Diaphorina citri psyllid: psy1222


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60
MTDGRVLVGTFLCTDRDANVILGSCGEYLSPEVFESKEENGAQEARLLGLVMVPGQHIPA
cccccEEEEEEEECcccccEEEcccEEEccccccccccccccccEEEEEEEEEccccccc
MTDGRVLVGTFLCTDRDANVILGSCGEYLSPE**************LLGLVMVPGQHIP*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTDGRVLVGTFLCTDRDANVILGSCGEYLSPEVFESKEENGAQEARLLGLVMVPGQHIPA

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
LSM domain-containing protein 1 Component of the N-terminal acetyltransferase C (NatC) complex which may catalyze acetylation of N-terminal methionine residues.confidentQ9D2U5
LSM domain-containing protein 1 confidentA4IGZ4
LSM domain-containing protein 1 confidentA2BIG9

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0031981 [CC]nuclear lumenprobableGO:0005575, GO:0043231, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422
GO:0044444 [CC]cytoplasmic partprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424
GO:0030532 [CC]small nuclear ribonucleoprotein complexprobableGO:0005575, GO:0032991, GO:0043231, GO:0005634, GO:0044464, GO:0005623, GO:0030529, GO:0044446, GO:0043229, GO:0044428, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0044422

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3PGW, chain B
Confidence level:very confident
Coverage over the Query: 1-60
View the alignment between query and template
View the model in PyMOL