7   2.7   23    7-29     10-32  (42)
 47 COG1923 Hfq Uncharacterized ho  87.5    0.52 1.1E-05   25.9   1.9   22    1-23     26-47  (77)
 48 cd01736 LSm14_N LSm14 (also kn  80.7     6.6 0.00014   21.4   4.4   53    5-58     17-70  (74)
 49 KOG3382|consensus               80.1    0.99 2.2E-05   27.4   1.1   19    7-25     45-63  (151)
 50 KOG3168|consensus               79.2     5.9 0.00013   24.9   4.3   57    1-59     58-114 (177)
 51 cd01735 LSm12_N LSm12 belongs   78.8     4.2   9E-05   21.3   3.1   25    3-27     15-39  (61)
 52 PRK14091 RNA-binding protein H  78.2     2.2 4.8E-05   26.6   2.3   25    1-25    111-135 (165)
 53 PF03614 Flag1_repress:  Repres  77.5       3 6.5E-05   25.8   2.7   26    1-26     36-61  (165)
 54 PF05071 NDUFA12:  NADH ubiquin  77.4     1.1 2.3E-05   25.6   0.7   17    9-25      1-17  (105)
 55 PRK14091 RNA-binding protein H  74.7     3.1 6.7E-05   25.9   2.2   24    1-24     31-54  (165)
 56 PF03122 Herpes_MCP:  Herpes vi  68.5     1.6 3.5E-05   34.6   0.0   50    2-60    255-304 (1354)
 57 PF12701 LSM14:  Scd6-like Sm d  66.4      16 0.00034   20.7   3.8   54    3-58     17-71  (96)
 58 PRK06630 hypothetical protein;  58.4     5.9 0.00013   22.8   1.1   19    7-25     11-29  (99)
 59 TIGR02038 protease_degS peripl  53.4      19  0.0004   24.3   3.0   26    1-26    108-133 (351)
 60 PLN03095 NADH:ubiquinone oxido  53.4     8.4 0.00018   22.7   1.2   20    8-27      9-28  (115)
 61 PLN02732 Probable NADH dehydro  51.1      15 0.00032   22.8   2.1   19    9-27     49-67  (159)
 62 PF11095 Gemin7:  Gem-associate  50.8      20 0.00044   19.7   2.4   23    2-24     32-55  (80)
 63 PF01887 SAM_adeno_trans:  S-ad  49.3      24 0.00052   23.1   2.9   23    6-28    169-191 (258)
 64 PRK10898 serine endoprotease;   49.0      26 0.00056   23.7   3.2   26    1-26    108-133 (353)
 65 PRK10942 serine endoprotease;   45.7      29 0.00063   24.5   3.1   25    1-25    142-166 (473)
 66 PRK08183 NADH dehydrogenase; V  45.5      12 0.00027   22.4   1.1   19    8-26     25-43  (133)
 67 PF06372 Gemin6:  Gemin6 protei  43.2      32 0.00069   21.4   2.7   25    2-27     25-50  (166)
 68 PF07202 Tcp10_C:  T-complex pr  42.2      16 0.00034   22.9   1.2   19    5-23    159-177 (179)
 69 TIGR02603 CxxCH_TIGR02603 puta  42.2      39 0.00085   19.6   2.9   24    1-25     64-87  (133)
 70 PRK06955 biotin--protein ligas  40.8      40 0.00087   22.3   3.0   23    3-25    258-280 (300)
 71 PTZ00275 biotin-acetyl-CoA-car  40.4      44 0.00096   22.0   3.2   23    3-25    245-267 (285)
 72 PRK10139 serine endoprotease;   38.8      43 0.00092   23.6   3.0   26    1-26    121-146 (455)
 73 TIGR00121 birA_ligase birA, bi  38.7      48   0.001   20.9   3.1   21    3-23    201-221 (237)
 74 PF10894 DUF2689:  Protein of u  38.3     2.8 6.1E-05   21.9  -2.1   18   15-32     21-38  (61)
 75 COG0779 Uncharacterized protei  38.3      52  0.0011   20.1   3.0   21    2-23    111-131 (153)
 76 PTZ00276 biotin/lipoate protei  36.7      58  0.0013   20.9   3.2   23    3-25    210-232 (245)
 77 PRK11886 bifunctional biotin--  35.6      56  0.0012   21.5   3.1   21    3-23    280-300 (319)
 78 PF02707 MOSP_N:  Major Outer S  35.6      29 0.00062   22.4   1.6   16    6-21     31-46  (204)
 79 PRK14638 hypothetical protein;  35.4      39 0.00085   20.4   2.2   21    2-23    108-128 (150)
 80 TIGR02037 degP_htrA_DO peripla  35.3      55  0.0012   22.5   3.1   26    1-26     88-113 (428)
 81 PF05413 Peptidase_C34:  Putati  34.5      17 0.00037   20.3   0.5   15   44-58     74-88  (92)
 82 PF11607 DUF3247:  Protein of u  34.2      29 0.00063   19.9   1.4   11    1-11     35-45  (101)
 83 PF12869 tRNA_anti-like:  tRNA_  33.1      47   0.001   19.0   2.2   22    5-26    123-144 (144)
 84 PF10622 Ehbp:  Energy-converti  32.6      38 0.00083   18.6   1.6   39   17-55     20-58  (78)
 85 PRK14639 hypothetical protein;  31.6      50  0.0011   19.7   2.2   21    2-23     96-116 (140)
 86 PF05989 Chordopox_A35R:  Chord  31.5      36 0.00079   21.4   1.6   21    7-27     93-113 (176)
 87 PRK14633 hypothetical protein;  30.7      58  0.0012   19.6   2.4   21    2-23    106-126 (150)
 88 PRK02001 hypothetical protein;  30.1      54  0.0012   19.9   2.2   21    2-23     98-118 (152)
 89 PRK14640 hypothetical protein;  29.9      91   0.002   18.7   3.1   21    2-23    109-129 (152)
 90 PRK14645 hypothetical protein;  29.7      57  0.0012   19.8   2.2   20    3-23    110-129 (154)
 91 PRK08330 biotin--protein ligas  29.4      88  0.0019   19.7   3.2   23    3-25    196-219 (236)
 92 PRK14643 hypothetical protein;  26.9      97  0.0021   19.0   2.9   17    2-18    116-132 (164)
 93 PRK13325 bifunctional biotin--  26.8      94   0.002   22.8   3.2   22    3-24    287-308 (592)
 94 cd01734 YlxS_C YxlS is a Bacil  26.6   1E+02  0.0022   16.4   2.7   19    4-23     39-57  (83)
 95 COG1912 Uncharacterized conser  26.2      90   0.002   21.0   2.8   21    3-23    170-190 (268)
 96 PF01398 JAB:  JAB1/Mov34/MPN/P  25.0      87  0.0019   17.1   2.3   26    6-31     27-53  (114)
 97 PF02576 DUF150:  Uncharacteris  23.8 1.5E+02  0.0032   17.3   3.3   19    3-22    100-118 (141)
 98 cd01403 Cyt_c_Oxidase_VIIb Cyt  23.6      40 0.00086   17.1   0.6   14   15-28      7-20  (51)
 99 PRK08477 biotin--protein ligas  23.3 1.2E+02  0.0025   19.3   2.9   24    2-25    182-205 (211)
100 cd08057 MPN_euk_non_mb Mpr1p,   20.8 1.6E+02  0.0034   17.3   3.0   27    5-31     23-49  (157)
101 PRK14631 hypothetical protein;  20.7 1.1E+02  0.0023   19.0   2.3   21    2-23    129-151 (174)
102 smart00232 JAB_MPN JAB/MPN dom  20.4 1.5E+02  0.0032   16.3   2.7   25    5-29     22-46  (135)

No 1  
>cd01717 Sm_B The eukaryotic Sm and Sm-like (LSm) proteins associate with RNA to form core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation.  Members of this family share a highly conserved Sm fold containing an N-terminal helix followed by a strongly bent five-stranded antiparallel beta-sheet. Sm subunit B heterodimerizes with subunit D3 and three such heterodimers form a hexameric ring structure with alternating B and D3 subunits.  The D3 - B heterodimer also assembles into a heptameric ring containing D1, D2, E, F, and G subunits.  Sm-like proteins exist in archaea as well as prokaryotes which form heptameric and hexameric ring structures similar to those found in eukaryotes.
Probab=99.87  E-value=6.2e-23  Score=112.89  Aligned_cols=59  Identities=37%  Similarity=0.683  Sum_probs=47.6

Q ss_pred             CCCCceEEEEEEeecCCCceEecccccccCccccccccccchhhheeeeeeeecCCCCCC
Q psy1222           1 MTDGRVLVGTFLCTDRDANVILGSCGEYLSPEVFESKEENGAQEARLLGLVMVPGQHIPA   60 (60)
Q Consensus         1 l~dgR~~~G~l~~~D~~~NlvL~~~~E~~~~~~~~~~~~~~~~~~r~lG~v~irG~~Iv~   60 (60)
                      |+|||++.|+|+|||+||||||++|+|++...+..+. .....+.|.+|+++|||++|+|
T Consensus        17 l~dgR~~~G~L~~~D~~~NlVL~~~~E~~~~~~~~~~-~~~~~~~r~lG~v~iRG~~Vv~   75 (79)
T cd01717          17 LQDGRQFVGQFLAFDKHMNLVLSDCEEFRKVKKKKSK-NSEREEKRTLGLVLLRGENIVS   75 (79)
T ss_pred             ECCCcEEEEEEEEEcCccCEEcCCEEEEEeccccccc-cccCcceeEeeeEEEcCCEEEE
Confidence            5899999999999999999999999999875432210 0113467899999999999985


No 2  
>cd06168 LSm9 The eukaryotic Sm and Sm-like (LSm) proteins associate with RNA to form the core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation.  Members of this family share a highly conserved Sm fold containing an N-terminal helix followed by a strongly bent five-stranded antiparallel beta-sheet. LSm9 proteins have a single Sm-like domain structure.  Sm-like proteins exist in archaea as well as prokaryotes that form heptameric and hexameric ring structures similar to those found in eukaryotes.
Probab=99.86  E-value=1.5e-22  Score=110.86  Aligned_cols=55  Identities=62%  Similarity=1.017  Sum_probs=47.2

Q ss_pred             CCCCceEEEEEEeecCCCceEecccccccCccccccccccchhhheeeeeeeecCCCCCC
Q psy1222           1 MTDGRVLVGTFLCTDRDANVILGSCGEYLSPEVFESKEENGAQEARLLGLVMVPGQHIPA   60 (60)
Q Consensus         1 l~dgR~~~G~l~~~D~~~NlvL~~~~E~~~~~~~~~~~~~~~~~~r~lG~v~irG~~Iv~   60 (60)
                      |+|||.|+|+|.|||+||||||++|.|++....+.     ...+.|.+|+++|||++|++
T Consensus        17 l~dgR~~~G~l~~~D~~~NivL~~~~E~~~~~~~~-----~~~~~r~lGlv~IrG~~Iv~   71 (75)
T cd06168          17 MTDGRTLVGVFLCTDRDCNIILGSAQEYRPPPDSF-----SPTEPRVLGLVMIPGHHIVS   71 (75)
T ss_pred             EcCCeEEEEEEEEEcCCCcEEecCcEEEEcccCcc-----CCccEEEeeeEEEeCCeEEE
Confidence            58999999999999999999999999998764321     13468999999999999974


No 3  
>cd01730 LSm3 The eukaryotic Sm and Sm-like (LSm) proteins associate with RNA to form the core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation.  Members of this family share a highly conserved Sm fold containing an N-terminal helix followed by a strongly bent five-stranded antiparallel beta-sheet. LSm3 is one of at least seven subunits that assemble onto U6 snRNA to form a seven-membered ring structure.  Sm-like proteins exist in archaea as well as prokaryotes that form heptameric and hexameric ring structures similar to those found in eukaryotes.
Probab=99.86  E-value=1.6e-22  Score=112.04  Aligned_cols=60  Identities=23%  Similarity=0.336  Sum_probs=48.1

Q ss_pred             CCCCceEEEEEEeecCCCceEecccccccCcccccc--ccccchhhheeeeeeeecCCCCCC
Q psy1222           1 MTDGRVLVGTFLCTDRDANVILGSCGEYLSPEVFES--KEENGAQEARLLGLVMVPGQHIPA   60 (60)
Q Consensus         1 l~dgR~~~G~l~~~D~~~NlvL~~~~E~~~~~~~~~--~~~~~~~~~r~lG~v~irG~~Iv~   60 (60)
                      |+|||++.|+|+|||+||||||+||+|++....++.  +++......|.+|+++|||++|++
T Consensus        18 l~~gr~~~G~L~~fD~~mNlvL~d~~E~~~~~~~~~~~~~~~~~~~~r~lg~~~iRGd~Vv~   79 (82)
T cd01730          18 LRGDRELRGRLHAYDQHLNMILGDVEETITTVEIDEETYEEIVKTTKRNIPMLFVRGDSVIL   79 (82)
T ss_pred             ECCCCEEEEEEEEEccceEEeccceEEEeecccccccccccccceeEEEcCeEEEeCCEEEE
Confidence            589999999999999999999999999987643321  111123467899999999999974


No 4  
>cd01729 LSm7 The eukaryotic Sm and Sm-like (LSm) proteins associate with RNA to form the core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation.  Members of this family share a highly conserved Sm fold containing an N-terminal helix followed by a strongly bent five-stranded antiparallel beta-sheet. LSm7 is one of at least seven subunits that assemble onto U6 snRNA to form a seven-membered ring structure.  Sm-like proteins exist in archaea as well as prokaryotes that form heptameric and hexameric ring structures similar to those found in eukaryotes.
Probab=99.85  E-value=7.2e-22  Score=109.39  Aligned_cols=57  Identities=26%  Similarity=0.338  Sum_probs=46.2

Q ss_pred             CCCCceEEEEEEeecCCCceEecccccccCccccccccccchhhheeeeeeeecCCCCCC
Q psy1222           1 MTDGRVLVGTFLCTDRDANVILGSCGEYLSPEVFESKEENGAQEARLLGLVMVPGQHIPA   60 (60)
Q Consensus         1 l~dgR~~~G~l~~~D~~~NlvL~~~~E~~~~~~~~~~~~~~~~~~r~lG~v~irG~~Iv~   60 (60)
                      |+|||+++|+|+|||+||||||++|+|+........   ......+.+|+++|||+||++
T Consensus        19 l~~gr~~~G~L~~~D~~mNlvL~~~~E~~~~~~~~~---~~~~~~~~lG~v~iRG~nV~~   75 (81)
T cd01729          19 FQGGREVTGILKGYDQLLNLVLDDTVEYLRDPDDPY---KLTDKTRQLGLVVCRGTSVVL   75 (81)
T ss_pred             ECCCcEEEEEEEEEcCcccEEecCEEEEEccCCccc---ccccceeEccEEEEcCCEEEE
Confidence            589999999999999999999999999986432110   112467889999999999974


No 5  
>cd01720 Sm_D2 The eukaryotic Sm and Sm-like (LSm) proteins associate with RNA to form core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation.  Members of this family share a highly conserved Sm fold containing an N-terminal helix followed by a strongly bent five-stranded antiparallel beta-sheet. Sm subunit D2 heterodimerizes with subunit D1 and three such heterodimers form a hexameric ring structure with alternating D1 and D2 subunits. The D1 - D2 heterodimer also assembles into a heptameric ring containing D2, D3, E, F, and G subunits. Sm-like proteins exist in archaea as well as prokaryotes which form heptameric and hexameric ring structures similar to those found in eukaryotes.
Probab=99.84  E-value=1.1e-21  Score=110.05  Aligned_cols=60  Identities=17%  Similarity=0.299  Sum_probs=47.8

Q ss_pred             CCCCceEEEEEEeecCCCceEecccccccCccccccc--cccchhhheeeeeeeecCCCCCC
Q psy1222           1 MTDGRVLVGTFLCTDRDANVILGSCGEYLSPEVFESK--EENGAQEARLLGLVMVPGQHIPA   60 (60)
Q Consensus         1 l~dgR~~~G~l~~~D~~~NlvL~~~~E~~~~~~~~~~--~~~~~~~~r~lG~v~irG~~Iv~   60 (60)
                      |++||.+.|+|+|||+||||||+||+|++...++++.  +.......|.+|+++||||+|++
T Consensus        21 lr~~r~~~G~L~~fD~hmNlvL~d~~E~~~~~~k~~~~~~~~~~~~~r~lg~v~iRGd~Vv~   82 (87)
T cd01720          21 CRNNKKLLGRVKAFDRHCNMVLENVKEMWTEVPKTGKGKKAKPVNKDRFISKMFLRGDSVIL   82 (87)
T ss_pred             EcCCCEEEEEEEEecCccEEEEcceEEEeeccccccccccccceeeeeEcccEEEeCCEEEE
Confidence            5899999999999999999999999999876543221  11113467889999999999974


No 6  
>cd01732 LSm5 The eukaryotic Sm and Sm-like (LSm) proteins associate with RNA to form the core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation.  Members of this family share a highly conserved Sm fold containing an N-terminal helix followed by a strongly bent five-stranded antiparallel beta-sheet. LSm4 is one of at least seven subunits that assemble onto U6 snRNA to form a seven-membered ring structure.  Sm-like proteins exist in archaea as well as prokaryotes that form heptameric and hexameric ring structures similar to those found in eukaryotes.
Probab=99.81  E-value=7.8e-21  Score=104.28  Aligned_cols=52  Identities=25%  Similarity=0.370  Sum_probs=44.1

Q ss_pred             CCCCceEEEEEEeecCCCceEecccccccCccccccccccchhhheeeeeeeecCCCCCC
Q psy1222           1 MTDGRVLVGTFLCTDRDANVILGSCGEYLSPEVFESKEENGAQEARLLGLVMVPGQHIPA   60 (60)
Q Consensus         1 l~dgR~~~G~l~~~D~~~NlvL~~~~E~~~~~~~~~~~~~~~~~~r~lG~v~irG~~Iv~   60 (60)
                      +++||++.|+|+|||+||||||+||+|++..+.        ....+.+|+++|||++|++
T Consensus        20 l~~gr~~~G~L~g~D~~mNlvL~da~E~~~~~~--------~~~~~~lg~v~iRG~nV~~   71 (76)
T cd01732          20 MKSDKEFVGTLLGFDDYVNMVLEDVTEYEITPE--------GRKITKLDQILLNGNNICM   71 (76)
T ss_pred             ECCCeEEEEEEEEeccceEEEEccEEEEEEcCC--------CceeeEcCeEEEeCCeEEE
Confidence            579999999999999999999999999984321        1246789999999999863


No 7  
>cd01728 LSm1 The eukaryotic Sm and Sm-like (LSm) proteins associate with RNA to form the core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation.  Members of this family share a highly conserved Sm fold containing an N-terminal helix followed by a strongly bent five-stranded antiparallel beta-sheet. LSm1 is one of at least seven subunits that assemble onto U6 snRNA to form a seven-membered ring structure.  Sm-like proteins exist in archaea as well as prokaryotes that form heptameric and hexameric ring structures similar to those found in eukaryotes.
Probab=99.81  E-value=1e-20  Score=103.35  Aligned_cols=52  Identities=23%  Similarity=0.329  Sum_probs=44.5

Q ss_pred             CCCCceEEEEEEeecCCCceEecccccccCccccccccccchhhheeeeeeeecCCCCCC
Q psy1222           1 MTDGRVLVGTFLCTDRDANVILGSCGEYLSPEVFESKEENGAQEARLLGLVMVPGQHIPA   60 (60)
Q Consensus         1 l~dgR~~~G~l~~~D~~~NlvL~~~~E~~~~~~~~~~~~~~~~~~r~lG~v~irG~~Iv~   60 (60)
                      |+|||++.|+|+|||+||||+|+||.|+.....        ...++.+|+++|||++|++
T Consensus        19 l~~gr~~~G~L~~fD~~~NlvL~d~~E~~~~~~--------~~~~~~lG~~viRG~~V~~   70 (74)
T cd01728          19 LRDGRKLIGILRSFDQFANLVLQDTVERIYVGD--------KYGDIPRGIFIIRGENVVL   70 (74)
T ss_pred             EcCCeEEEEEEEEECCcccEEecceEEEEecCC--------ccceeEeeEEEEECCEEEE
Confidence            589999999999999999999999999876431        1246789999999999873


No 8  
>cd01727 LSm8 The eukaryotic Sm and Sm-like (LSm) proteins associate with RNA to form the core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation.  Members of this family share a highly conserved Sm fold containing an N-terminal helix followed by a strongly bent five-stranded antiparallel beta-sheet. LSm8 is one of at least seven subunits that assemble onto U6 snRNA to form a seven-membered ring structure.  Sm-like proteins exist in archaea as well as prokaryotes that form heptameric and hexameric ring structures similar to those found in eukaryotes.
Probab=99.80  E-value=2.8e-20  Score=101.28  Aligned_cols=53  Identities=34%  Similarity=0.493  Sum_probs=44.5

Q ss_pred             CCCCceEEEEEEeecCCCceEecccccccCccccccccccchhhheeeeeeeecCCCCCC
Q psy1222           1 MTDGRVLVGTFLCTDRDANVILGSCGEYLSPEVFESKEENGAQEARLLGLVMVPGQHIPA   60 (60)
Q Consensus         1 l~dgR~~~G~l~~~D~~~NlvL~~~~E~~~~~~~~~~~~~~~~~~r~lG~v~irG~~Iv~   60 (60)
                      ++|||.++|+|+|||+||||||++|.|+...+..       ....+.+|++++||+||++
T Consensus        16 l~dgr~~~G~L~~~D~~~NlvL~~~~E~~~~~~~-------~~~~~~lG~~~iRG~~I~~   68 (74)
T cd01727          16 TVDGRVIVGTLKGFDQATNLILDDSHERVYSSDE-------GVEQVVLGLYIIRGDNIAV   68 (74)
T ss_pred             ECCCcEEEEEEEEEccccCEEccceEEEEecCCC-------CceeeEeceEEECCCEEEE
Confidence            5799999999999999999999999998754311       2356789999999999873


No 9  
>cd01719 Sm_G The eukaryotic Sm and Sm-like (LSm) proteins associate with RNA to form the core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation.  Members of this family share a highly conserved Sm fold containing an N-terminal helix followed by a strongly bent five-stranded antiparallel beta-sheet.  Sm subunit G binds subunits E and F to form a trimer which then assembles onto snRNA along with the D1/D2 and D3/B heterodimers forming a seven-membered ring structure.  Sm-like proteins exist in archaea as well as prokaryotes that form heptameric and hexameric ring structures similar to those found in eukaryotes.
Probab=99.79  E-value=7e-20  Score=99.51  Aligned_cols=49  Identities=24%  Similarity=0.314  Sum_probs=43.5

Q ss_pred             CCCCceEEEEEEeecCCCceEecccccccCccccccccccchhhheeeeeeeecCCCCCC
Q psy1222           1 MTDGRVLVGTFLCTDRDANVILGSCGEYLSPEVFESKEENGAQEARLLGLVMVPGQHIPA   60 (60)
Q Consensus         1 l~dgR~~~G~l~~~D~~~NlvL~~~~E~~~~~~~~~~~~~~~~~~r~lG~v~irG~~Iv~   60 (60)
                      |+|||++.|+|+|||+||||+|++|+|+...           ...+.+|+++|||++|++
T Consensus        17 L~~g~~~~G~L~~~D~~mNlvL~~~~E~~~~-----------~~~~~lg~v~IRG~~I~~   65 (72)
T cd01719          17 LNGNRKVSGILRGFDPFMNLVLDDAVEVNSG-----------GEKNNIGMVVIRGNSIVM   65 (72)
T ss_pred             ECCCeEEEEEEEEEcccccEEeccEEEEccC-----------CceeEeceEEECCCEEEE
Confidence            5899999999999999999999999999742           246889999999999863


No 10 
>PRK00737 small nuclear ribonucleoprotein; Provisional
Probab=99.78  E-value=7.9e-20  Score=99.12  Aligned_cols=48  Identities=25%  Similarity=0.412  Sum_probs=42.6

Q ss_pred             CCCCceEEEEEEeecCCCceEecccccccCccccccccccchhhheeeeeeeecCCCCC
Q psy1222           1 MTDGRVLVGTFLCTDRDANVILGSCGEYLSPEVFESKEENGAQEARLLGLVMVPGQHIP   59 (60)
Q Consensus         1 l~dgR~~~G~l~~~D~~~NlvL~~~~E~~~~~~~~~~~~~~~~~~r~lG~v~irG~~Iv   59 (60)
                      |+|||+|.|+|++||+|||++|+||.|++..           +..+.+|.++|||++|+
T Consensus        21 lk~g~~~~G~L~~~D~~mNlvL~d~~e~~~~-----------~~~~~lg~v~iRG~~V~   68 (72)
T PRK00737         21 LKGGREFRGELQGYDIHMNLVLDNAEEIQDG-----------EVVRKLGKVVIRGDNVV   68 (72)
T ss_pred             ECCCCEEEEEEEEEcccceeEEeeEEEEcCC-----------CeEeEcCcEEEeCCEEE
Confidence            5899999999999999999999999997532           24678999999999986


No 11 
>cd01731 archaeal_Sm1 The archaeal sm1 proteins: The Sm proteins are conserved in all three domains of life and are always associated with U-rich RNA sequences. They function to mediate RNA-RNA interactions and RNA biogenesis.  All Sm proteins contain a common sequence motif in two segments, Sm1 and Sm2, separated by a short variable linker. Eukaryotic Sm proteins form part of specific small nuclear ribonucleoproteins (snRNPs) that are involved in the processing of pre-mRNAs to mature mRNAs, and are a major component of the eukaryotic spliceosome. Most snRNPs consist of seven Sm proteins (B/B', D1, D2, D3, E, F and G) arranged in a ring on a uridine-rich sequence (Sm site), plus a small nuclear RNA (snRNA) (either U1, U2, U5 or U4/6). Since archaebacteria do not have any splicing apparatus, Sm proteins of archaebacteria may play a more general role. Archaeal Lsm proteins are likely to represent the ancestral Sm domain.
Probab=99.78  E-value=8.9e-20  Score=97.77  Aligned_cols=48  Identities=23%  Similarity=0.400  Sum_probs=43.0

Q ss_pred             CCCCceEEEEEEeecCCCceEecccccccCccccccccccchhhheeeeeeeecCCCCC
Q psy1222           1 MTDGRVLVGTFLCTDRDANVILGSCGEYLSPEVFESKEENGAQEARLLGLVMVPGQHIP   59 (60)
Q Consensus         1 l~dgR~~~G~l~~~D~~~NlvL~~~~E~~~~~~~~~~~~~~~~~~r~lG~v~irG~~Iv   59 (60)
                      |+|||++.|+|.|||+||||+|++|+|++...           ..+.+|+++|||++|+
T Consensus        17 l~~g~~~~G~L~~~D~~mNlvL~~~~e~~~~~-----------~~~~lg~~~iRG~~I~   64 (68)
T cd01731          17 LKGGKEVRGRLKSYDQHMNLVLEDAEEIDDGE-----------PVRKYGRVVIRGDNVL   64 (68)
T ss_pred             ECCCCEEEEEEEEECCcceEEEeeEEEEecCC-----------eEeEcCcEEEeCCEEE
Confidence            57999999999999999999999999987542           4678999999999986


No 12 
>cd01718 Sm_E The eukaryotic Sm and Sm-like (LSm) proteins associate with RNA to form the core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation.  Members of this family share a highly conserved Sm fold containing an N-terminal helix followed by a strongly bent five-stranded antiparallel beta-sheet.  Sm subunit E binds subunits F and G to form a trimer which then assembles onto snRNA along with the D1/D2 and D3/B heterodimers forming a seven-membered ring structure.  Sm-like proteins exist in archaea as well as prokaryotes that form heptameric and hexameric ring structures similar to those found in eukaryotes.
Probab=99.78  E-value=1.1e-19  Score=100.43  Aligned_cols=48  Identities=19%  Similarity=0.313  Sum_probs=42.2

Q ss_pred             CCCceEEEEEEeecCCCceEecccccccCccccccccccchhhheeeeeeeecCCCCC
Q psy1222           2 TDGRVLVGTFLCTDRDANVILGSCGEYLSPEVFESKEENGAQEARLLGLVMVPGQHIP   59 (60)
Q Consensus         2 ~dgR~~~G~l~~~D~~~NlvL~~~~E~~~~~~~~~~~~~~~~~~r~lG~v~irG~~Iv   59 (60)
                      ++||+++|+|+|||+||||||+||+|+....          .+.+.+|+++|||+||+
T Consensus        28 ~~g~~~~G~L~gfD~~mNlvL~d~~E~~~~~----------~~~~~lG~iliRGnnV~   75 (79)
T cd01718          28 QTDLRIEGVIIGFDEYMNLVLDDAEEVHLKT----------KTRKPLGRILLKGDNIT   75 (79)
T ss_pred             CCCcEEEEEEEEEccceeEEEcCEEEEecCC----------ceEeEcCcEEEeCCEEE
Confidence            4899999999999999999999999997521          35678999999999986


No 13 
>PTZ00138 small nuclear ribonucleoprotein; Provisional
Probab=99.75  E-value=7.8e-19  Score=98.87  Aligned_cols=48  Identities=21%  Similarity=0.340  Sum_probs=41.6

Q ss_pred             CCceEEEEEEeecCCCceEecccccccCccccccccccchhhheeeeeeeecCCCCCC
Q psy1222           3 DGRVLVGTFLCTDRDANVILGSCGEYLSPEVFESKEENGAQEARLLGLVMVPGQHIPA   60 (60)
Q Consensus         3 dgR~~~G~l~~~D~~~NlvL~~~~E~~~~~~~~~~~~~~~~~~r~lG~v~irG~~Iv~   60 (60)
                      ++|++.|+|+|||+||||||+||+|++...          +..+.+|+++|||+||++
T Consensus        37 ~~r~~~G~L~gfD~~mNlVL~d~~E~~~~~----------~~~~~lG~ilIRGnnV~~   84 (89)
T PTZ00138         37 PNLRIEGKILGFDEYMNMVLDDAEEVYTKK----------NTRKDLGRILLKGDNITL   84 (89)
T ss_pred             CCcEEEEEEEEEcccceEEEccEEEEecCC----------ceeeEcCeEEEcCCEEEE
Confidence            469999999999999999999999987531          357789999999999863


No 14 
>cd01726 LSm6 The eukaryotic Sm and Sm-like (LSm) proteins associate with RNA to form the core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation.  Members of this family share a highly conserved Sm fold containing an N-terminal helix followed by a strongly bent five-stranded antiparallel beta-sheet. LSm6 is one of at least seven subunits that assemble onto U6 snRNA to form a seven-membered ring structure.  Sm-like proteins exist in archaea as well as prokaryotes that form heptameric and hexameric ring structures similar to those found in eukaryotes.
Probab=99.73  E-value=2.9e-18  Score=91.79  Aligned_cols=48  Identities=23%  Similarity=0.382  Sum_probs=42.2

Q ss_pred             CCCCceEEEEEEeecCCCceEecccccccCccccccccccchhhheeeeeeeecCCCCC
Q psy1222           1 MTDGRVLVGTFLCTDRDANVILGSCGEYLSPEVFESKEENGAQEARLLGLVMVPGQHIP   59 (60)
Q Consensus         1 l~dgR~~~G~l~~~D~~~NlvL~~~~E~~~~~~~~~~~~~~~~~~r~lG~v~irG~~Iv   59 (60)
                      |++||+|.|+|.|||+||||+|++|+|....           ...+.+|+++|||++|+
T Consensus        17 Lk~g~~~~G~L~~~D~~mNlvL~~~~~~~~~-----------~~~~~~~~v~IRG~~I~   64 (67)
T cd01726          17 LNSGVDYRGILACLDGYMNIALEQTEEYVNG-----------QLKNKYGDAFIRGNNVL   64 (67)
T ss_pred             ECCCCEEEEEEEEEccceeeEEeeEEEEeCC-----------ceeeEeCCEEEECCEEE
Confidence            6899999999999999999999999886532           24678999999999985


No 15 
>cd01722 Sm_F The eukaryotic Sm and Sm-like (LSm) proteins associate with RNA to form core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation.  Members of this family share a highly conserved Sm fold containing an N-terminal helix followed by a strongly bent five-stranded antiparallel beta-sheet. Sm subunit F is capable of forming both homo- and hetero-heptamer ring structures.  To form the hetero-heptamer, Sm subunit F initially binds subunits E and G to form a trimer which then assembles onto snRNA along with the D3/B and D1/D2 heterodimers.
Probab=99.72  E-value=2.4e-18  Score=92.33  Aligned_cols=48  Identities=23%  Similarity=0.342  Sum_probs=42.1

Q ss_pred             CCCCceEEEEEEeecCCCceEecccccccCccccccccccchhhheeeeeeeecCCCCC
Q psy1222           1 MTDGRVLVGTFLCTDRDANVILGSCGEYLSPEVFESKEENGAQEARLLGLVMVPGQHIP   59 (60)
Q Consensus         1 l~dgR~~~G~l~~~D~~~NlvL~~~~E~~~~~~~~~~~~~~~~~~r~lG~v~irG~~Iv   59 (60)
                      |+|||++.|+|.|||+|||++|++|+|+...           ...+.+|.++|||++|+
T Consensus        18 Lk~g~~~~G~L~~~D~~mNi~L~~~~e~~~~-----------~~~~~lg~~~IRG~~I~   65 (68)
T cd01722          18 LKWGMEYKGTLVSVDSYMNLQLANTEEYIDG-----------KSTGNLGEVLIRCNNVL   65 (68)
T ss_pred             ECCCcEEEEEEEEECCCEEEEEeeEEEEeCC-----------ccccCcCcEEEECCEEE
Confidence            5899999999999999999999999988542           24567999999999985


No 16 
>smart00651 Sm snRNP Sm proteins. small nuclear ribonucleoprotein particles (snRNPs) involved in pre-mRNA splicing
Probab=99.72  E-value=2.5e-18  Score=91.12  Aligned_cols=49  Identities=31%  Similarity=0.474  Sum_probs=43.9

Q ss_pred             CCCCceEEEEEEeecCCCceEecccccccCccccccccccchhhheeeeeeeecCCCCC
Q psy1222           1 MTDGRVLVGTFLCTDRDANVILGSCGEYLSPEVFESKEENGAQEARLLGLVMVPGQHIP   59 (60)
Q Consensus         1 l~dgR~~~G~l~~~D~~~NlvL~~~~E~~~~~~~~~~~~~~~~~~r~lG~v~irG~~Iv   59 (60)
                      |+|||.+.|+|.|||+||||+|++|.|+....          ...+.+|.++|||++|+
T Consensus        15 l~~g~~~~G~L~~~D~~~NlvL~~~~e~~~~~----------~~~~~~~~~~IrG~~I~   63 (67)
T smart00651       15 LKNGREYRGTLKGFDQFMNLVLEDVEETVKDG----------EKKRKLGLVFIRGNNIV   63 (67)
T ss_pred             ECCCcEEEEEEEEECccccEEEccEEEEecCC----------cEEeEeCCEEEcCCEEE
Confidence            57999999999999999999999999998642          35788999999999986


No 17 
>KOG3168|consensus
Probab=99.71  E-value=3.1e-19  Score=109.45  Aligned_cols=59  Identities=32%  Similarity=0.634  Sum_probs=51.7

Q ss_pred             CCCCceEEEEEEeecCCCceEecccccccCccccccccccchhhheeeeeeeecCCCCCC
Q psy1222           1 MTDGRVLVGTFLCTDRDANVILGSCGEYLSPEVFESKEENGAQEARLLGLVMVPGQHIPA   60 (60)
Q Consensus         1 l~dgR~~~G~l~~~D~~~NlvL~~~~E~~~~~~~~~~~~~~~~~~r~lG~v~irG~~Iv~   60 (60)
                      ++|||.|+|+|.+||+|||+||.||+|++..+.++.+.. ..+++|.+|++++||+||||
T Consensus        21 ~qDgr~~ig~~~afDkhmNlvl~dceE~r~~k~k~~~~~-~~eEkr~lgLvllRgenIvs   79 (177)
T KOG3168|consen   21 LQDGRTFIGQFKAFDKHMNLVLQDCEEFRKIKPKNRKMT-DGEEKRVLGLVLLRGENIVS   79 (177)
T ss_pred             eccCceeechhhhhHHHHHHHHHHHHHHhcccccccccc-ccceeeEEEEEEecCCcEEE
Confidence            579999999999999999999999999998877654322 35789999999999999987


No 18 
>PF01423 LSM:  LSM domain ;  InterPro: IPR001163 This family is found in Lsm (like-Sm) proteins and in bacterial Lsm-related Hfq proteins. In each case, the domain adopts a core structure consisting of an open beta-barrel with an SH3-like topology. Lsm (like-Sm) proteins have diverse functions, and are thought to be important modulators of RNA biogenesis and function [, ]. The Sm proteins form part of specific small nuclear ribonucleoproteins (snRNPs) that are involved in the processing of pre-mRNAs to mature mRNAs, and are a major component of the eukaryotic spliceosome. Most snRNPs consist of seven Sm proteins (B/B', D1, D2, D3, E, F and G) arranged in a ring on a uridine-rich sequence (Sm site), plus a small nuclear RNA (snRNA) (either U1, U2, U5 or U4/6) []. All Sm proteins contain a common sequence motif in two segments, Sm1 and Sm2, separated by a short variable linker []. In other snRNPs, certain Sm proteins are replaced with different Lsm proteins, such as with U7 snRNPs, in which the D1 and D2 Sm proteins are replaced with U7-specific Lsm10 and Lsm11 proteins, where Lsm11 plays a role in histone U7-specific RNA processing []. Lsm proteins are also found in archaebacteria, which do not have any splicing apparatus suggesting a more general role for Lsm proteins. The pleiotropic translational regulator Hfq (host factor Q) is a bacterial Lsm-like protein, which modulates the structure of numerous RNA molecules by binding preferentially to A/U-rich sequences in RNA []. Hfq forms an Lsm-like fold, however, unlike the heptameric Sm proteins, Hfq forms a homo-hexameric ring.; PDB: 1D3B_K 2Y9D_D 2Y9A_D 2Y9C_R 3VRI_C 2Y9B_K 3QUI_D 3M4G_H 3INZ_E 1U1S_C ....
Probab=99.69  E-value=8.9e-18  Score=89.07  Aligned_cols=49  Identities=33%  Similarity=0.546  Sum_probs=44.2

Q ss_pred             CCCCceEEEEEEeecCCCceEecccccccCccccccccccchhhheeeeeeeecCCCCC
Q psy1222           1 MTDGRVLVGTFLCTDRDANVILGSCGEYLSPEVFESKEENGAQEARLLGLVMVPGQHIP   59 (60)
Q Consensus         1 l~dgR~~~G~l~~~D~~~NlvL~~~~E~~~~~~~~~~~~~~~~~~r~lG~v~irG~~Iv   59 (60)
                      |+||+.+.|+|.+||+|||++|++|.|+....          .+.+++|.++|||++|.
T Consensus        15 l~~g~~~~G~L~~~D~~~Nl~L~~~~~~~~~~----------~~~~~~~~~~irG~~I~   63 (67)
T PF01423_consen   15 LKNGRTYRGTLVSFDQFMNLVLSDVTETIKNG----------PEKRSLGLVFIRGSNIR   63 (67)
T ss_dssp             ETTSEEEEEEEEEEETTEEEEEEEEEEEETTE----------SEEEEEEEEEEEGGGEE
T ss_pred             EeCCEEEEEEEEEeechheEEeeeEEEEECCC----------CcEeECcEEEEECCEEE
Confidence            57999999999999999999999999998753          16788999999999986


No 19 
>cd00600 Sm_like The eukaryotic Sm and Sm-like (LSm) proteins associate with RNA to form the core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation.  Members of this family share a highly conserved Sm fold containing an N-terminal helix followed by a strongly bent five-stranded antiparallel beta-sheet.  Sm-like proteins exist in archaea as well as prokaryotes that form heptameric and hexameric ring structures similar to those found in eukaryotes.
Probab=99.67  E-value=3.8e-17  Score=85.45  Aligned_cols=48  Identities=33%  Similarity=0.652  Sum_probs=43.4

Q ss_pred             CCCCceEEEEEEeecCCCceEecccccccCccccccccccchhhheeeeeeeecCCCCC
Q psy1222           1 MTDGRVLVGTFLCTDRDANVILGSCGEYLSPEVFESKEENGAQEARLLGLVMVPGQHIP   59 (60)
Q Consensus         1 l~dgR~~~G~l~~~D~~~NlvL~~~~E~~~~~~~~~~~~~~~~~~r~lG~v~irG~~Iv   59 (60)
                      |+||+.+.|+|.|||+|||++|++|.|++..           ...+.+|.++|||++|.
T Consensus        13 l~~g~~~~G~L~~~D~~~Ni~L~~~~~~~~~-----------~~~~~~~~~~irG~~I~   60 (63)
T cd00600          13 LKDGRVLEGVLVAFDKYMNLVLDDVEETIKE-----------GKKRVLGLVLIRGDNVR   60 (63)
T ss_pred             ECCCcEEEEEEEEECCCCCEEECCEEEEecC-----------CcEEECCeEEEECCEEE
Confidence            5799999999999999999999999999874           25688999999999985


No 20 
>KOG1780|consensus
Probab=99.67  E-value=1.9e-17  Score=90.09  Aligned_cols=48  Identities=23%  Similarity=0.351  Sum_probs=42.9

Q ss_pred             CCCCceEEEEEEeecCCCceEecccccccCccccccccccchhhheeeeeeeecCCCCC
Q psy1222           1 MTDGRVLVGTFLCTDRDANVILGSCGEYLSPEVFESKEENGAQEARLLGLVMVPGQHIP   59 (60)
Q Consensus         1 l~dgR~~~G~l~~~D~~~NlvL~~~~E~~~~~~~~~~~~~~~~~~r~lG~v~irG~~Iv   59 (60)
                      |++||.+.|+|+|||.|||+||++|+|....           ..+..+|+++|||++|+
T Consensus        21 lnG~r~v~GiLrGyD~FmNiVlde~vE~~~~-----------~~~~~ig~~vIrgnsiv   68 (77)
T KOG1780|consen   21 LNGGRKVTGILRGYDPFMNIVLDETVEPNGD-----------GDKNNIGMVVIRGNSIV   68 (77)
T ss_pred             eCCCcEEEEEEeccchHHhhhhhhceeecCc-----------CCcceeeeEEEeccEEE
Confidence            5789999999999999999999999998764           34677999999999986


No 21 
>COG1958 LSM1 Small nuclear ribonucleoprotein (snRNP) homolog [Transcription]
Probab=99.67  E-value=5.5e-17  Score=89.05  Aligned_cols=52  Identities=29%  Similarity=0.411  Sum_probs=41.2

Q ss_pred             CCCCceEEEEEEeecCCCceEecccccccCccccccccccchhhheeeeeeeecCCCCC
Q psy1222           1 MTDGRVLVGTFLCTDRDANVILGSCGEYLSPEVFESKEENGAQEARLLGLVMVPGQHIP   59 (60)
Q Consensus         1 l~dgR~~~G~l~~~D~~~NlvL~~~~E~~~~~~~~~~~~~~~~~~r~lG~v~irG~~Iv   59 (60)
                      |++||+|.|+|.|||+|||++|+||.|+......       ....+..|.++|||++|+
T Consensus        24 lk~g~~~~G~L~~~D~~mNlvL~d~~e~~~~~~~-------~~~~~~~~~~~IRG~~I~   75 (79)
T COG1958          24 LKNGREYRGTLVGFDQYMNLVLDDVEEIISHDGE-------KNVRRLGGEVLIRGDNIV   75 (79)
T ss_pred             ECCCCEEEEEEEEEccceeEEEeceEEEeccCCc-------cccceeccEEEEECCcEE
Confidence            5899999999999999999999999999851100       012344459999999986


No 22 
>KOG1781|consensus
Probab=99.62  E-value=1.3e-17  Score=94.91  Aligned_cols=57  Identities=32%  Similarity=0.349  Sum_probs=47.7

Q ss_pred             CCCCceEEEEEEeecCCCceEecccccccCccccccccccchhhheeeeeeeecCCCCCC
Q psy1222           1 MTDGRVLVGTFLCTDRDANVILGSCGEYLSPEVFESKEENGAQEARLLGLVMVPGQHIPA   60 (60)
Q Consensus         1 l~dgR~~~G~l~~~D~~~NlvL~~~~E~~~~~~~~~~~~~~~~~~r~lG~v~irG~~Iv~   60 (60)
                      +.+||+..|+|+|||+.|||||++|+||..++..+.+   ...++|.||++++||..+++
T Consensus        34 f~GGr~~sGiLkGyDqLlNlVLDd~vEylrdpdd~~~---~~~~tR~LGLvV~RGTalvl   90 (108)
T KOG1781|consen   34 FTGGREASGILKGYDQLLNLVLDDTVEYLRDPDDPYK---LTDETRKLGLVVCRGTALVL   90 (108)
T ss_pred             eecCceeeeehhhHHHHHHHHHHHHHHHhcCCCCccc---hhhhhheeeeEEEcccEEEE
Confidence            4689999999999999999999999999887654322   34567999999999998763


No 23 
>cd01721 Sm_D3 The eukaryotic Sm and Sm-like (LSm) proteins associate with RNA to form core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation.  Members of this family share a highly conserved Sm fold containing an N-terminal helix followed by a strongly bent five-stranded antiparallel beta-sheet. Sm subunit D3 heterodimerizes with subunit B and three such heterodimers form a hexameric ring structure with alternating B and D3 subunits. The D3 - B heterodimer also assembles into a heptameric ring containing D1, D2, E, F, and G subunits. Sm-like proteins exist in archaea as well as prokaryotes which form heptameric and hexameric ring structures similar to those found in eukaryotes.
Probab=99.55  E-value=4.1e-15  Score=80.23  Aligned_cols=48  Identities=19%  Similarity=0.266  Sum_probs=40.6

Q ss_pred             CCCCceEEEEEEeecCCCceEecccccccCccccccccccchhhheeeeeeeecCCCCC
Q psy1222           1 MTDGRVLVGTFLCTDRDANVILGSCGEYLSPEVFESKEENGAQEARLLGLVMVPGQHIP   59 (60)
Q Consensus         1 l~dgR~~~G~l~~~D~~~NlvL~~~~E~~~~~~~~~~~~~~~~~~r~lG~v~irG~~Iv   59 (60)
                      |++|.++.|+|.++|.|||++|++|.|.....           ....+|.++|||+||.
T Consensus        17 Lk~g~~~~G~L~~~D~~MNl~L~~~~~~~~~g-----------~~~~~~~v~IRG~nI~   64 (70)
T cd01721          17 LKTGEVYRGKLIEAEDNMNCQLKDVTVTARDG-----------RVSQLEQVYIRGSKIR   64 (70)
T ss_pred             ECCCcEEEEEEEEEcCCceeEEEEEEEECCCC-----------cEeEcCcEEEeCCEEE
Confidence            68999999999999999999999998754321           2356899999999984


No 24 
>cd01723 LSm4 The eukaryotic Sm and Sm-like (LSm) proteins associate with RNA to form the core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation.  Members of this family share a highly conserved Sm fold containing an N-terminal helix followed by a strongly bent five-stranded antiparallel beta-sheet. LSm4 is one of at least seven subunits that assemble onto U6 snRNA to form a seven-membered ring structure.  Sm-like proteins exist in archaea as well as prokaryotes that form heptameric and hexameric ring structures similar to those found in eukaryotes.
Probab=99.55  E-value=3.9e-15  Score=81.35  Aligned_cols=49  Identities=14%  Similarity=0.129  Sum_probs=40.9

Q ss_pred             CCCCceEEEEEEeecCCCceEecccccccCccccccccccchhhheeeeeeeecCCCCC
Q psy1222           1 MTDGRVLVGTFLCTDRDANVILGSCGEYLSPEVFESKEENGAQEARLLGLVMVPGQHIP   59 (60)
Q Consensus         1 l~dgR~~~G~l~~~D~~~NlvL~~~~E~~~~~~~~~~~~~~~~~~r~lG~v~irG~~Iv   59 (60)
                      |++|+++.|+|.+||+|||++|++|+|.....          +....++.++|||++|.
T Consensus        18 Lkng~~~~G~L~~~D~~mNi~L~~~~~~~~~g----------~~~~~~~~v~IRG~~I~   66 (76)
T cd01723          18 LKNGETYNGHLVNCDNWMNIHLREVICTSKDG----------DKFWKMPECYIRGNTIK   66 (76)
T ss_pred             ECCCCEEEEEEEEEcCCCceEEEeEEEECCCC----------cEeeeCCcEEEeCCEEE
Confidence            58999999999999999999999999874431          23345789999999985


No 25 
>KOG3460|consensus
Probab=99.54  E-value=3.1e-16  Score=87.04  Aligned_cols=59  Identities=24%  Similarity=0.362  Sum_probs=47.3

Q ss_pred             CCCCceEEEEEEeecCCCceEecccccccCccccc--cccccchhhheeeeeeeecCCCCC
Q psy1222           1 MTDGRVLVGTFLCTDRDANVILGSCGEYLSPEVFE--SKEENGAQEARLLGLVMVPGQHIP   59 (60)
Q Consensus         1 l~dgR~~~G~l~~~D~~~NlvL~~~~E~~~~~~~~--~~~~~~~~~~r~lG~v~irG~~Iv   59 (60)
                      |+++|++.|+|.|||+|+||||+|++|.+......  ..++.....+|.+-++|+||++|+
T Consensus        22 lr~drel~G~L~afD~HlNmvL~d~eetit~~e~~E~~~e~~~k~~~r~~emlFvRGd~Vi   82 (91)
T KOG3460|consen   22 LRSDRELRGTLHAFDEHLNMVLGDVEETITTVEIDEDTYEEIVKTTKRTVEMLFVRGDGVI   82 (91)
T ss_pred             ecCChhhhcchhhhHHhhhhhhhhhhheEEEeeccchhHHHHHhhhhcceeEEEEeCCeEE
Confidence            57899999999999999999999999998754321  112223467889999999999986


No 26 
>cd01724 Sm_D1 The eukaryotic Sm and Sm-like (LSm) proteins associate with RNA to form core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation.  Members of this family share a highly conserved Sm fold containing an N-terminal helix followed by a strongly bent five-stranded antiparallel beta-sheet. Sm subunit D1 heterodimerizes with subunit D2 and three such heterodimers form a hexameric ring structure with alternating D1 and D2 subunits. The D1 - D2 heterodimer also assembles into a heptameric ring containing DB, D3, E, F, and G subunits. Sm-like proteins exist in archaea as well as prokaryotes which form heptameric and hexameric ring structures similar to those found in eukaryotes.
Probab=99.50  E-value=2.3e-14  Score=80.73  Aligned_cols=48  Identities=21%  Similarity=0.295  Sum_probs=41.9

Q ss_pred             CCCCceEEEEEEeecCCCceEecccccccCccccccccccchhhheeeeeeeecCCCCC
Q psy1222           1 MTDGRVLVGTFLCTDRDANVILGSCGEYLSPEVFESKEENGAQEARLLGLVMVPGQHIP   59 (60)
Q Consensus         1 l~dgR~~~G~l~~~D~~~NlvL~~~~E~~~~~~~~~~~~~~~~~~r~lG~v~irG~~Iv   59 (60)
                      |++|..|.|+|.++|.|||++|+||+|+...           .....+|.++|||++|.
T Consensus        18 LKng~~~~G~L~~vD~~MNl~L~~a~~~~~~-----------~~~~~~~~v~IRG~nI~   65 (90)
T cd01724          18 LKNGTIVHGTITGVDPSMNTHLKNVKLTLKG-----------RNPVPLDTLSIRGNNIR   65 (90)
T ss_pred             ECCCCEEEEEEEEEcCceeEEEEEEEEEcCC-----------CceeEcceEEEeCCEEE
Confidence            6899999999999999999999999888643           24567899999999984


No 27 
>cd01733 LSm10 The eukaryotic Sm and Sm-like (LSm) proteins associate with RNA to form the core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation.  Members of this family share a highly conserved Sm fold containing an N-terminal helix followed by a strongly bent five-stranded antiparallel beta-sheet.  LSm10 is an SmD1-like protein which is thought to bind U7 snRNA along with LSm11 and five other Sm subunits to form a 7-member ring structure. LSm10 and the U7 snRNP of which it is a part are thought to play an important role in histone mRNA 3' processing.
Probab=99.47  E-value=4.9e-14  Score=77.55  Aligned_cols=48  Identities=17%  Similarity=0.198  Sum_probs=40.8

Q ss_pred             CCCCceEEEEEEeecCCCceEecccccccCccccccccccchhhheeeeeeeecCCCCC
Q psy1222           1 MTDGRVLVGTFLCTDRDANVILGSCGEYLSPEVFESKEENGAQEARLLGLVMVPGQHIP   59 (60)
Q Consensus         1 l~dgR~~~G~l~~~D~~~NlvL~~~~E~~~~~~~~~~~~~~~~~~r~lG~v~irG~~Iv   59 (60)
                      |++|..|.|+|.++|.+||++|+||++....           .....+|.++|||++|.
T Consensus        26 LKng~~~~G~L~~vD~~MNl~L~~~~~~~~~-----------~~~~~~~~v~IRG~nI~   73 (78)
T cd01733          26 LRNETTVTGRIASVDAFMNIRLAKVTIIDRN-----------GKQVQVEEIMVTGRNIR   73 (78)
T ss_pred             ECCCCEEEEEEEEEcCCceeEEEEEEEEcCC-----------CceeECCcEEEECCEEE
Confidence            6899999999999999999999999876532           13346899999999984


No 28 
>KOG1782|consensus
Probab=99.45  E-value=1.5e-15  Score=89.27  Aligned_cols=51  Identities=25%  Similarity=0.334  Sum_probs=45.4

Q ss_pred             CCCCceEEEEEEeecCCCceEecccccccCccccccccccchhhheeeeeeeecCCCCC
Q psy1222           1 MTDGRVLVGTFLCTDRDANVILGSCGEYLSPEVFESKEENGAQEARLLGLVMVPGQHIP   59 (60)
Q Consensus         1 l~dgR~~~G~l~~~D~~~NlvL~~~~E~~~~~~~~~~~~~~~~~~r~lG~v~irG~~Iv   59 (60)
                      |+|||.+.|+|++||||.|+||++|+|++.-..        ....+..|..+|||+||+
T Consensus        26 LRDGR~L~G~LRSfDQFaNlvL~~~iERi~v~~--------~Y~di~~glfiIRGENVv   76 (129)
T KOG1782|consen   26 LRDGRKLIGVLRSFDQFANLVLQGVIERIFVGN--------KYCDIPRGLFIIRGENVV   76 (129)
T ss_pred             EecCcchhhhhhhHHHHHHHHHHhhhhheeecc--------eecccCceEEEEecCcEE
Confidence            689999999999999999999999999987642        346677899999999997


No 29 
>KOG1784|consensus
Probab=99.40  E-value=2e-13  Score=76.90  Aligned_cols=51  Identities=31%  Similarity=0.563  Sum_probs=44.7

Q ss_pred             CCCceEEEEEEeecCCCceEecccccccCccccccccccchhhheeeeeeeecCCCCC
Q psy1222           2 TDGRVLVGTFLCTDRDANVILGSCGEYLSPEVFESKEENGAQEARLLGLVMVPGQHIP   59 (60)
Q Consensus         2 ~dgR~~~G~l~~~D~~~NlvL~~~~E~~~~~~~~~~~~~~~~~~r~lG~v~irG~~Iv   59 (60)
                      .|||.++|.|+||||-.||+|+++-|+.....       ...++-.+|+.+|||+|+-
T Consensus        18 ~DGr~ivgsLkGFDq~tNlii~~~heRi~s~~-------~gv~q~~lGlyiirgeNva   68 (96)
T KOG1784|consen   18 NDGRVIVGSLKGFDQTTNLIIDESHERIFSET-------EGVEQIVLGLYIIRGENVA   68 (96)
T ss_pred             cCCeEEEEEeccccccceeeehhhHhhhhhhh-------cchhheeeEEEEEecCccc
Confidence            59999999999999999999999999987542       2356788999999999984


No 30 
>cd01725 LSm2 The eukaryotic Sm and Sm-like (LSm) proteins associate with RNA to form the core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation.  Members of this family share a highly conserved Sm fold containing an N-terminal helix followed by a strongly bent five-stranded antiparallel beta-sheet. LSm2 is one of at least seven subunits that assemble onto U6 snRNA to form a seven-membered ring structure.  Sm-like proteins exist in archaea as well as prokaryotes that form heptameric and hexameric ring structures similar to those found in eukaryotes.
Probab=99.40  E-value=2.5e-13  Score=75.07  Aligned_cols=50  Identities=12%  Similarity=0.116  Sum_probs=40.2

Q ss_pred             CCCCceEEEEEEeecCCCceEecccccccCccccccccccchhhheeeeeeeecCCCCC
Q psy1222           1 MTDGRVLVGTFLCTDRDANVILGSCGEYLSPEVFESKEENGAQEARLLGLVMVPGQHIP   59 (60)
Q Consensus         1 l~dgR~~~G~l~~~D~~~NlvL~~~~E~~~~~~~~~~~~~~~~~~r~lG~v~irG~~Iv   59 (60)
                      |++|..+.|+|.++|.|||++|+||++.....         ......++.++|||++|.
T Consensus        18 LKng~~~~G~L~~vD~~MNi~L~n~~~~~~~~---------~~~~~~~~~v~IRG~~I~   67 (81)
T cd01725          18 LKNDLSIRGTLHSVDQYLNIKLTNISVTDPEK---------YPHMLSVKNCFIRGSVVR   67 (81)
T ss_pred             ECCCcEEEEEEEEECCCcccEEEEEEEEcCCC---------cccccccCeEEEECCEEE
Confidence            68999999999999999999999997764321         112345689999999974


No 31 
>KOG1774|consensus
Probab=99.31  E-value=5.2e-13  Score=73.91  Aligned_cols=46  Identities=24%  Similarity=0.395  Sum_probs=39.0

Q ss_pred             CceEEEEEEeecCCCceEecccccccCccccccccccchhhheeeeeeeecCCCCC
Q psy1222           4 GRVLVGTFLCTDRDANVILGSCGEYLSPEVFESKEENGAQEARLLGLVMVPGQHIP   59 (60)
Q Consensus         4 gR~~~G~l~~~D~~~NlvL~~~~E~~~~~~~~~~~~~~~~~~r~lG~v~irG~~Iv   59 (60)
                      |-.+.|.+.|||.|||+||++|+|.....          ...+++|.+++.||||.
T Consensus        36 ~~rieG~IvGFDEyMNvVlD~aeev~~k~----------~~rk~lGRilLKGDnIt   81 (88)
T KOG1774|consen   36 GLRIEGRIVGFDEYMNLVLDDAEEVHSKT----------KSRKELGRILLKGDNIT   81 (88)
T ss_pred             CcEEeEEEechHHhhhhhhcchhhccccc----------cCCCccccEEEcCCcEE
Confidence            45689999999999999999999987642          23448999999999986


No 32 
>KOG3482|consensus
Probab=99.24  E-value=4.7e-12  Score=68.86  Aligned_cols=48  Identities=21%  Similarity=0.352  Sum_probs=42.9

Q ss_pred             CCCCceEEEEEEeecCCCceEecccccccCccccccccccchhhheeeeeeeecCCCCC
Q psy1222           1 MTDGRVLVGTFLCTDRDANVILGSCGEYLSPEVFESKEENGAQEARLLGLVMVPGQHIP   59 (60)
Q Consensus         1 l~dgR~~~G~l~~~D~~~NlvL~~~~E~~~~~~~~~~~~~~~~~~r~lG~v~irG~~Iv   59 (60)
                      |+.|.+|.|+|.+.|.+|||.|.+|+|++..           .....+|.++||++||.
T Consensus        25 LKwg~eYkG~LvsvD~YmNlqL~~~eE~idG-----------~~~g~lGEilIRCNNvl   72 (79)
T KOG3482|consen   25 LKWGQEYKGTLVSVDNYMNLQLANAEEYIDG-----------VSTGNLGEILIRCNNVL   72 (79)
T ss_pred             EecCcEEEEEEEEecchhheehhhhhhhhcc-----------cccccceeEEEEeccEE
Confidence            4678999999999999999999999999874           35677999999999984


No 33 
>KOG1775|consensus
Probab=99.19  E-value=2.8e-12  Score=70.33  Aligned_cols=51  Identities=24%  Similarity=0.373  Sum_probs=42.8

Q ss_pred             CCCCceEEEEEEeecCCCceEecccccccCccccccccccchhhheeeeeeeecCCCCC
Q psy1222           1 MTDGRVLVGTFLCTDRDANVILGSCGEYLSPEVFESKEENGAQEARLLGLVMVPGQHIP   59 (60)
Q Consensus         1 l~dgR~~~G~l~~~D~~~NlvL~~~~E~~~~~~~~~~~~~~~~~~r~lG~v~irG~~Iv   59 (60)
                      |+..|+|+|+|.|||.|.|+||+|++||-..++        .....+++++++.|+||.
T Consensus        24 mksdkE~~GtL~GFDd~VNmvLeDvtEye~~~e--------gr~~tk~~~iLLnGNni~   74 (84)
T KOG1775|consen   24 MKSDKEFVGTLVGFDDFVNMVLEDVTEYEITPE--------GRRMTKLDQILLNGNNIT   74 (84)
T ss_pred             EccCceeeeEEechHHHHHHHHHhhhheeeCCC--------cceeeeeeeeeecCCcEE
Confidence            578899999999999999999999999976542        124557899999999974


No 34 
>KOG3459|consensus
Probab=99.15  E-value=2.1e-12  Score=74.75  Aligned_cols=59  Identities=17%  Similarity=0.276  Sum_probs=49.0

Q ss_pred             CCCCceEEEEEEeecCCCceEecccccccCcccccccc--ccchhhheeeeeeeecCCCCC
Q psy1222           1 MTDGRVLVGTFLCTDRDANVILGSCGEYLSPEVFESKE--ENGAQEARLLGLVMVPGQHIP   59 (60)
Q Consensus         1 l~dgR~~~G~l~~~D~~~NlvL~~~~E~~~~~~~~~~~--~~~~~~~r~lG~v~irG~~Iv   59 (60)
                      .+|++.+.|...|||.|+|++|+++.|.|.+.+++++.  ...-...|.+|.++||||+|+
T Consensus        43 cRnn~k~l~Rv~afdrhcnmvlenvkelwte~~ks~kgkk~~~~~~~r~isK~flRGdsvI  103 (114)
T KOG3459|consen   43 CRNNVKLLGRVKAFDRHCNMVLENVKELWTEVPKSGKGKKAKPVNKDRFISKMFLRGDSVI  103 (114)
T ss_pred             ecccHHHHhhhhhhhccccchhhcHHHHCCccccCCCcccCCccchhhhhheeeecCCeEE
Confidence            36889999999999999999999999999987765432  112356899999999999986


No 35 
>KOG1783|consensus
Probab=99.08  E-value=6.7e-12  Score=68.25  Aligned_cols=48  Identities=27%  Similarity=0.439  Sum_probs=42.8

Q ss_pred             CCCCceEEEEEEeecCCCceEecccccccCccccccccccchhhheeeeeeeecCCCCC
Q psy1222           1 MTDGRVLVGTFLCTDRDANVILGSCGEYLSPEVFESKEENGAQEARLLGLVMVPGQHIP   59 (60)
Q Consensus         1 l~dgR~~~G~l~~~D~~~NlvL~~~~E~~~~~~~~~~~~~~~~~~r~lG~v~irG~~Iv   59 (60)
                      |.+|-.|.|+|.|.|.+|||-|+.|+|+...           +.++..|.+||||++|.
T Consensus        23 l~sgvdyrG~l~~lDgymNiaLe~tee~~ng-----------ql~n~ygdaFirGnnVl   70 (77)
T KOG1783|consen   23 LNSGVDYRGTLVCLDGYMNIALESTEEYVNG-----------QLKNKYGDAFIRGNNVL   70 (77)
T ss_pred             ecCCccccceehhhhhHHHHHHHHHHHHhcC-----------cccccccceeeccccEE
Confidence            5688999999999999999999999999864           35778999999999984


No 36 
>cd01739 LSm11_C The eukaryotic Sm and Sm-like (LSm) proteins associate with RNA to form the core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation.  Members of this family share a highly conserved Sm fold containing an N-terminal helix followed by a strongly bent five-stranded antiparallel beta-sheet. LSm11 is an SmD2 - like subunit which binds U7 snRNA along with LSm10 and five other Sm subunits to form a 7-member ring structure. LSm11 and the U7 snRNP of which it is a part are thought to play an important role in histone mRNA 3' processing.
Probab=98.67  E-value=1e-08  Score=54.79  Aligned_cols=26  Identities=23%  Similarity=0.175  Sum_probs=24.5

Q ss_pred             eEEEEEEeecCCCceEecccccccCc
Q psy1222           6 VLVGTFLCTDRDANVILGSCGEYLSP   31 (60)
Q Consensus         6 ~~~G~l~~~D~~~NlvL~~~~E~~~~   31 (60)
                      .++|.|.|||+|+||+|.|+.|.+..
T Consensus        24 ~~~G~lvAFDK~wNm~L~DV~E~y~~   49 (66)
T cd01739          24 VCSGFLVAFDKFWNMALVDVDETYRK   49 (66)
T ss_pred             EEEEEEEeeeeehhheehhhhhhhcc
Confidence            68999999999999999999999875


No 37 
>KOG3448|consensus
Probab=97.73  E-value=3.8e-05  Score=43.35  Aligned_cols=49  Identities=12%  Similarity=0.094  Sum_probs=35.7

Q ss_pred             CCCCceEEEEEEeecCCCceEecccccccCccccccccccchhhheeeeeeeecCCCC
Q psy1222           1 MTDGRVLVGTFLCTDRDANVILGSCGEYLSPEVFESKEENGAQEARLLGLVMVPGQHI   58 (60)
Q Consensus         1 l~dgR~~~G~l~~~D~~~NlvL~~~~E~~~~~~~~~~~~~~~~~~r~lG~v~irG~~I   58 (60)
                      |+++-.+.|+|.+.|++.|+=|.|..-...+  +       ...--.+-..+|||..|
T Consensus        19 LKnd~~i~GtL~svDqyLNlkL~di~v~d~~--k-------yPhm~Sv~ncfIRGSvv   67 (96)
T KOG3448|consen   19 LKNDLSICGTLHSVDQYLNLKLTDISVTDPD--K-------YPHMLSVKNCFIRGSVV   67 (96)
T ss_pred             EcCCcEEEEEecccchhheeEEeeeEeeCcc--c-------CCCeeeeeeEEEeccEE
Confidence            5788899999999999999999987544332  1       11234456788998754


No 38 
>KOG3293|consensus
Probab=97.72  E-value=1.7e-05  Score=47.08  Aligned_cols=48  Identities=15%  Similarity=0.085  Sum_probs=38.3

Q ss_pred             CCCCceEEEEEEeecCCCceEecccccccCccccccccccchhhheeeeeeeecCCCC
Q psy1222           1 MTDGRVLVGTFLCTDRDANVILGSCGEYLSPEVFESKEENGAQEARLLGLVMVPGQHI   58 (60)
Q Consensus         1 l~dgR~~~G~l~~~D~~~NlvL~~~~E~~~~~~~~~~~~~~~~~~r~lG~v~irG~~I   58 (60)
                      |++|-.|.|.|...|..|||-|.+++++..+..          .--.+..+.|||.+|
T Consensus        19 LKNget~nGhL~~cD~wMNl~L~~Vi~ts~Dgd----------kf~r~pEcYirGttI   66 (134)
T KOG3293|consen   19 LKNGETYNGHLVNCDNWMNLHLREVICTSEDGD----------KFFRMPECYIRGTTI   66 (134)
T ss_pred             ecCCCEecceeecchhhhhcchheeEEeccCCC----------ceeecceeEEeccee
Confidence            689999999999999999999999999876532          223345677888765


No 39 
>KOG3172|consensus
Probab=97.40  E-value=0.00026  Score=41.23  Aligned_cols=46  Identities=20%  Similarity=0.269  Sum_probs=37.6

Q ss_pred             CCCceEEEEEEeecCCCceEecccccccCccccccccccchhhheeeeeeeecCCCC
Q psy1222           2 TDGRVLVGTFLCTDRDANVILGSCGEYLSPEVFESKEENGAQEARLLGLVMVPGQHI   58 (60)
Q Consensus         2 ~dgR~~~G~l~~~D~~~NlvL~~~~E~~~~~~~~~~~~~~~~~~r~lG~v~irG~~I   58 (60)
                      +.|-.|.|.|+-.+..||+.|+|.+-...+.           ....+-+|+|||..|
T Consensus        23 ~tGe~YRGkliEaeDnmNcql~di~vT~~dg-----------~vs~le~V~IRGS~I   68 (119)
T KOG3172|consen   23 KTGEVYRGKLIEAEDNMNCQLRDITVTARDG-----------RVSQLEQVFIRGSKI   68 (119)
T ss_pred             cCCceeeeeeEEeccccccEEEEEEEEccCC-----------cceeeeeEEEecCeE
Confidence            5688999999999999999999987665432           345577899999876


No 40 
>KOG3428|consensus
Probab=97.36  E-value=0.00031  Score=40.84  Aligned_cols=46  Identities=22%  Similarity=0.297  Sum_probs=36.0

Q ss_pred             CCCCceEEEEEEeecCCCceEecccccccCccccccccccchhhheeeeeeeecCCCC
Q psy1222           1 MTDGRVLVGTFLCTDRDANVILGSCGEYLSPEVFESKEENGAQEARLLGLVMVPGQHI   58 (60)
Q Consensus         1 l~dgR~~~G~l~~~D~~~NlvL~~~~E~~~~~~~~~~~~~~~~~~r~lG~v~irG~~I   58 (60)
                      |++|....|++.+.|.+||..|.+..=....            +...+-.+.|||++|
T Consensus        19 Lkngt~v~G~I~~Vd~~Mn~~l~~v~~t~~~------------~pv~l~~lsirgnni   64 (109)
T KOG3428|consen   19 LKNGTIVHGTIDSVDVQMNTHLKHVKMTVKG------------EPVRLDTLSIRGNNI   64 (109)
T ss_pred             ecCCcEEeeeEEEEEhhheeEEEEEEEecCC------------CceeEEEEEeecceE
Confidence            6799999999999999999999887654431            234466778888876


No 41 
>PF14438 SM-ATX:  Ataxin 2 SM domain; PDB: 1M5Q_1.
Probab=96.67  E-value=0.0021  Score=34.62  Aligned_cols=56  Identities=14%  Similarity=0.313  Sum_probs=29.3

Q ss_pred             CCCCceEEEEEEeecC---CCceEecccccccCccccccccccchhhheeeeeeeecCCCCCC
Q psy1222           1 MTDGRVLVGTFLCTDR---DANVILGSCGEYLSPEVFESKEENGAQEARLLGLVMVPGQHIPA   60 (60)
Q Consensus         1 l~dgR~~~G~l~~~D~---~~NlvL~~~~E~~~~~~~~~~~~~~~~~~r~lG~v~irG~~Iv~   60 (60)
                      ++||..|.|+|.+++.   .+-++|.-|.........+.    ..........++|+++.|++
T Consensus        19 ~~~G~~yeGif~s~s~~~~~~~vvLk~a~~~~~~~~~~~----~~~~~~~~~tlii~~~dvv~   77 (77)
T PF14438_consen   19 TKNGSVYEGIFHSASPESNEFDVVLKMARKVPKSDQSNS----DPLSSEIVETLIIPAKDVVQ   77 (77)
T ss_dssp             ETTS-EEEEEEEEE-T---T--EEEEEEEETTS----------EEEEEEE-GGGEEE------
T ss_pred             ECCCCEEEEEEEeCCCcccceeEEEEeeeeccccccccC----CccCCCCCceEEEeccccCC
Confidence            4799999999999999   88999988877765432110    01223345578888887763


No 42 
>cd01716 Hfq Hfq, an abundant, ubiquitous RNA-binding protein, functions as a pleiotrophic regulator of RNA metabolism in prokaryotes, required for transcription of some transcripts and degradation of others. Hfq binds small RNA molecules called riboregulators that modulate the stability or translation efficiency of RNA transcripts. Hfq binds preferentially to unstructured A/U-rich RNA sequences and is similar to the eukaryotic Sm proteins in both sequence and structure. Hfq forms a homo-hexameric ring similar to the heptameric ring of the Sm proteins.
Probab=92.23  E-value=0.16  Score=26.76  Aligned_cols=21  Identities=19%  Similarity=0.265  Sum_probs=18.0

Q ss_pred             CCCCceEEEEEEeecCCCceE
Q psy1222           1 MTDGRVLVGTFLCTDRDANVI   21 (60)
Q Consensus         1 l~dgR~~~G~l~~~D~~~Nlv   21 (60)
                      |.+|-.+.|.+.+||+|+=++
T Consensus        18 L~NG~~l~G~I~~fD~ftVll   38 (61)
T cd01716          18 LVNGVQLKGQIESFDNFTVLL   38 (61)
T ss_pred             EeCCcEEEEEEEEEcceEEEE
Confidence            568999999999999999444


No 43 
>TIGR02383 Hfq RNA chaperone Hfq. This model represents the RNA-binding pleiotropic regulator Hfq, a small, Sm-like protein of bacteria. It helps pair regulatory noncoding RNAs with complementary mRNA target regions. It enhances the elongation of poly(A) tails on mRNA. It appears also to protect RNase E recognition sites (A/U-rich sequences with adjacent stem-loop structures) from cleavage. Being pleiotropic, it differs in some of its activities in different species. Hfq binds the non-coding regulatory RNA DsrA (see Rfam RF00014) in the few species known to have it: Escherichia coli, Shigella flexneri, Salmonella spp. In Azorhizobium caulinodans, an hfq mutant is unable to express nifA, and Hfq is called NrfA, for nif regulatory factor (see PubMed:8197116). The name hfq reflects phenomenology as a host factor for phage Q-beta RNA replication.
Probab=91.60  E-value=0.2  Score=26.38  Aligned_cols=21  Identities=19%  Similarity=0.265  Sum_probs=17.9

Q ss_pred             CCCCceEEEEEEeecCCCceE
Q psy1222           1 MTDGRVLVGTFLCTDRDANVI   21 (60)
Q Consensus         1 l~dgR~~~G~l~~~D~~~Nlv   21 (60)
                      |.+|-.+.|.+.+||+|+=++
T Consensus        22 L~nG~~l~G~I~~fD~ftVll   42 (61)
T TIGR02383        22 LVNGVQLKGVIESFDNFTVLL   42 (61)
T ss_pred             EeCCcEEEEEEEEEeeeEEEE
Confidence            468999999999999999444


No 44 
>PRK00395 hfq RNA-binding protein Hfq; Provisional
Probab=90.97  E-value=0.25  Score=27.31  Aligned_cols=24  Identities=17%  Similarity=0.216  Sum_probs=19.4

Q ss_pred             CCCCceEEEEEEeecCCCceEecc
Q psy1222           1 MTDGRVLVGTFLCTDRDANVILGS   24 (60)
Q Consensus         1 l~dgR~~~G~l~~~D~~~NlvL~~   24 (60)
                      |.+|-.+.|.+.+||+|+=++-.+
T Consensus        26 L~NG~~l~G~I~~fD~ftVll~~~   49 (79)
T PRK00395         26 LVNGIKLQGQIESFDNFVVLLRNT   49 (79)
T ss_pred             EeCCcEEEEEEEEEccEEEEEEEC
Confidence            568999999999999998555434


No 45 
>PF02237 BPL_C:  Biotin protein ligase C terminal domain;  InterPro: IPR003142 This C-terminal domain has an SH3-like barrel fold, the function of which is unknown. It is found associated with prokaryotic bifunctional transcriptional repressors [] and eukaryotic enzymes involved in biotin utilization [, ].   In Escherichia coli the biotin operon repressor (BirA) is a bifunctional protein. BirA acts both as the acetyl-coA carboxylase biotin holoenzyme synthetase (6.3.4.15 from EC) and as the biotin operon repressor. DNA sequence analysis of mutations indicates that the helix-turn-helix DNA binding region is located at the N terminus while mutations affecting enzyme function, although mapping over a large region, are found mainly in the central part of the protein's primary sequence [].; GO: 0006464 protein modification process; PDB: 3RUX_A 2CGH_A 3L1A_B 3L2Z_A 1HXD_A 1BIB_A 2EWN_B 1BIA_A 2EJ9_A 3FJP_A ....
Probab=89.86  E-value=0.75  Score=22.53  Aligned_cols=25  Identities=12%  Similarity=0.122  Sum_probs=21.6

Q ss_pred             CCceEEEEEEeecCCCceEeccccc
Q psy1222           3 DGRVLVGTFLCTDRDANVILGSCGE   27 (60)
Q Consensus         3 dgR~~~G~l~~~D~~~NlvL~~~~E   27 (60)
                      ++..+.|++.++|.+..|++.....
T Consensus        11 ~~~~~~G~~~gId~~G~L~v~~~~g   35 (48)
T PF02237_consen   11 GDGEIEGIAEGIDDDGALLVRTEDG   35 (48)
T ss_dssp             TSCEEEEEEEEEETTSEEEEEETTE
T ss_pred             CCeEEEEEEEEECCCCEEEEEECCC
Confidence            5678899999999999999976654


No 46 
>PF14563 DUF4444:  Domain of unknown function (DUF4444); PDB: 3BFM_A.
Probab=89.13  E-value=0.67  Score=22.74  Aligned_cols=23  Identities=35%  Similarity=0.449  Sum_probs=15.6

Q ss_pred             EEEEEEeecCCCceEeccccccc
Q psy1222           7 LVGTFLCTDRDANVILGSCGEYL   29 (60)
Q Consensus         7 ~~G~l~~~D~~~NlvL~~~~E~~   29 (60)
                      ..|+|.|+|....|+|.+..+..
T Consensus        10 ~tGtFlGvDE~FGmLLr~~~~T~   32 (42)
T PF14563_consen   10 LTGTFLGVDEDFGMLLRDDDTTH   32 (42)
T ss_dssp             EEEEEEEE-TT--EEEE-SS-EE
T ss_pred             cceeEEeeccccceEEEeCCccE
Confidence            57999999999999999887654


No 47 
>COG1923 Hfq Uncharacterized host factor I protein [General function prediction only]
Probab=87.47  E-value=0.52  Score=25.93  Aligned_cols=22  Identities=27%  Similarity=0.315  Sum_probs=17.9

Q ss_pred             CCCCceEEEEEEeecCCCceEec
Q psy1222           1 MTDGRVLVGTFLCTDRDANVILG   23 (60)
Q Consensus         1 l~dgR~~~G~l~~~D~~~NlvL~   23 (60)
                      |.+|=.+.|.+.+||+|. ++|.
T Consensus        26 LvNG~~L~G~V~sfD~f~-VlL~   47 (77)
T COG1923          26 LVNGFKLQGQVESFDNFV-VLLK   47 (77)
T ss_pred             EEcCEEEEEEEEeeeeEE-EEEE
Confidence            457889999999999998 4444


No 48 
>cd01736 LSm14_N LSm14 (also known as RAP55) belongs to a family of Sm-like proteins that associate with RNA to form the core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation. Members of this family share a highly conserved Sm fold, containing an N-terminal helix followed by a strongly bent five-stranded antiparallel beta-sheet, that associates with other Sm proteins to form hexameric and heptameric ring structures.   In addition to the N-terminal Sm-like domain, LSm14 has an uncharacterized C-terminal domain containing a conserved DFDF box.  In Xenopus laevis, LSm14 is an oocyte-specific constituent of ribonucleoprotein particles.
Probab=80.74  E-value=6.6  Score=21.41  Aligned_cols=53  Identities=8%  Similarity=0.119  Sum_probs=32.7

Q ss_pred             ceEEEEEEeecCCC-ceEecccccccCccccccccccchhhheeeeeeeecCCCC
Q psy1222           5 RVLVGTFLCTDRDA-NVILGSCGEYLSPEVFESKEENGAQEARLLGLVMVPGQHI   58 (60)
Q Consensus         5 R~~~G~l~~~D~~~-NlvL~~~~E~~~~~~~~~~~~~~~~~~r~lG~v~irG~~I   58 (60)
                      -.|+|+|..+|..- -+-|.++..+=.+...... ++..........++.||..|
T Consensus        17 iRYeGiL~~In~~~sTi~L~nVr~fGTEgR~~~~-~~ipp~~~vyd~IvFrgsDI   70 (74)
T cd01736          17 IRYEGILYTINTEDSTIALKNVRSFGTEGRPTDG-PEIPPSDEVYDYIVFRGSDI   70 (74)
T ss_pred             cEEEEEEEeeccccCEEEeeeeEeecccCCCCCC-CccCCCCcceeEEEEcCCcc
Confidence            45899999999884 4668887655433211100 01122344567899999876


No 49 
>KOG3382|consensus
Probab=80.09  E-value=0.99  Score=27.43  Aligned_cols=19  Identities=21%  Similarity=0.265  Sum_probs=16.0

Q ss_pred             EEEEEEeecCCCceEeccc
Q psy1222           7 LVGTFLCTDRDANVILGSC   25 (60)
Q Consensus         7 ~~G~l~~~D~~~NlvL~~~   25 (60)
                      =+|+|.|.|+|.|=--++-
T Consensus        45 kiGTLVG~DkfGNkYyen~   63 (151)
T KOG3382|consen   45 KIGTLVGVDKFGNKYYENN   63 (151)
T ss_pred             cceeeeeecccccchhccc
Confidence            3699999999999877665


No 50 
>KOG3168|consensus
Probab=79.18  E-value=5.9  Score=24.89  Aligned_cols=57  Identities=28%  Similarity=0.209  Sum_probs=38.8

Q ss_pred             CCCCceEEEEEEeecCCCceEecccccccCccccccccccchhhheeeeeeeecCCCCC
Q psy1222           1 MTDGRVLVGTFLCTDRDANVILGSCGEYLSPEVFESKEENGAQEARLLGLVMVPGQHIP   59 (60)
Q Consensus         1 l~dgR~~~G~l~~~D~~~NlvL~~~~E~~~~~~~~~~~~~~~~~~r~lG~v~irG~~Iv   59 (60)
                      ++|+++..+...++|.-.|||+--+++.....++...-.  ....+..|+..+.|-.|.
T Consensus        58 ~~~~eEkr~lgLvllRgenIvs~tVegppp~s~s~~~v~--ag~~~g~G~ar~~Grgip  114 (177)
T KOG3168|consen   58 MTDGEEKRVLGLVLLRGENIVSMTVEGPPPPSDSFRRVP--AGAARGPGIARVAGRGIP  114 (177)
T ss_pred             ccccceeeEEEEEEecCCcEEEEeccCCCCCcccccccc--ccccCCcccccccCCCcc
Confidence            468999999999999999999988888766543221000  123455666666666554


No 51 
>cd01735 LSm12_N LSm12 belongs to a family of Sm-like proteins that associate with RNA to form the core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation.  Members of this family share a highly conserved Sm fold containing an N-terminal helix followed by a strongly bent five-stranded antiparallel beta-sheet that associates with other Sm proteins to form hexameric and heptameric ring structures.   In addition to the N-terminal Sm-like domain, LSm12 has a novel methyltransferase domain.
Probab=78.85  E-value=4.2  Score=21.33  Aligned_cols=25  Identities=16%  Similarity=0.275  Sum_probs=19.9

Q ss_pred             CCceEEEEEEeecCCCceEeccccc
Q psy1222           3 DGRVLVGTFLCTDRDANVILGSCGE   27 (60)
Q Consensus         3 dgR~~~G~l~~~D~~~NlvL~~~~E   27 (60)
                      .|-+|.|.+.|||.-.+|++=.|.+
T Consensus        15 ~g~~ieGEV~afD~~tk~lIlk~~s   39 (61)
T cd01735          15 FEQRLQGEVVAFDYPSKMLILKCPS   39 (61)
T ss_pred             CCceEEEEEEEecCCCcEEEEECcc
Confidence            4789999999999998877555433


No 52 
>PRK14091 RNA-binding protein Hfq; Provisional
Probab=78.20  E-value=2.2  Score=26.56  Aligned_cols=25  Identities=16%  Similarity=0.187  Sum_probs=19.5

Q ss_pred             CCCCceEEEEEEeecCCCceEeccc
Q psy1222           1 MTDGRVLVGTFLCTDRDANVILGSC   25 (60)
Q Consensus         1 l~dgR~~~G~l~~~D~~~NlvL~~~   25 (60)
                      |.+|-.+.|.+.+||+|+=|+-.+.
T Consensus       111 L~NG~~l~G~I~~fD~ftvlL~~~g  135 (165)
T PRK14091        111 LVNGVMLQGEIAAFDLFCMLLERDG  135 (165)
T ss_pred             EecCcEEEEEEEEEcceEEEEEeCC
Confidence            4678899999999999984444443


No 53 
>PF03614 Flag1_repress:  Repressor of phase-1 flagellin;  InterPro: IPR003223 Flagellin is the subunit which polymerises to form the filaments of bacterial flagella. The proteins in this family are transcriptional repressors of phase-1 flagellin genes.; GO: 0003700 sequence-specific DNA binding transcription factor activity, 0006355 regulation of transcription, DNA-dependent
Probab=77.48  E-value=3  Score=25.84  Aligned_cols=26  Identities=19%  Similarity=0.080  Sum_probs=23.1

Q ss_pred             CCCCceEEEEEEeecCCCceEecccc
Q psy1222           1 MTDGRVLVGTFLCTDRDANVILGSCG   26 (60)
Q Consensus         1 l~dgR~~~G~l~~~D~~~NlvL~~~~   26 (60)
                      +.||..|.|.+.+|+.--|.||..+.
T Consensus        36 ~~ng~~f~myV~gf~~~~n~iL~p~~   61 (165)
T PF03614_consen   36 SENGQVFCMYVSGFMSKENKILAPDP   61 (165)
T ss_pred             ecCCcEEEEEEeccCcccCEEeccCC
Confidence            35899999999999999999997664


No 54 
>PF05071 NDUFA12:  NADH ubiquinone oxidoreductase subunit NDUFA12;  InterPro: IPR007763  NADH:ubiquinone oxidoreductase (complex I) (1.6.5.3 from EC) is a respiratory-chain enzyme that catalyses the transfer of two electrons from NADH to ubiquinone in a reaction that is associated with proton translocation across the membrane (NADH + ubiquinone = NAD+ + ubiquinol) []. Complex I is a major source of reactive oxygen species (ROS) that are predominantly formed by electron transfer from FMNH(2). Complex I is found in bacteria, cyanobacteria (as a NADH-plastoquinone oxidoreductase), archaea [], mitochondira, and in the hydrogenosome, a mitochondria-derived organelle. In general, the bacterial complex consists of 14 different subunits, while the mitochondrial complex contains homologues to these subunits in addition to approximately 31 additional proteins []. Mitochondrial complex I, which is located in the inner mitochondrial membrane, is the largest multimeric respiratory enzyme in the mitochondria, consisting of more than 40 subunits, one FMN co-factor and eight FeS clusters []. The assembly of mitochondrial complex I is an intricate process that requires the cooperation of the nuclear and mitochondrial genomes [, ]. Mitochondrial complex I can cycle between active and deactive forms that can be distinguished by the reactivity towards divalent cations and thiol-reactive agents. All redox prosthetic groups reside in the peripheral arm of the L-shaped structure. The NADH oxidation domain harbouring the FMN cofactor is connected via a chain of iron-sulphur clusters to the ubiquinone reduction site that is located in a large pocket formed by the PSST and 49kDa subunits of complex I []. this entry represents the 17.2kDa subunit from NADH:ubiquinone oxidoreductase and its homologues []. This subunit is believed to be one of the 36 structural complex I proteins.; GO: 0008137 NADH dehydrogenase (ubiquinone) activity, 0009055 electron carrier activity, 0016020 membrane
Probab=77.38  E-value=1.1  Score=25.60  Aligned_cols=17  Identities=29%  Similarity=0.255  Sum_probs=15.2

Q ss_pred             EEEEeecCCCceEeccc
Q psy1222           9 GTFLCTDRDANVILGSC   25 (60)
Q Consensus         9 G~l~~~D~~~NlvL~~~   25 (60)
                      |+|+|.|.|.|---+.-
T Consensus         1 G~lVG~D~~GN~YyE~~   17 (105)
T PF05071_consen    1 GTLVGTDEFGNKYYENP   17 (105)
T ss_pred             CCEeeEeCCCCEEEeec
Confidence            78999999999988766


No 55 
>PRK14091 RNA-binding protein Hfq; Provisional
Probab=74.72  E-value=3.1  Score=25.92  Aligned_cols=24  Identities=17%  Similarity=0.167  Sum_probs=18.5

Q ss_pred             CCCCceEEEEEEeecCCCceEecc
Q psy1222           1 MTDGRVLVGTFLCTDRDANVILGS   24 (60)
Q Consensus         1 l~dgR~~~G~l~~~D~~~NlvL~~   24 (60)
                      |.+|-.+.|.+.+||+|.=|+-.+
T Consensus        31 L~nG~rl~G~I~~fD~ftVlL~~~   54 (165)
T PRK14091         31 LVKGVKLQGIITWFDNFSILLRRD   54 (165)
T ss_pred             EecCcEEEEEEEEEcceEEEEEeC
Confidence            457889999999999998444333


No 56 
>PF03122 Herpes_MCP:  Herpes virus major capsid protein;  InterPro: IPR000912 The Herpesvirus major capsid protein (MCP) is the principal protein of the icosahedral capsid, forming the main component of the hexavalent and probably the pentavalent capsomeres. The capsid shell consists of 150 MCP hexamers and 12 MCP pentamers. One pentamer is found at each of the 12 apices of the icosahedral shell, and the hexamers form the edges and 20 faces []. The MCP can be considered as having three domains: floor, middle and upper. The floor domains form a thin largely continuous layer, or shell, and are the only parts that interact directly to form intercapsomeric connections. They also interact with the internal scaffolding protein during capsid assembly []. The remainder of the protein extends radially outward from the capsid producing the hexamer and pentamer capsomere structures. The middle domains are involved in binding to the triplexes that lie between and link adjacent capsomeres []. The upper domains form the tops of the hexamer and pentamer towers and are the binding sites for the small capsid protein VP26 in the hexons and for tegument proteins in the pentons.; GO: 0005198 structural molecule activity, 0019028 viral capsid; PDB: 1NO7_B.
Probab=68.48  E-value=1.6  Score=34.64  Aligned_cols=50  Identities=16%  Similarity=0.302  Sum_probs=0.0

Q ss_pred             CCCceEEEEEEeecCCCceEecccccccCccccccccccchhhheeeeeeeecCCCCCC
Q psy1222           2 TDGRVLVGTFLCTDRDANVILGSCGEYLSPEVFESKEENGAQEARLLGLVMVPGQHIPA   60 (60)
Q Consensus         2 ~dgR~~~G~l~~~D~~~NlvL~~~~E~~~~~~~~~~~~~~~~~~r~lG~v~irG~~Iv~   60 (60)
                      .+|+.+-|.|...|.-++.+|+--.+.....         ......+|.++|+|+|.|+
T Consensus       255 ~~G~~v~GVlvTT~~V~q~Ll~~l~~i~~~~---------v~~PatYg~~Vi~geNlVT  304 (1354)
T PF03122_consen  255 SSGRPVDGVLVTTANVMQKLLNLLGQISDTS---------VSVPATYGEFVISGENLVT  304 (1354)
T ss_dssp             -----------------------------------------------------------
T ss_pred             CCCCEeceEEeccHHHHHHHHHHHhhhccce---------eecchhheeeeecCccHHH
Confidence            4799999999999999988876544422211         1345678999999999875


No 57 
>PF12701 LSM14:  Scd6-like Sm domain; PDB: 2RM4_A 2FB7_A 2VC8_A 2VXF_A 2VXE_A.
Probab=66.37  E-value=16  Score=20.70  Aligned_cols=54  Identities=11%  Similarity=0.174  Sum_probs=31.0

Q ss_pred             CCceEEEEEEeecC-CCceEecccccccCccccccccccchhhheeeeeeeecCCCC
Q psy1222           3 DGRVLVGTFLCTDR-DANVILGSCGEYLSPEVFESKEENGAQEARLLGLVMVPGQHI   58 (60)
Q Consensus         3 dgR~~~G~l~~~D~-~~NlvL~~~~E~~~~~~~~~~~~~~~~~~r~lG~v~irG~~I   58 (60)
                      .+-.|+|+|...|. ...|.|.++.-+=.+.....  ............++.||..|
T Consensus        17 ~~iRYeG~L~~Id~~~sTItL~nVr~~GtE~R~~~--~~ipp~~~v~~~I~Fr~sDI   71 (96)
T PF12701_consen   17 SDIRYEGILYSIDTEDSTITLKNVRSFGTEGRPTD--REIPPSDEVYDYIVFRGSDI   71 (96)
T ss_dssp             TTEEEEEEEEEEETTTTEEEEEEEEETTETTSS-S--S---C-CSSSSEEEEETTTE
T ss_pred             CCcEEEEEEEEEcCCCCEEEeeeeeecCcCCCCcC--cccCCCCceeeEEEEEcccc
Confidence            44578999999998 47899998865543211000  00111223355677777654


No 58 
>PRK06630 hypothetical protein; Provisional
Probab=58.39  E-value=5.9  Score=22.77  Aligned_cols=19  Identities=16%  Similarity=-0.043  Sum_probs=16.4

Q ss_pred             EEEEEEeecCCCceEeccc
Q psy1222           7 LVGTFLCTDRDANVILGSC   25 (60)
Q Consensus         7 ~~G~l~~~D~~~NlvL~~~   25 (60)
                      ..|+|.|-|++.|---++.
T Consensus        11 r~G~lVG~D~~GNkYYE~~   29 (99)
T PRK06630         11 FFHKKVGEDEFLNQYYESR   29 (99)
T ss_pred             ccCeEeEEeCCCChhcccC
Confidence            3699999999999988774


No 59 
>TIGR02038 protease_degS periplasmic serine pepetdase DegS. This family consists of the periplasmic serine protease DegS (HhoB), a shorter paralog of protease DO (HtrA, DegP) and DegQ (HhoA). It is found in E. coli and several other Proteobacteria of the gamma subdivision. It contains a trypsin domain and a single copy of PDZ domain (in contrast to DegP with two copies). A critical role of this DegS is to sense stress in the periplasm and partially degrade an inhibitor of sigma(E).
Probab=53.36  E-value=19  Score=24.30  Aligned_cols=26  Identities=15%  Similarity=0.259  Sum_probs=22.1

Q ss_pred             CCCCceEEEEEEeecCCCceEecccc
Q psy1222           1 MTDGRVLVGTFLCTDRDANVILGSCG   26 (60)
Q Consensus         1 l~dgR~~~G~l~~~D~~~NlvL~~~~   26 (60)
                      +.||+.+.+++.++|...+|-|=...
T Consensus       108 ~~dg~~~~a~vv~~d~~~DlAvlkv~  133 (351)
T TIGR02038       108 LQDGRKFEAELVGSDPLTDLAVLKIE  133 (351)
T ss_pred             ECCCCEEEEEEEEecCCCCEEEEEec
Confidence            36899999999999999999885544


No 60 
>PLN03095 NADH:ubiquinone oxidoreductase 18 kDa subunit; Provisional
Probab=53.35  E-value=8.4  Score=22.66  Aligned_cols=20  Identities=15%  Similarity=0.092  Sum_probs=16.9

Q ss_pred             EEEEEeecCCCceEeccccc
Q psy1222           8 VGTFLCTDRDANVILGSCGE   27 (60)
Q Consensus         8 ~G~l~~~D~~~NlvL~~~~E   27 (60)
                      .|.|+|.|++.|---++..+
T Consensus         9 ~g~lVG~D~~GNkYYE~~~~   28 (115)
T PLN03095          9 AGRLVGEDEFGNKYYENPSY   28 (115)
T ss_pred             cceEeEEcCCCCeeeEcCCC
Confidence            58999999999998886544


No 61 
>PLN02732 Probable NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit
Probab=51.06  E-value=15  Score=22.77  Aligned_cols=19  Identities=21%  Similarity=0.291  Sum_probs=16.6

Q ss_pred             EEEEeecCCCceEeccccc
Q psy1222           9 GTFLCTDRDANVILGSCGE   27 (60)
Q Consensus         9 G~l~~~D~~~NlvL~~~~E   27 (60)
                      |+|+|-|++.|---++..+
T Consensus        49 G~lVG~D~~GNkYYE~~~~   67 (159)
T PLN02732         49 ATLVGVDKFGNKYYQKLGD   67 (159)
T ss_pred             cEEEEecCCCCeeeecCCC
Confidence            9999999999999887643


No 62 
>PF11095 Gemin7:  Gem-associated protein 7 (Gemin7);  InterPro: IPR020338 Gem-associated protein 7 (Gemin7) is a component of the survival of motor neuron complex, which functions in the assembly of spliceosomal small nuclear ribonucleoproteins. Gemin7 interacts with several Sm proteins of spliceosomal small nuclear ribonucleoproteins, especially SmE []. Gem-associated protein 7 is found in the nucleoplasm, in nuclear "gems" (Gemini of Cajal bodies), and in the cytoplasm. Three transcript variants encoding the same protein have been found for this gene [].; GO: 0032797 SMN complex; PDB: 1Y96_D.
Probab=50.76  E-value=20  Score=19.75  Aligned_cols=23  Identities=17%  Similarity=0.284  Sum_probs=15.7

Q ss_pred             CCCceEEEEEEeecCC-CceEecc
Q psy1222           2 TDGRVLVGTFLCTDRD-ANVILGS   24 (60)
Q Consensus         2 ~dgR~~~G~l~~~D~~-~NlvL~~   24 (60)
                      -++..+.|+|.|+|.. .|+..++
T Consensus        32 ~e~t~V~a~F~a~d~~~~~f~Vs~   55 (80)
T PF11095_consen   32 HENTTVSARFGACDIDVSNFQVSN   55 (80)
T ss_dssp             GGG-EEEEEEEEE-TTS-EEEEEE
T ss_pred             eCCeEEEEEEEEecCchheEEhhh
Confidence            4677899999999988 4666554


No 63 
>PF01887 SAM_adeno_trans:  S-adenosyl-l-methionine hydroxide adenosyltransferase;  InterPro: IPR002747 The S-adenosyl-L-methionine (SAM) hydroxide adenosyltransferase family groups several fluorinase and chlorinase enzymes whose common feature is that they mediate nucleophilic reactions of their respective halide ions to the C-5' carbon of SAM []. These enzymes utilise a rigorously conserved amino acid side chain triad (Asp-Arg-His) which may have a role in activating water to hydroxide ion. Structural studies indicate that the protein is a homotrimer, with each monomer being composed of N- and C-terminal domains [, ]. The N-terminal domain has a central seven-stranded beta-sheet, which combines parallel and antiparallel strands sandwiched between alpha helices. The C-terminal domain forms a beta-barrel with a greek-key topology. SAM is bound at the interface between the C-terminal domain of one monomer and the N-terminal domain of the neighbouring monomer, with a total of three molecules bound by the trimer.; PDB: 2CW5_C 1WU8_C 2WR8_A 2Q6O_B 2Q6L_A 2Q6K_A 2Q6I_A 2V7T_B 2C4U_F 1RQP_C ....
Probab=49.26  E-value=24  Score=23.11  Aligned_cols=23  Identities=22%  Similarity=0.244  Sum_probs=19.4

Q ss_pred             eEEEEEEeecCCCceEecccccc
Q psy1222           6 VLVGTFLCTDRDANVILGSCGEY   28 (60)
Q Consensus         6 ~~~G~l~~~D~~~NlvL~~~~E~   28 (60)
                      .+.|.+.-+|+|.|+++.=..+.
T Consensus       169 ~i~g~Vi~iD~FGNlitnI~~~~  191 (258)
T PF01887_consen  169 GIRGEVIYIDHFGNLITNISREL  191 (258)
T ss_dssp             EEEEEEEEEETTSEEEEEEEHHH
T ss_pred             eEEEEEEEECccCCeeeCCCHHH
Confidence            78999999999999998755444


No 64 
>PRK10898 serine endoprotease; Provisional
Probab=48.97  E-value=26  Score=23.70  Aligned_cols=26  Identities=19%  Similarity=0.334  Sum_probs=21.7

Q ss_pred             CCCCceEEEEEEeecCCCceEecccc
Q psy1222           1 MTDGRVLVGTFLCTDRDANVILGSCG   26 (60)
Q Consensus         1 l~dgR~~~G~l~~~D~~~NlvL~~~~   26 (60)
                      +.||+.+.+.+.++|...+|-|=...
T Consensus       108 ~~dg~~~~a~vv~~d~~~DlAvl~v~  133 (353)
T PRK10898        108 LQDGRVFEALLVGSDSLTDLAVLKIN  133 (353)
T ss_pred             eCCCCEEEEEEEEEcCCCCEEEEEEc
Confidence            36899999999999999998765543


No 65 
>PRK10942 serine endoprotease; Provisional
Probab=45.67  E-value=29  Score=24.52  Aligned_cols=25  Identities=20%  Similarity=0.343  Sum_probs=21.4

Q ss_pred             CCCCceEEEEEEeecCCCceEeccc
Q psy1222           1 MTDGRVLVGTFLCTDRDANVILGSC   25 (60)
Q Consensus         1 l~dgR~~~G~l~~~D~~~NlvL~~~   25 (60)
                      +.|||++.+++.++|...+|-|=..
T Consensus       142 ~~dg~~~~a~vv~~D~~~DlAvlki  166 (473)
T PRK10942        142 LSDGRKFDAKVVGKDPRSDIALIQL  166 (473)
T ss_pred             ECCCCEEEEEEEEecCCCCEEEEEe
Confidence            4689999999999999999877643


No 66 
>PRK08183 NADH dehydrogenase; Validated
Probab=45.51  E-value=12  Score=22.45  Aligned_cols=19  Identities=26%  Similarity=0.233  Sum_probs=16.1

Q ss_pred             EEEEEeecCCCceEecccc
Q psy1222           8 VGTFLCTDRDANVILGSCG   26 (60)
Q Consensus         8 ~G~l~~~D~~~NlvL~~~~   26 (60)
                      .|.|+|.|++.|---++..
T Consensus        25 ~g~lVG~D~~GNkYYE~~~   43 (133)
T PRK08183         25 KGERVGEDEFGNVYYRTKG   43 (133)
T ss_pred             cCeEeEecCCCCeeeecCC
Confidence            5899999999999886654


No 67 
>PF06372 Gemin6:  Gemin6 protein;  InterPro: IPR009422 This family consists of several mammalian Gemin6 proteins. The exact function of Gemin6 is unknown but it has been found to form part of the Survival of motor neuron complex. The SMN complex plays a key role in the biogenesis of spliceosomal small nuclear ribonucleoproteins (snRNPs) and other ribonucleoprotein particles [].; GO: 0000245 spliceosome assembly, 0005634 nucleus; PDB: 1Y96_A.
Probab=43.24  E-value=32  Score=21.40  Aligned_cols=25  Identities=24%  Similarity=0.284  Sum_probs=18.4

Q ss_pred             CCCceEEEEEEeecCC-CceEeccccc
Q psy1222           2 TDGRVLVGTFLCTDRD-ANVILGSCGE   27 (60)
Q Consensus         2 ~dgR~~~G~l~~~D~~-~NlvL~~~~E   27 (60)
                      .| +++.|.+.++|.- .||||-+..|
T Consensus        25 ~d-~~~~G~v~TiDPVS~siVL~~~~e   50 (166)
T PF06372_consen   25 SD-KEYKGWVYTIDPVSASIVLVNFQE   50 (166)
T ss_dssp             TT-EEEEEEEEEE-TTT--EEEEEE-T
T ss_pred             ec-cEEEEEEEEeCCCCCeEEEEEccc
Confidence            57 9999999999998 5999986666


No 68 
>PF07202 Tcp10_C:  T-complex protein 10 C-terminus;  InterPro: IPR009852 Proteins in this entry include T-complex 10, involved in spermatogenesis in mice, and centromere protein J, which not only inhibits microtubule nucleation from the centrosome, but also depolymerises taxol-stabilised microtubules [, ]. These proteins share an approximately 180 residue C-terminal region which contains unsual G repreats [].
Probab=42.18  E-value=16  Score=22.87  Aligned_cols=19  Identities=37%  Similarity=0.552  Sum_probs=16.4

Q ss_pred             ceEEEEEEeecCCCceEec
Q psy1222           5 RVLVGTFLCTDRDANVILG   23 (60)
Q Consensus         5 R~~~G~l~~~D~~~NlvL~   23 (60)
                      |.-.|.++.-|+..||||+
T Consensus       159 ~y~~gr~r~kd~~g~~~~d  177 (179)
T PF07202_consen  159 RYASGRVRIKDKDGNVIMD  177 (179)
T ss_pred             EeCCCcEEEecCCCCEEec
Confidence            4456999999999999996


No 69 
>TIGR02603 CxxCH_TIGR02603 putative heme-binding domain, Pirellula/Verrucomicrobium type. This model represents a domain limited to very few species but expanded into large paralogous families in some species that conain it. We find it in over 20 copies each in Pirellula sp. strain 1 (phylum Planctomycetes) and Verrucomicrobium spinosum DSM 4136 (phylum Verrucomicrobia), and no matches above trusted cutoff an any other species so far. This domain, about 140 amino acids long, contains an absolutely conserved motif CxxCH, the cytochrome c family heme-binding site signature (PS00190).
Probab=42.17  E-value=39  Score=19.57  Aligned_cols=24  Identities=29%  Similarity=0.465  Sum_probs=17.3

Q ss_pred             CCCCceEEEEEEeecCCCceEeccc
Q psy1222           1 MTDGRVLVGTFLCTDRDANVILGSC   25 (60)
Q Consensus         1 l~dgR~~~G~l~~~D~~~NlvL~~~   25 (60)
                      ++||+.+.|.+..=|.. .+.|.++
T Consensus        64 ~~dG~~~~G~~~~e~~~-~~~l~~~   87 (133)
T TIGR02603        64 LKDGRILSGIVASETAD-GVTVKMP   87 (133)
T ss_pred             ECCCCEEEEEEEecCCC-eEEEEcC
Confidence            47999999999886544 3555554


No 70 
>PRK06955 biotin--protein ligase; Provisional
Probab=40.76  E-value=40  Score=22.27  Aligned_cols=23  Identities=13%  Similarity=0.187  Sum_probs=19.4

Q ss_pred             CCceEEEEEEeecCCCceEeccc
Q psy1222           3 DGRVLVGTFLCTDRDANVILGSC   25 (60)
Q Consensus         3 dgR~~~G~l~~~D~~~NlvL~~~   25 (60)
                      +++.+.|++.++|....|++...
T Consensus       258 ~~~~~~G~~~gId~~G~L~v~~~  280 (300)
T PRK06955        258 GAELARGVAHGIDETGQLLLDTP  280 (300)
T ss_pred             CCcEEEEEEeeECCCceEEEEeC
Confidence            45678999999999999999643


No 71 
>PTZ00275 biotin-acetyl-CoA-carboxylase ligase; Provisional
Probab=40.42  E-value=44  Score=21.99  Aligned_cols=23  Identities=22%  Similarity=0.277  Sum_probs=20.0

Q ss_pred             CCceEEEEEEeecCCCceEeccc
Q psy1222           3 DGRVLVGTFLCTDRDANVILGSC   25 (60)
Q Consensus         3 dgR~~~G~l~~~D~~~NlvL~~~   25 (60)
                      ++..+.|++.++|....|+|...
T Consensus       245 ~~~~~~G~~~gId~~G~L~i~~~  267 (285)
T PTZ00275        245 DNELIVGYLQGLLHDGSLLLLRE  267 (285)
T ss_pred             CCCEEEEEEEEECCCCeEEEEeC
Confidence            57789999999999999999643


No 72 
>PRK10139 serine endoprotease; Provisional
Probab=38.83  E-value=43  Score=23.57  Aligned_cols=26  Identities=19%  Similarity=0.386  Sum_probs=22.1

Q ss_pred             CCCCceEEEEEEeecCCCceEecccc
Q psy1222           1 MTDGRVLVGTFLCTDRDANVILGSCG   26 (60)
Q Consensus         1 l~dgR~~~G~l~~~D~~~NlvL~~~~   26 (60)
                      +.||+.+.+++.++|....|-+=...
T Consensus       121 ~~dg~~~~a~vvg~D~~~DlAvlkv~  146 (455)
T PRK10139        121 LNDGREFDAKLIGSDDQSDIALLQIQ  146 (455)
T ss_pred             ECCCCEEEEEEEEEcCCCCEEEEEec
Confidence            46899999999999999998775543


No 73 
>TIGR00121 birA_ligase birA, biotin-[acetyl-CoA-carboxylase] ligase region. The protein name suggests that this enzyme transfers biotin only to acetyl-CoA-carboxylase but it also transfers the biotin moiety to other proteins. The apparent orthologs among the eukaryotes are larger proteins that contain a single copy of this domain.
Probab=38.73  E-value=48  Score=20.94  Aligned_cols=21  Identities=19%  Similarity=0.279  Sum_probs=18.7

Q ss_pred             CCceEEEEEEeecCCCceEec
Q psy1222           3 DGRVLVGTFLCTDRDANVILG   23 (60)
Q Consensus         3 dgR~~~G~l~~~D~~~NlvL~   23 (60)
                      ++..+.|++.++|....|+|.
T Consensus       201 ~~~~~~G~~~gI~~~G~L~v~  221 (237)
T TIGR00121       201 GNGEIEGIARGIDKDGALLLE  221 (237)
T ss_pred             CCcEEEEEEEeECCCceEEEE
Confidence            456799999999999999996


No 74 
>PF10894 DUF2689:  Protein of unknown function (DUF2689);  InterPro: IPR024396 Members of this protein family are annotated as conjugal transfer protein TrbD; however, currently no function is known.
Probab=38.35  E-value=2.8  Score=21.86  Aligned_cols=18  Identities=17%  Similarity=0.305  Sum_probs=14.9

Q ss_pred             cCCCceEecccccccCcc
Q psy1222          15 DRDANVILGSCGEYLSPE   32 (60)
Q Consensus        15 D~~~NlvL~~~~E~~~~~   32 (60)
                      |.||+-||++|.-++..+
T Consensus        21 DDFmhaVlSNCtTrIvLp   38 (61)
T PF10894_consen   21 DDFMHAVLSNCTTRIVLP   38 (61)
T ss_pred             HHHHHHHHhcCceeEEec
Confidence            889999999999876543


No 75 
>COG0779 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=38.28  E-value=52  Score=20.12  Aligned_cols=21  Identities=19%  Similarity=0.368  Sum_probs=17.5

Q ss_pred             CCCceEEEEEEeecCCCceEec
Q psy1222           2 TDGRVLVGTFLCTDRDANVILG   23 (60)
Q Consensus         2 ~dgR~~~G~l~~~D~~~NlvL~   23 (60)
                      .+.+.|.|+|.++|..+ +++.
T Consensus       111 ~~~k~~~G~i~~~d~~~-v~~~  131 (153)
T COG0779         111 EGRKKFEGKIVAVDGET-VTLE  131 (153)
T ss_pred             CCceEEEEEEEEEcCCe-EEEE
Confidence            57899999999999988 5553


No 76 
>PTZ00276 biotin/lipoate protein ligase; Provisional
Probab=36.72  E-value=58  Score=20.90  Aligned_cols=23  Identities=13%  Similarity=-0.094  Sum_probs=19.8

Q ss_pred             CCceEEEEEEeecCCCceEeccc
Q psy1222           3 DGRVLVGTFLCTDRDANVILGSC   25 (60)
Q Consensus         3 dgR~~~G~l~~~D~~~NlvL~~~   25 (60)
                      ++..+.|++.++|....|++...
T Consensus       210 ~~~~~~G~~~gId~~G~Lvv~~~  232 (245)
T PTZ00276        210 GRDPEELTALSLNEWGHLIVRRP  232 (245)
T ss_pred             CCcEEEEEEEEECCCCeEEEEEC
Confidence            56778999999999999999743


No 77 
>PRK11886 bifunctional biotin--[acetyl-CoA-carboxylase] synthetase/biotin operon repressor; Provisional
Probab=35.62  E-value=56  Score=21.50  Aligned_cols=21  Identities=14%  Similarity=0.251  Sum_probs=18.6

Q ss_pred             CCceEEEEEEeecCCCceEec
Q psy1222           3 DGRVLVGTFLCTDRDANVILG   23 (60)
Q Consensus         3 dgR~~~G~l~~~D~~~NlvL~   23 (60)
                      ++..+.|++.++|....|++.
T Consensus       280 ~~~~~~G~~~gi~~~G~L~i~  300 (319)
T PRK11886        280 GDKEISGIARGIDEQGALLLE  300 (319)
T ss_pred             CCcEEEEEEEEECCCceEEEE
Confidence            456799999999999999995


No 78 
>PF02707 MOSP_N:  Major Outer Sheath Protein N-terminal region;  InterPro: IPR003857 This is a family of spirochete major outer sheath protein N-terminal regions. These proteins are present on the bacterial cell surface. In Treponema denticola the major outer sheath protein (Msp) binds immobilized laminin and fibronectin supporting the hypothesis that Msp mediates the extracellular matrix binding activity of T. denticola [].
Probab=35.55  E-value=29  Score=22.39  Aligned_cols=16  Identities=13%  Similarity=0.152  Sum_probs=14.0

Q ss_pred             eEEEEEEeecCCCceE
Q psy1222           6 VLVGTFLCTDRDANVI   21 (60)
Q Consensus         6 ~~~G~l~~~D~~~Nlv   21 (60)
                      .++.+|+||+.+|+|-
T Consensus        31 s~eAtLh~ygaYltig   46 (204)
T PF02707_consen   31 SIEATLHCYGAYLTIG   46 (204)
T ss_pred             eEEEEEEEEeeEEEec
Confidence            5889999999999874


No 79 
>PRK14638 hypothetical protein; Provisional
Probab=35.38  E-value=39  Score=20.35  Aligned_cols=21  Identities=14%  Similarity=0.395  Sum_probs=16.7

Q ss_pred             CCCceEEEEEEeecCCCceEec
Q psy1222           2 TDGRVLVGTFLCTDRDANVILG   23 (60)
Q Consensus         2 ~dgR~~~G~l~~~D~~~NlvL~   23 (60)
                      .+++.|+|+|.++|.. ++.|.
T Consensus       108 ~~~k~~~G~L~~~~~~-~i~l~  128 (150)
T PRK14638        108 KDGKTFIGRIESFVDG-TITIS  128 (150)
T ss_pred             CCCcEEEEEEEEEeCC-EEEEE
Confidence            4789999999999864 46664


No 80 
>TIGR02037 degP_htrA_DO periplasmic serine protease, Do/DeqQ family. This family consists of a set proteins various designated DegP, heat shock protein HtrA, and protease DO. The ortholog in Pseudomonas aeruginosa is designated MucD and is found in an operon that controls mucoid phenotype. This family also includes the DegQ (HhoA) paralog in E. coli which can rescue a DegP mutant, but not the smaller DegS paralog, which cannot. Members of this family are located in the periplasm and have separable functions as both protease and chaperone. Members have a trypsin domain and two copies of a PDZ domain. This protein protects bacteria from thermal and other stresses and may be important for the survival of bacterial pathogens.// The chaperone function is dominant at low temperatures, whereas the proteolytic activity is turned on at elevated temperatures.
Probab=35.28  E-value=55  Score=22.49  Aligned_cols=26  Identities=15%  Similarity=0.339  Sum_probs=22.0

Q ss_pred             CCCCceEEEEEEeecCCCceEecccc
Q psy1222           1 MTDGRVLVGTFLCTDRDANVILGSCG   26 (60)
Q Consensus         1 l~dgR~~~G~l~~~D~~~NlvL~~~~   26 (60)
                      +.||+.+.+.+.++|...+|.|=...
T Consensus        88 ~~~~~~~~a~vv~~d~~~DlAllkv~  113 (428)
T TIGR02037        88 LSDGREFKAKLVGKDPRTDIAVLKID  113 (428)
T ss_pred             eCCCCEEEEEEEEecCCCCEEEEEec
Confidence            35899999999999999998876554


No 81 
>PF05413 Peptidase_C34:  Putative closterovirus papain-like endopeptidase;  InterPro: IPR008744 RNA-directed RNA polymerase (RdRp) (2.7.7.48 from EC) is an essential protein encoded in the genomes of all RNA containing viruses with no DNA stage [, ]. It catalyses synthesis of the RNA strand complementary to a given RNA template, but the precise molecular mechanism remains unclear. The postulated RNA replication process is a two-step mechanism. First, the initiation step of RNA synthesis begins at or near the 3' end of the RNA template by means of a primer-independent (de novo) mechanism. The de novo initiation consists in the addition of a nucleotide tri-phosphate (NTP) to the 3'-OH of the first initiating NTP. During the following so-called elongation phase, this nucleotidyl transfer reaction is repeated with subsequent NTPs to generate the complementary RNA product [].  All the RNA-directed RNA polymerases, and many DNA-directed polymerases, employ a fold whose organisation has been likened to the shape of a right hand with three subdomains termed fingers, palm and thumb []. Only the catalytic palm subdomain, composed of a four-stranded antiparallel beta-sheet with two alpha-helices, is well conserved among all of these enzymes. In RdRp, the palm subdomain comprises three well conserved motifs (A, B and C). Motif A (D-x(4,5)-D) and motif C (GDD) are spatially juxtaposed; the Asp residues of these motifs are implied in the binding of Mg2+ and/or Mn2+. The Asn residue of motif B is involved in selection of ribonucleoside triphosphates over dNTPs and thus determines whether RNA is synthesised rather than DNA []. The domain organisation [] and the 3D structure of the catalytic centre of a wide range of RdPp's, even those with a low overall sequence homology, are conserved. The catalytic centre is formed by several motifs containing a number of conserved amino acid residues. There are 4 superfamilies of viruses that cover all RNA containing viruses with no DNA stage: Viruses containing positive-strand RNA or double-strand RNA, except retroviruses and Birnaviridae: viral RNA-directed RNA polymerases including all positive-strand RNA viruses with no DNA stage, double-strand RNA viruses, and the Cystoviridae, Reoviridae, Hypoviridae, Partitiviridae, Totiviridae families. Mononegavirales (negative-strand RNA viruses with non-segmented genomes). Negative-strand RNA viruses with segmented genomes, i.e. Orthomyxoviruses (including influenza A, B, and C viruses, Thogotoviruses, and the infectious salmon anemia virus), Arenaviruses, Bunyaviruses, Hantaviruses, Nairoviruses, Phleboviruses, Tenuiviruses and Tospoviruses. Birnaviridae family of dsRNA viruses.  The RNA-directed RNA polymerases in the first of the above superfamilies can be divided into the following three subgroups: All positive-strand RNA eukaryotic viruses with no DNA stage. All RNA-containing bacteriophages -there are two families of RNA-containing bacteriophages: Leviviridae (positive ssRNA phages) and Cystoviridae (dsRNA phages). Reoviridae family of dsRNA viruses.   This signature is found in the RNA-direct RNA polymerase of apple chlorotic leaf spot virus and cherry mottle virus.; GO: 0003723 RNA binding, 0003968 RNA-directed RNA polymerase activity, 0005524 ATP binding, 0019079 viral genome replication
Probab=34.50  E-value=17  Score=20.34  Aligned_cols=15  Identities=27%  Similarity=0.474  Sum_probs=12.2

Q ss_pred             hheeeeeeeecCCCC
Q psy1222          44 EARLLGLVMVPGQHI   58 (60)
Q Consensus        44 ~~r~lG~v~irG~~I   58 (60)
                      .--++|.+++||+|-
T Consensus        74 ~Gl~~Gr~~LRGNHF   88 (92)
T PF05413_consen   74 IGLPLGRMLLRGNHF   88 (92)
T ss_pred             ccCchhheeecccce
Confidence            456789999999984


No 82 
>PF11607 DUF3247:  Protein of unknown function (DUF3247);  InterPro: IPR021649  This family of proteins is the protein product of the gene XC5848 from Xanthomonas campestris. The protein has no known function however its structure has been determined. The protein adopts a Lsm fold however differences with the fold were observed at the N-terminal and internal regions []. ; PDB: 2E12_B.
Probab=34.22  E-value=29  Score=19.92  Aligned_cols=11  Identities=45%  Similarity=0.809  Sum_probs=8.6

Q ss_pred             CCCCceEEEEE
Q psy1222           1 MTDGRVLVGTF   11 (60)
Q Consensus         1 l~dgR~~~G~l   11 (60)
                      |+||+.+.|++
T Consensus        35 L~DGs~l~Gtv   45 (101)
T PF11607_consen   35 LDDGSMLRGTV   45 (101)
T ss_dssp             ETTS-EEEEEE
T ss_pred             EcCCCeeeeee
Confidence            57999999986


No 83 
>PF12869 tRNA_anti-like:  tRNA_anti-like;  InterPro: IPR024422 The function of the proteins in this entry is not known, but they contain a novel variant of the nucleic acid-binding OB fold [].; PDB: 3F1Z_I.
Probab=33.05  E-value=47  Score=18.99  Aligned_cols=22  Identities=18%  Similarity=0.209  Sum_probs=9.4

Q ss_pred             ceEEEEEEeecCCCceEecccc
Q psy1222           5 RVLVGTFLCTDRDANVILGSCG   26 (60)
Q Consensus         5 R~~~G~l~~~D~~~NlvL~~~~   26 (60)
                      -.+.|++.++|-..++.|++|.
T Consensus       123 Vti~G~~~g~~~~~~v~l~~c~  144 (144)
T PF12869_consen  123 VTIKGICTGYSLMGVVMLDDCQ  144 (144)
T ss_dssp             EEEEEE-----SSS-EEEE---
T ss_pred             EEEEEEEEeeecCCcEEeeccC
Confidence            3578999999845678888773


No 84 
>PF10622 Ehbp:  Energy-converting hydrogenase B subunit P (EhbP);  InterPro: IPR019597  Ehb (energy-converting hydrogenase B) is an methanogenic archaeal enzyme that functions in one of the metabolic pathways involved in methanol reduction to methane. This entry contains subunit P of Ehb. 
Probab=32.64  E-value=38  Score=18.56  Aligned_cols=39  Identities=31%  Similarity=0.306  Sum_probs=20.2

Q ss_pred             CCceEecccccccCccccccccccchhhheeeeeeeecC
Q psy1222          17 DANVILGSCGEYLSPEVFESKEENGAQEARLLGLVMVPG   55 (60)
Q Consensus        17 ~~NlvL~~~~E~~~~~~~~~~~~~~~~~~r~lG~v~irG   55 (60)
                      |-|+|.-|-.+-...-+-..-+++=-++.|.||+.++|=
T Consensus        20 yRNvIV~Npt~EpIKidvPv~d~~WIE~Hr~LGL~vvPv   58 (78)
T PF10622_consen   20 YRNVIVGNPTDEPIKIDVPVYDEEWIEEHRKLGLIVVPV   58 (78)
T ss_pred             cccEEEeCCCCCCEEeeccccCHHHHHHHHhCCeEEEec
Confidence            468887765543211100001111135788999999873


No 85 
>PRK14639 hypothetical protein; Provisional
Probab=31.61  E-value=50  Score=19.67  Aligned_cols=21  Identities=19%  Similarity=0.431  Sum_probs=16.6

Q ss_pred             CCCceEEEEEEeecCCCceEec
Q psy1222           2 TDGRVLVGTFLCTDRDANVILG   23 (60)
Q Consensus         2 ~dgR~~~G~l~~~D~~~NlvL~   23 (60)
                      .+++.|.|+|.++|.. ++.|.
T Consensus        96 ~~~~~~~G~L~~~~~~-~i~l~  116 (140)
T PRK14639         96 NEKEKFEGKIVSVDDE-NITLE  116 (140)
T ss_pred             CCCcEEEEEEEEEeCC-EEEEE
Confidence            4689999999999885 46553


No 86 
>PF05989 Chordopox_A35R:  Chordopoxvirus A35R protein;  InterPro: IPR009247 This family consists of several Chordopoxvirus sequences homologous to the Vaccinia virus A35R protein. The function of this family is unknown.
Probab=31.54  E-value=36  Score=21.44  Aligned_cols=21  Identities=14%  Similarity=0.309  Sum_probs=16.8

Q ss_pred             EEEEEEeecCCCceEeccccc
Q psy1222           7 LVGTFLCTDRDANVILGSCGE   27 (60)
Q Consensus         7 ~~G~l~~~D~~~NlvL~~~~E   27 (60)
                      -.+.+.|||++.++.+++-..
T Consensus        93 ~n~~iiccD~~~~l~i~~k~q  113 (176)
T PF05989_consen   93 KNSFIICCDKDPKLSIDNKFQ  113 (176)
T ss_pred             CCcEEEEecCcceEEECCCcc
Confidence            356789999999999986543


No 87 
>PRK14633 hypothetical protein; Provisional
Probab=30.72  E-value=58  Score=19.59  Aligned_cols=21  Identities=24%  Similarity=0.317  Sum_probs=16.5

Q ss_pred             CCCceEEEEEEeecCCCceEec
Q psy1222           2 TDGRVLVGTFLCTDRDANVILG   23 (60)
Q Consensus         2 ~dgR~~~G~l~~~D~~~NlvL~   23 (60)
                      .+.+.|.|+|.+++.. ++.|.
T Consensus       106 ~~~~~~~G~L~~v~~~-~i~l~  126 (150)
T PRK14633        106 GSQTKFKGVLERVEGN-NVILN  126 (150)
T ss_pred             CCcEEEEEEEEEEeCC-EEEEE
Confidence            4679999999999875 46554


No 88 
>PRK02001 hypothetical protein; Validated
Probab=30.06  E-value=54  Score=19.90  Aligned_cols=21  Identities=19%  Similarity=0.526  Sum_probs=16.7

Q ss_pred             CCCceEEEEEEeecCCCceEec
Q psy1222           2 TDGRVLVGTFLCTDRDANVILG   23 (60)
Q Consensus         2 ~dgR~~~G~l~~~D~~~NlvL~   23 (60)
                      .+++.|.|+|.++|.. ++.|.
T Consensus        98 ~~~~~~~G~L~~~~~~-~i~l~  118 (152)
T PRK02001         98 KNGKKIEGELKSADEN-DITLE  118 (152)
T ss_pred             CCCCEEEEEEEEEeCC-EEEEE
Confidence            4789999999999975 45553


No 89 
>PRK14640 hypothetical protein; Provisional
Probab=29.87  E-value=91  Score=18.74  Aligned_cols=21  Identities=19%  Similarity=0.300  Sum_probs=16.5

Q ss_pred             CCCceEEEEEEeecCCCceEec
Q psy1222           2 TDGRVLVGTFLCTDRDANVILG   23 (60)
Q Consensus         2 ~dgR~~~G~l~~~D~~~NlvL~   23 (60)
                      .+.+.|.|+|.++|.. ++.|.
T Consensus       109 ~~~k~~~G~L~~v~~~-~v~l~  129 (152)
T PRK14640        109 NNRRKFKGVIKAVQGD-MITLT  129 (152)
T ss_pred             CCceEEEEEEEEEeCC-EEEEE
Confidence            4679999999999875 46664


No 90 
>PRK14645 hypothetical protein; Provisional
Probab=29.71  E-value=57  Score=19.82  Aligned_cols=20  Identities=20%  Similarity=0.363  Sum_probs=15.9

Q ss_pred             CCceEEEEEEeecCCCceEec
Q psy1222           3 DGRVLVGTFLCTDRDANVILG   23 (60)
Q Consensus         3 dgR~~~G~l~~~D~~~NlvL~   23 (60)
                      +++.|.|+|.++|.. .+.|.
T Consensus       110 ~~k~~~G~L~~~~d~-~i~l~  129 (154)
T PRK14645        110 PGENFTGRIKAVSGD-QVTFD  129 (154)
T ss_pred             CCeEEEEEEEEEeCC-EEEEE
Confidence            579999999999875 46554


No 91 
>PRK08330 biotin--protein ligase; Provisional
Probab=29.42  E-value=88  Score=19.74  Aligned_cols=23  Identities=30%  Similarity=0.267  Sum_probs=18.8

Q ss_pred             CCceE-EEEEEeecCCCceEeccc
Q psy1222           3 DGRVL-VGTFLCTDRDANVILGSC   25 (60)
Q Consensus         3 dgR~~-~G~l~~~D~~~NlvL~~~   25 (60)
                      ++..+ .|++.++|....|++...
T Consensus       196 ~~~~~~~G~~~gI~~~G~L~v~~~  219 (236)
T PRK08330        196 DGEILVEGIAEDIDEFGALILRLD  219 (236)
T ss_pred             CCcEEEEEEEEEECCCCEEEEEEC
Confidence            45665 699999999999999744


No 92 
>PRK14643 hypothetical protein; Provisional
Probab=26.88  E-value=97  Score=18.99  Aligned_cols=17  Identities=6%  Similarity=0.003  Sum_probs=13.9

Q ss_pred             CCCceEEEEEEeecCCC
Q psy1222           2 TDGRVLVGTFLCTDRDA   18 (60)
Q Consensus         2 ~dgR~~~G~l~~~D~~~   18 (60)
                      .+.+.|.|+|.++|...
T Consensus       116 ~g~k~~~G~L~~~~~~~  132 (164)
T PRK14643        116 KKVKEFEGYVTKYNVNT  132 (164)
T ss_pred             CCceEEEEEEEEEeCCc
Confidence            35689999999998764


No 93 
>PRK13325 bifunctional biotin--[acetyl-CoA-carboxylase] ligase/pantothenate kinase; Reviewed
Probab=26.75  E-value=94  Score=22.79  Aligned_cols=22  Identities=23%  Similarity=0.228  Sum_probs=19.0

Q ss_pred             CCceEEEEEEeecCCCceEecc
Q psy1222           3 DGRVLVGTFLCTDRDANVILGS   24 (60)
Q Consensus         3 dgR~~~G~l~~~D~~~NlvL~~   24 (60)
                      +++.+.|+..++|....|+|..
T Consensus       287 ~~~~~~Gi~~GId~~G~L~l~~  308 (592)
T PRK13325        287 GETVFEGTVKGVDGQGVLHLET  308 (592)
T ss_pred             CCcEEEEEEEEECCCCEEEEEE
Confidence            4457999999999999999964


No 94 
>cd01734 YlxS_C YxlS is a Bacillus subtilis gene of unknown function with two domains that each have an alpha/beta fold.  The N-terminal domain is composed of two alpha-helices and a three-stranded beta-sheet, while the C-terminal domain is composed of one alpha-helix and a five-stranded beta-sheet.  This CD represents the C-terminal domain which has a fold similar to the Sm fold of proteins like Sm-D3.
Probab=26.57  E-value=1e+02  Score=16.41  Aligned_cols=19  Identities=37%  Similarity=0.503  Sum_probs=14.5

Q ss_pred             CceEEEEEEeecCCCceEec
Q psy1222           4 GRVLVGTFLCTDRDANVILG   23 (60)
Q Consensus         4 gR~~~G~l~~~D~~~NlvL~   23 (60)
                      .+.+.|.|.++|.. +++|.
T Consensus        39 ~~~~~G~L~~~~~~-~v~l~   57 (83)
T cd01734          39 QKEFEGTLLGVDDD-TVTLE   57 (83)
T ss_pred             eEEEEEEEEeEeCC-EEEEE
Confidence            36899999999885 45553


No 95 
>COG1912 Uncharacterized conserved protein [Function unknown]
Probab=26.23  E-value=90  Score=20.97  Aligned_cols=21  Identities=33%  Similarity=0.411  Sum_probs=18.0

Q ss_pred             CCceEEEEEEeecCCCceEec
Q psy1222           3 DGRVLVGTFLCTDRDANVILG   23 (60)
Q Consensus         3 dgR~~~G~l~~~D~~~NlvL~   23 (60)
                      ++-.+.|+..-+|+|.|++..
T Consensus       170 ~~~~v~g~V~~iD~FGNv~TN  190 (268)
T COG1912         170 EDGGVKGTVIYVDRFGNVITN  190 (268)
T ss_pred             cCCeEEEEEEEECCcCceeec
Confidence            456789999999999999975


No 96 
>PF01398 JAB:  JAB1/Mov34/MPN/PAD-1 ubiquitin protease;  InterPro: IPR000555 Members of this family are found in proteasome regulatory subunits, eukaryotic initiation factor 3 (eIF3) subunits and regulators of transcription factors. This family is also known as the MPN domain [] and PAD-1-like domain []. It has been shown that this domain occurs in prokaryotes []. Mov34 proteins act as the regulatory subunit of the 26 proteasome, which is involved in the ATP-dependent degradation of ubiquitinated proteins. The function of this domain is unclear, but it is found in the N terminus of the proteasome regulatory subunits, eukaryotic initiation factor 3 (eIF3) subunits and regulators of transcription factors. A number of the proteins associated with this family belong to MEROPS peptidase family M67 (clan M-). This includes the Poh1 peptidase of Saccharomyces cerevisiae (Baker's yeast) which is a component of the 19S proteasome regulatory particle.; GO: 0005515 protein binding; PDB: 2ZNV_D 2ZNR_A 4E0Q_A 2P87_A 2P8R_A 2O96_B 2O95_A 3RZU_F 3RZV_A.
Probab=25.03  E-value=87  Score=17.15  Aligned_cols=26  Identities=15%  Similarity=0.133  Sum_probs=21.9

Q ss_pred             eEEEEEEeecCCC-ceEecccccccCc
Q psy1222           6 VLVGTFLCTDRDA-NVILGSCGEYLSP   31 (60)
Q Consensus         6 ~~~G~l~~~D~~~-NlvL~~~~E~~~~   31 (60)
                      ++.|.|.|+.... .+.+.+|.+....
T Consensus        27 ~v~G~LlG~~~~~~~v~I~~~f~~p~~   53 (114)
T PF01398_consen   27 EVIGLLLGTQDGDNTVEITNSFPVPHS   53 (114)
T ss_dssp             EEEEEEEEEEETT-EEEEEEEEEESEE
T ss_pred             EEEEEEEEEecCceEEEEEEEEEeeEe
Confidence            7899999998888 8889999886554


No 97 
>PF02576 DUF150:  Uncharacterised BCR, YhbC family COG0779;  InterPro: IPR003728 The RimP protein facilitates maturation of the 30S ribsomal subunit, and is required for the efficient production of translationally competent ribosmomes [].; PDB: 1IB8_A.
Probab=23.77  E-value=1.5e+02  Score=17.26  Aligned_cols=19  Identities=21%  Similarity=0.385  Sum_probs=14.5

Q ss_pred             CCceEEEEEEeecCCCceEe
Q psy1222           3 DGRVLVGTFLCTDRDANVIL   22 (60)
Q Consensus         3 dgR~~~G~l~~~D~~~NlvL   22 (60)
                      +.+.|.|+|.++|. -.++|
T Consensus       100 ~~~~~~G~L~~~~~-~~i~l  118 (141)
T PF02576_consen  100 GRKEFEGKLLEVDE-DEITL  118 (141)
T ss_dssp             S-SEEEEEEEEEET-TEEEE
T ss_pred             CcEEEEEEEEEEeC-CEEEE
Confidence            45789999999998 44666


No 98 
>cd01403 Cyt_c_Oxidase_VIIb Cytochrome C oxidase chain VIIb. Cytochrome c oxidase (CcO), the terminal oxidase in the respiratory chains of eukaryotes and most bacteria, is a multi-chain transmembrane protein located in the inner membrane of mitochondria and the cell membrane of prokaryotes. It catalyzes the reduction of O2 and simultaneously pumps protons across the membrane.  The number of subunits varies from three to five in bacteria and up to 13 in mammalian mitochondria. Subunits I, II, and III of mammalian CcO are encoded within the mitochondrial genome and the remaining 10 subunits are encoded within the nuclear genome. The VIIb subunit is found only in eukaryotes and its specific function remains unclear. A rare polymorphism of the CcO VIIb gene may be associated with the high risk of nasopharyngeal carcinoma in a Cantonese family.
Probab=23.61  E-value=40  Score=17.06  Aligned_cols=14  Identities=29%  Similarity=0.413  Sum_probs=10.1

Q ss_pred             cCCCceEecccccc
Q psy1222          15 DRDANVILGSCGEY   28 (60)
Q Consensus        15 D~~~NlvL~~~~E~   28 (60)
                      ||+.|++|-.-.-+
T Consensus         7 dKYGn~~l~~Ga~F   20 (51)
T cd01403           7 DKYGNAVLISGATF   20 (51)
T ss_pred             hhcCceEEecccch
Confidence            88999998754433


No 99 
>PRK08477 biotin--protein ligase; Provisional
Probab=23.30  E-value=1.2e+02  Score=19.29  Aligned_cols=24  Identities=13%  Similarity=0.153  Sum_probs=19.9

Q ss_pred             CCCceEEEEEEeecCCCceEeccc
Q psy1222           2 TDGRVLVGTFLCTDRDANVILGSC   25 (60)
Q Consensus         2 ~dgR~~~G~l~~~D~~~NlvL~~~   25 (60)
                      .+++.+.|+..+.|...-|++.--
T Consensus       182 ~~~~~~~g~a~~I~~~G~L~v~~~  205 (211)
T PRK08477        182 IDGKLVSLKDAELLEDGSILINGK  205 (211)
T ss_pred             ECCEEEEEEEeeECCCCeEEECCE
Confidence            367889999999999999988643


No 100
>cd08057 MPN_euk_non_mb Mpr1p, Pad1p N-terminal (MPN) domains without catalytic isopeptidase activity (non metal-binding); eukaryotic. This family contains MPN (also known as Mov34, PAD-1, JAMM, JAB, MPN+) domains variants  lacking key residues in the JAB1/MPN/Mov34 metalloenzyme (JAMM) motif and are unable to coordinate a metal ion. Comparisons of key catalytic and metal binding residues explain why the MPN-containing proteins Rpn7/PSMD7, Rpn8/PSMD8, CSN6, Prp8p, and the translation initiation factor 3 subunits f and h do not show catalytic isopeptidase activity. It has been proposed that the MPN domain in these proteins has a primarily structural function. Rpn7 is known to be critical for the integrity of the 26S proteasome complex by establishing a correct lid structure. It is necessary for the incorporation/anchoring of Rpn3 and Rpn12 to the lid and essential for viability and normal mitosis. CSN6 is a highly conserved protein complex with diverse functions, including several import
Probab=20.81  E-value=1.6e+02  Score=17.33  Aligned_cols=27  Identities=11%  Similarity=0.081  Sum_probs=23.6

Q ss_pred             ceEEEEEEeecCCCceEecccccccCc
Q psy1222           5 RVLVGTFLCTDRDANVILGSCGEYLSP   31 (60)
Q Consensus         5 R~~~G~l~~~D~~~NlvL~~~~E~~~~   31 (60)
                      ..+.|.|.|+..-..+.+.||-+....
T Consensus        23 ~~v~G~LlG~~~~~~veV~nsF~lp~~   49 (157)
T cd08057          23 KRVIGVLLGYVDGDKIEVTNSFELPFD   49 (157)
T ss_pred             CeEEEEEEeEEeCCEEEEEEeEEcccc
Confidence            468899999998889999999998764


No 101
>PRK14631 hypothetical protein; Provisional
Probab=20.72  E-value=1.1e+02  Score=19.04  Aligned_cols=21  Identities=14%  Similarity=0.359  Sum_probs=15.6

Q ss_pred             CCCceEEEEEEeec--CCCceEec
Q psy1222           2 TDGRVLVGTFLCTD--RDANVILG   23 (60)
Q Consensus         2 ~dgR~~~G~l~~~D--~~~NlvL~   23 (60)
                      .+.+.|.|+|.++|  .. ++.|.
T Consensus       129 ~~~k~~~G~L~~v~~~~~-~v~l~  151 (174)
T PRK14631        129 ENRRKFQAKLLAVDLENE-EIQVE  151 (174)
T ss_pred             CCceEEEEEEEEeecCCC-EEEEE
Confidence            35699999999998  53 45553


No 102
>smart00232 JAB_MPN JAB/MPN domain. Domain in Jun kinase activation domain binding protein and proteasomal subunits. Domain at Mpr1p and Pad1p N-termini. Domain of unknown function.
Probab=20.40  E-value=1.5e+02  Score=16.33  Aligned_cols=25  Identities=8%  Similarity=0.004  Sum_probs=19.9

Q ss_pred             ceEEEEEEeecCCCceEeccccccc
Q psy1222           5 RVLVGTFLCTDRDANVILGSCGEYL   29 (60)
Q Consensus         5 R~~~G~l~~~D~~~NlvL~~~~E~~   29 (60)
                      .+..|.|.|.+...++.+.++....
T Consensus        22 ~e~~G~L~G~~~~~~~~i~~~~~~p   46 (135)
T smart00232       22 EEVCGVLLGKSNKDRPEVKEVFAVP   46 (135)
T ss_pred             cEEEEEEEEEEcCCEEEEEEEEecC
Confidence            5789999999877788887776643


Done!