BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= psy12239
         (785 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|1X3M|A Chain A, Crystal Structure Of Adp Bound Propionate Kinase (tdcd)
           From Salmonella Typhimurium
 pdb|1X3N|A Chain A, Crystal Structure Of Amppnp Bound Propionate Kinase (Tdcd)
           From Salmonella Typhimurium
 pdb|2E1Y|A Chain A, Crystal Structure Of Propionate Kinase (Tdcd) From
           Salmonella Typhimurium
 pdb|2E1Z|A Chain A, Crystal Structure Of Salmonella Typhimurium Propionate
           Kinase (Tdcd) In Complex With Diadenosine Tetraphosphate
           (Ap4a) Obtained After Co-Crystallization With Atp
 pdb|2E20|A Chain A, Crystal Structure Of Salmonella Typhimurium Propionate
           Kinase (Tdcd) In Complex With Diadenosine Tetraphosphate
           (Ap4a)
          Length = 415

 Score = 29.6 bits (65), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 19/74 (25%), Positives = 36/74 (48%)

Query: 382 FLEAIRMKFVGFALRGDRDSLIGLPHPIHESVKVLKQHIYTSLSEVHIQKEEEINRSPMS 441
           F+  I     G A    R   I     I E+  +++Q +   L  + +  + E+N+ P S
Sbjct: 313 FVHRIARHIAGHAASLHRLDGIIFTGGIGENSVLIRQLVIEHLGVLGLTLDVEMNKQPNS 372

Query: 442 LGEEIIGSSPTEML 455
            GE II ++P++++
Sbjct: 373 HGERIISANPSQVI 386


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.319    0.135    0.398 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 21,631,771
Number of Sequences: 62578
Number of extensions: 850362
Number of successful extensions: 1705
Number of sequences better than 100.0: 7
Number of HSP's better than 100.0 without gapping: 5
Number of HSP's successfully gapped in prelim test: 2
Number of HSP's that attempted gapping in prelim test: 1699
Number of HSP's gapped (non-prelim): 8
length of query: 785
length of database: 14,973,337
effective HSP length: 107
effective length of query: 678
effective length of database: 8,277,491
effective search space: 5612138898
effective search space used: 5612138898
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 55 (25.8 bits)