Query         psy12257
Match_columns 145
No_of_seqs    108 out of 357
Neff          5.6 
Searched_HMMs 46136
Date          Fri Aug 16 22:44:27 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy12257.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/12257hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF03227 GILT:  Gamma interfero 100.0 4.8E-41   1E-45  244.0  10.5  104   32-143     1-106 (108)
  2 KOG3160|consensus              100.0 4.4E-37 9.5E-42  248.6   9.5  131    6-144    11-146 (220)
  3 PF13462 Thioredoxin_4:  Thiore  95.1   0.077 1.7E-06   38.8   5.9   44   27-71      9-54  (162)
  4 cd03019 DsbA_DsbA DsbA family,  92.7    0.19 4.1E-06   37.4   4.1   44   29-73     14-57  (178)
  5 cd03023 DsbA_Com1_like DsbA fa  92.6    0.31 6.6E-06   35.0   5.1   41   29-71      4-44  (154)
  6 PF14595 Thioredoxin_9:  Thiore  91.5    0.44 9.6E-06   35.5   4.9   44   27-72     38-81  (129)
  7 cd02972 DsbA_family DsbA famil  89.5    0.62 1.3E-05   30.3   3.8   41   34-75      1-41  (98)
  8 PRK11657 dsbG disulfide isomer  86.4     1.7 3.6E-05   35.7   5.2   43   28-73    115-157 (251)
  9 PF13905 Thioredoxin_8:  Thiore  85.6       3 6.5E-05   27.8   5.4   41   31-72      2-44  (95)
 10 TIGR00411 redox_disulf_1 small  84.0     2.6 5.6E-05   27.2   4.4   29   32-61      1-29  (82)
 11 cd03020 DsbA_DsbC_DsbG DsbA fa  83.0     2.5 5.4E-05   32.7   4.6   43   28-75     75-117 (197)
 12 cd02973 TRX_GRX_like Thioredox  82.9     3.1 6.6E-05   26.2   4.3   17   32-48      1-17  (67)
 13 KOG2501|consensus               81.1     1.2 2.6E-05   34.8   2.1   79   14-95     15-96  (157)
 14 cd03026 AhpF_NTD_C TRX-GRX-lik  78.1     5.2 0.00011   27.6   4.5   41   28-70     10-50  (89)
 15 PF01323 DSBA:  DSBA-like thior  75.5     7.1 0.00015   29.2   5.0   39   33-73      1-39  (193)
 16 TIGR02190 GlrX-dom Glutaredoxi  69.9     3.2 6.9E-05   27.6   1.7   21   29-49      5-25  (79)
 17 cd02066 GRX_family Glutaredoxi  69.9       4 8.7E-05   25.0   2.1   17   33-49      1-17  (72)
 18 cd02964 TryX_like_family Trypa  69.8     9.9 0.00021   27.2   4.4   40   30-70     17-57  (132)
 19 TIGR02200 GlrX_actino Glutared  68.0     3.8 8.3E-05   26.0   1.7   16   33-48      1-16  (77)
 20 cd02995 PDI_a_PDI_a'_C PDIa fa  66.5      17 0.00038   24.0   4.9   36   30-66     18-53  (104)
 21 PF13743 Thioredoxin_5:  Thiore  66.4      12 0.00025   28.9   4.4  105   36-145     2-116 (176)
 22 KOG3425|consensus               66.3      11 0.00025   28.5   4.1   36   38-74     41-76  (128)
 23 cd03024 DsbA_FrnE DsbA family,  66.3      11 0.00024   28.5   4.3   41   34-75      1-43  (201)
 24 cd03025 DsbA_FrnE_like DsbA fa  66.2     8.6 0.00019   28.9   3.6   42   32-74      1-42  (193)
 25 cd02949 TRX_NTR TRX domain, no  66.0      21 0.00045   24.1   5.2   35   27-62     10-44  (97)
 26 cd03419 GRX_GRXh_1_2_like Glut  65.4     5.6 0.00012   25.7   2.2   17   33-49      1-17  (82)
 27 PF13728 TraF:  F plasmid trans  64.6     7.4 0.00016   31.3   3.1   38   30-72    120-157 (215)
 28 cd03012 TlpA_like_DipZ_like Tl  64.6      19 0.00042   25.4   5.0   41   29-71     22-62  (126)
 29 PRK10877 protein disulfide iso  63.6      19 0.00041   29.1   5.3   42   28-73    105-146 (232)
 30 PF11287 DUF3088:  Protein of u  62.5     3.7 8.1E-05   30.4   0.9   34   41-76     23-56  (112)
 31 PF00462 Glutaredoxin:  Glutare  61.3     7.7 0.00017   24.0   2.2   17   34-50      1-17  (60)
 32 PRK13703 conjugal pilus assemb  61.3     7.3 0.00016   32.4   2.5   38   30-72    143-180 (248)
 33 TIGR02180 GRX_euk Glutaredoxin  60.9     6.3 0.00014   25.4   1.8   16   34-49      1-16  (84)
 34 cd03027 GRX_DEP Glutaredoxin (  60.5     7.4 0.00016   25.1   2.0   17   33-49      2-18  (73)
 35 cd03418 GRX_GRXb_1_3_like Glut  59.5     6.2 0.00014   25.2   1.5   17   33-49      1-17  (75)
 36 PF00085 Thioredoxin:  Thioredo  57.0      31 0.00068   22.6   4.7   33   29-62     16-48  (103)
 37 PHA03050 glutaredoxin; Provisi  56.1     7.6 0.00016   27.9   1.6   17   33-49     14-30  (108)
 38 TIGR02189 GlrX-like_plant Glut  56.1     7.6 0.00017   27.2   1.6   18   33-50      9-26  (99)
 39 TIGR02196 GlrX_YruB Glutaredox  55.8       7 0.00015   24.1   1.2   15   34-48      2-16  (74)
 40 cd03009 TryX_like_TryX_NRX Try  55.6      33 0.00071   24.2   4.9   41   30-71     18-59  (131)
 41 PRK13728 conjugal transfer pro  55.1      24 0.00052   28.0   4.4   34   34-72     73-106 (181)
 42 PRK11200 grxA glutaredoxin 1;   53.7      11 0.00023   25.1   2.0   17   33-49      2-18  (85)
 43 cd02969 PRX_like1 Peroxiredoxi  53.6      31 0.00067   25.7   4.7   41   29-71     24-64  (171)
 44 cd01659 TRX_superfamily Thiore  53.5      30 0.00065   19.1   3.7   35   34-70      1-35  (69)
 45 TIGR02181 GRX_bact Glutaredoxi  52.7     8.6 0.00019   25.0   1.3   16   34-49      1-16  (79)
 46 TIGR02739 TraF type-F conjugat  52.7      12 0.00027   31.1   2.6   38   30-72    150-187 (256)
 47 TIGR01126 pdi_dom protein disu  52.7      33 0.00072   22.4   4.3   21   29-49     12-32  (102)
 48 COG1651 DsbG Protein-disulfide  52.6      27 0.00057   27.6   4.4   41   30-71     84-125 (244)
 49 cd02976 NrdH NrdH-redoxin (Nrd  52.3      11 0.00025   23.0   1.8   16   33-48      1-16  (73)
 50 cd03008 TryX_like_RdCVF Trypar  52.1      38 0.00082   25.7   5.0   32   30-62     25-56  (146)
 51 cd02950 TxlA TRX-like protein   49.7      44 0.00096   24.7   5.0   36   28-64     18-53  (142)
 52 cd03029 GRX_hybridPRX5 Glutare  48.7      15 0.00032   23.5   2.0   17   33-49      2-18  (72)
 53 PRK09381 trxA thioredoxin; Pro  47.7      58  0.0013   22.1   5.0   34   28-62     19-52  (109)
 54 COG0695 GrxC Glutaredoxin and   47.7      12 0.00027   25.2   1.5   17   33-49      2-18  (80)
 55 cd02961 PDI_a_family Protein D  47.6      63  0.0014   20.5   5.0   30   30-60     15-44  (101)
 56 cd02970 PRX_like2 Peroxiredoxi  47.4      51  0.0011   23.2   4.8   41   30-72     24-64  (149)
 57 TIGR02183 GRXA Glutaredoxin, G  46.8      13 0.00029   25.0   1.6   16   34-49      2-17  (86)
 58 PF00578 AhpC-TSA:  AhpC/TSA fa  46.2      45 0.00099   22.8   4.3   40   30-70     25-66  (124)
 59 cd03002 PDI_a_MPD1_like PDI fa  44.9      62  0.0013   21.7   4.8   22   28-49     16-37  (109)
 60 cd02968 SCO SCO (an acronym fo  44.8      53  0.0011   23.1   4.6   34   29-63     21-55  (142)
 61 TIGR01068 thioredoxin thioredo  44.5      66  0.0014   20.8   4.8   33   28-61     12-44  (101)
 62 PTZ00051 thioredoxin; Provisio  44.1      75  0.0016   20.9   5.0   31   28-59     16-46  (98)
 63 cd02966 TlpA_like_family TlpA-  43.9      77  0.0017   20.4   5.0   31   30-61     19-49  (116)
 64 PRK10638 glutaredoxin 3; Provi  43.6      23 0.00049   23.5   2.3   17   33-49      3-19  (83)
 65 PRK03147 thiol-disulfide oxido  43.3      69  0.0015   23.4   5.2   32   30-62     61-92  (173)
 66 TIGR02187 GlrX_arch Glutaredox  43.1      56  0.0012   25.6   4.8   21   28-48    131-151 (215)
 67 cd03010 TlpA_like_DsbE TlpA-li  42.9      37  0.0008   23.7   3.5   20   30-49     25-44  (127)
 68 cd03001 PDI_a_P5 PDIa family,   42.8      86  0.0019   20.6   5.2   22   28-49     16-37  (103)
 69 PF08534 Redoxin:  Redoxin;  In  42.7      60  0.0013   23.1   4.7   40   29-69     27-68  (146)
 70 cd02998 PDI_a_ERp38 PDIa famil  42.3      81  0.0018   20.6   5.0   23   27-49     15-37  (105)
 71 cd03004 PDI_a_ERdj5_C PDIa fam  42.3   1E+02  0.0022   20.6   5.5   22   28-49     17-38  (104)
 72 PRK15317 alkyl hydroperoxide r  41.7      51  0.0011   29.4   4.9   21   29-49    115-135 (517)
 73 cd02992 PDI_a_QSOX PDIa family  41.3 1.1E+02  0.0024   21.5   5.8   23   28-50     17-39  (114)
 74 cd02953 DsbDgamma DsbD gamma f  41.0      60  0.0013   21.8   4.2   23   28-50      9-31  (104)
 75 TIGR01295 PedC_BrcD bacterioci  40.4      24 0.00052   25.6   2.2   22   28-49     21-42  (122)
 76 KOG1752|consensus               40.3      18 0.00039   26.1   1.5   39   33-73     15-53  (104)
 77 PTZ00256 glutathione peroxidas  40.1      65  0.0014   24.6   4.7   42   28-71     39-80  (183)
 78 cd02948 TRX_NDPK TRX domain, T  40.0 1.1E+02  0.0024   20.7   5.5   33   28-61     15-47  (102)
 79 PRK10996 thioredoxin 2; Provis  39.9      66  0.0014   23.5   4.6   34   28-62     50-83  (139)
 80 TIGR02540 gpx7 putative glutat  39.4      64  0.0014   23.6   4.4   40   30-70     22-62  (153)
 81 PF13098 Thioredoxin_2:  Thiore  39.0      65  0.0014   21.8   4.2   26   29-55      4-29  (112)
 82 cd02967 mauD Methylamine utili  38.9      84  0.0018   21.2   4.7   32   30-62     21-52  (114)
 83 cd02993 PDI_a_APS_reductase PD  38.5      86  0.0019   21.5   4.8   22   28-49     19-40  (109)
 84 PRK10329 glutaredoxin-like pro  38.4      26 0.00057   23.6   2.0   15   33-47      2-16  (81)
 85 TIGR02738 TrbB type-F conjugat  37.8      40 0.00087   25.6   3.1   19   31-49     51-69  (153)
 86 cd03022 DsbA_HCCA_Iso DsbA fam  37.8      59  0.0013   24.2   4.1   35   34-71      1-35  (192)
 87 PF13192 Thioredoxin_3:  Thiore  37.4 1.1E+02  0.0024   19.9   4.9   35   32-70      1-35  (76)
 88 cd02999 PDI_a_ERp44_like PDIa   36.3 1.2E+02  0.0026   20.8   5.2   22   28-49     16-37  (100)
 89 TIGR02194 GlrX_NrdH Glutaredox  35.5      23 0.00049   22.8   1.3   16   34-49      1-16  (72)
 90 COG2761 FrnE Predicted dithiol  35.5      67  0.0015   26.5   4.3  112   28-145     2-153 (225)
 91 cd02956 ybbN ybbN protein fami  35.3 1.3E+02  0.0028   19.7   5.1   22   28-49     10-31  (96)
 92 TIGR02740 TraF-like TraF-like   33.7      49  0.0011   27.4   3.3   38   30-72    166-203 (271)
 93 cd02997 PDI_a_PDIR PDIa family  33.6      74  0.0016   20.9   3.7   31   30-61     17-47  (104)
 94 KOG2613|consensus               33.0      34 0.00073   31.1   2.3   20   41-60    139-158 (502)
 95 cd03006 PDI_a_EFP1_N PDIa fami  32.9 1.8E+02   0.004   20.7   5.9   30   27-61     26-55  (113)
 96 cd02951 SoxW SoxW family; SoxW  32.7 1.2E+02  0.0027   21.1   4.9   20   31-50     15-34  (125)
 97 cd03040 GST_N_mPGES2 GST_N fam  32.6      32 0.00069   22.0   1.6   17   33-49      1-17  (77)
 98 cd02957 Phd_like Phosducin (Ph  32.6      73  0.0016   22.1   3.6   18   31-48     25-42  (113)
 99 COG4545 Glutaredoxin-related p  32.6      28  0.0006   24.5   1.4   16   35-50      5-20  (85)
100 TIGR03140 AhpF alkyl hydropero  31.9      98  0.0021   27.6   5.1   21   29-49    116-136 (515)
101 TIGR00385 dsbE periplasmic pro  30.0      71  0.0015   24.0   3.4   21   29-49     62-82  (173)
102 cd03003 PDI_a_ERdj5_N PDIa fam  29.8 1.7E+02  0.0037   19.4   5.2   20   29-48     17-36  (101)
103 cd02996 PDI_a_ERp44 PDIa famil  29.0 1.6E+02  0.0034   19.9   4.8   22   28-49     16-37  (108)
104 TIGR03399 RNA_3prim_cycl RNA 3  28.8 1.6E+02  0.0035   25.3   5.7   63   25-90    105-169 (326)
105 cd03011 TlpA_like_ScsD_MtbDsbE  27.8   1E+02  0.0022   21.1   3.7   29   30-59     20-48  (123)
106 cd03028 GRX_PICOT_like Glutare  27.4      42 0.00091   22.7   1.6   16   33-48      9-29  (90)
107 PF06110 DUF953:  Eukaryotic pr  27.0 1.3E+02  0.0028   22.2   4.2   34   39-73     35-68  (119)
108 cd00340 GSH_Peroxidase Glutath  25.7 1.8E+02  0.0039   21.2   4.9   39   30-71     22-60  (152)
109 cd02994 PDI_a_TMX PDIa family,  25.6      79  0.0017   21.0   2.7   24   33-61     19-42  (101)
110 smart00594 UAS UAS domain.      25.0      75  0.0016   22.6   2.6   44   28-73     25-68  (122)
111 PRK15412 thiol:disulfide inter  24.9   1E+02  0.0022   23.5   3.5   22   29-50     67-88  (185)
112 TIGR01617 arsC_related transcr  24.8      54  0.0012   23.3   1.8   16   34-49      1-16  (117)
113 cd02965 HyaE HyaE family; HyaE  24.7 1.6E+02  0.0034   21.5   4.3   21   28-48     25-47  (111)
114 PRK13675 GTP cyclohydrolase; P  24.7 1.2E+02  0.0026   25.9   4.2   24   30-53    145-168 (308)
115 cd02962 TMX2 TMX2 family; comp  24.5 1.2E+02  0.0025   23.1   3.7   21   28-48     45-65  (152)
116 cd03037 GST_N_GRX2 GST_N famil  24.5      38 0.00083   21.3   0.9   14   35-48      2-15  (71)
117 cd02975 PfPDO_like_N Pyrococcu  24.1 1.7E+02  0.0036   20.6   4.3   19   30-48     21-40  (113)
118 TIGR02661 MauD methylamine deh  24.1 1.1E+02  0.0023   23.6   3.5   28   29-57     73-100 (189)
119 cd02954 DIM1 Dim1 family; Dim1  23.8      86  0.0019   22.9   2.8   28   28-60     12-39  (114)
120 cd00874 RNA_Cyclase_Class_II R  23.4 2.4E+02  0.0053   24.2   5.8   62   26-90    104-167 (326)
121 PHA02125 thioredoxin-like prot  23.3      68  0.0015   20.7   2.0   15   34-48      2-16  (75)
122 cd02987 Phd_like_Phd Phosducin  22.6 1.5E+02  0.0032   22.8   4.0   18   31-48     84-101 (175)
123 PLN02412 probable glutathione   22.6 1.6E+02  0.0034   22.1   4.1   32   30-62     29-60  (167)
124 cd03005 PDI_a_ERp46 PDIa famil  22.6 1.7E+02  0.0038   19.0   3.9   28   33-61     19-46  (102)
125 cd02989 Phd_like_TxnDC9 Phosdu  22.0 1.1E+02  0.0023   21.6   2.9   20   29-48     21-40  (113)
126 cd02984 TRX_PICOT TRX domain,   21.7 2.4E+02  0.0052   18.3   5.0   20   30-49     14-33  (97)
127 cd03000 PDI_a_TMX3 PDIa family  21.0 2.7E+02  0.0058   18.6   5.4   31   29-60     14-44  (104)
128 TIGR00365 monothiol glutaredox  20.8      68  0.0015   22.2   1.6   16   34-49     14-34  (97)
129 COG4665 FcbT2 TRAP-type mannit  20.1      65  0.0014   25.8   1.5   23   27-49     71-93  (182)
130 PRK10606 btuE putative glutath  20.0 2.1E+02  0.0046   22.3   4.5   39   30-71     25-63  (183)

No 1  
>PF03227 GILT:  Gamma interferon inducible lysosomal thiol reductase (GILT);  InterPro: IPR004911  This family includes the two characterised human gamma-interferon-inducible lysosomal thiol reductase (GILT) sequences [, ]. It also contains several other eukaryotic putative proteins with similarity to GILT []. The aligned region contains three conserved cysteine residues. In addition, the two GILT sequences possess a C-X(2)-C motif that is shared by some of the other sequences in the family. This motif is thought to be associated with disulphide bond reduction. 
Probab=100.00  E-value=4.8e-41  Score=244.04  Aligned_cols=104  Identities=40%  Similarity=0.821  Sum_probs=92.2

Q ss_pred             eEEEEEEEeCChhhHHHHHHhhHHHH--HhccCceeEEEEeeeeceeecCCCCCcceeeeCChhhhccChHhHHHhhhhc
Q psy12257         32 AKVALYMESLCPGCHQFIKHQLYPVF--MKYSNYIQLDLIPFGNARHTKNSDGTWEFKCQHGEPECFGNLYLACATHLLQ  109 (145)
Q Consensus        32 V~V~vyyESlCPd~~~Fi~~qL~P~~--~~l~d~idl~lvPfG~a~~~~~~~g~~~f~CQHG~~EC~gN~~~aCal~~~~  109 (145)
                      |+|+||||||||||++||++||+|+|  ++++++|||+|||||||+...  +|. .|+|||||.||+||++|+|+++++ 
T Consensus         1 V~v~vyyESlCPd~~~fi~~~L~p~~~~~~~~~~~~l~lvP~G~a~~~~--~~~-~~~CqHG~~EC~gN~~q~C~l~~~-   76 (108)
T PF03227_consen    1 VNVEVYYESLCPDCRRFITNQLFPVWTYEKLSDIMNLTLVPFGNAKVSS--SGN-EFTCQHGPDECYGNKLQACALKHL-   76 (108)
T ss_pred             CEEEEEEEecCHhHHHHHHHHHHHHHHHhhccceEEEEEEEEeccEEec--CCc-eeecCCcHHHHHcCHHHHhHHHhc-
Confidence            78999999999999999999999976  789999999999999999885  443 899999999999999999999999 


Q ss_pred             CCCccccceeeeeccccCCCCchhhHHHHhhhcC
Q psy12257        110 ASRPKHLIRYYNCMASASSFSIEKDVKQVTEMGR  143 (145)
Q Consensus       110 ~~~~~~~l~fI~Cm~~~~~~~~~~~~~~c~~~~~  143 (145)
                       ++...+|+||+||+++.+++.+..   |++..+
T Consensus        77 -~~~~~~~~~i~Cm~~~~~~~~~~~---Ca~~~~  106 (108)
T PF03227_consen   77 -PDTNAALPFIACMESSQDFPKAIK---CAKKYG  106 (108)
T ss_pred             -CChhhhcCEEEEEcCCCCCchhhh---hHHhcC
Confidence             577888999999999966543333   887765


No 2  
>KOG3160|consensus
Probab=100.00  E-value=4.4e-37  Score=248.61  Aligned_cols=131  Identities=33%  Similarity=0.560  Sum_probs=106.5

Q ss_pred             cccccceeeeecccchh-h--hh-hhcCCeeEEEEEEEeCChhhHHHHHHhhHHHHHh-ccCceeEEEEeeeeceeecCC
Q psy12257          6 SDTGCQKFRYLLGKKVE-E--VS-MLRIVKAKVALYMESLCPGCHQFIKHQLYPVFMK-YSNYIQLDLIPFGNARHTKNS   80 (145)
Q Consensus         6 ~~~~~~~~~~l~~~~~~-~--~~-~~~~~kV~V~vyyESlCPd~~~Fi~~qL~P~~~~-l~d~idl~lvPfG~a~~~~~~   80 (145)
                      +-+.+..|++++..... .  ++ ....+||+|+||||||||||++||++||+|+|.. +.+++||++||||||+...  
T Consensus        11 ~~~~~~~F~c~~~~~~~~~~~~~~~~~~~~v~ItlyyEaLCPdc~~Fi~~qL~p~~~~~~~~~idl~lvPfGna~~~~--   88 (220)
T KOG3160|consen   11 SLAILSFFVCLLLFSFLLGILVAKGSQAPKVNITLYYEALCPDCSKFIRNQLYPFFDNLLPSILDLTLVPFGNAQCRN--   88 (220)
T ss_pred             cchhhheeeecchHhhhhhheeeccccCCeeEEEEEEEecCccHHHHHHHHHHHHHhhcccceeEEEEEccCCceeec--
Confidence            45677888877654443 1  22 2345699999999999999999999999999987 7999999999999999985  


Q ss_pred             CCCcceeeeCChhhhccChHhHHHhhhhcCCCccccceeeeeccccCCCCchhhHHHHhhhcCC
Q psy12257         81 DGTWEFKCQHGEPECFGNLYLACATHLLQASRPKHLIRYYNCMASASSFSIEKDVKQVTEMGRV  144 (145)
Q Consensus        81 ~g~~~f~CQHG~~EC~gN~~~aCal~~~~~~~~~~~l~fI~Cm~~~~~~~~~~~~~~c~~~~~l  144 (145)
                      ++ +.|+||||+.||.+|++|||+|+++  +++.++++||.||++..   .-..+.+|.+..|+
T Consensus        89 ~~-~~~~CqHG~~EC~lN~LqaCvI~~l--~~~~~~l~~i~C~~~~~---~~~~~~~C~~~~~~  146 (220)
T KOG3160|consen   89 DG-GTFTCQHGEEECKLNKLQACVIDTL--PDQSDQLPFIRCIQGKQ---KLSEAEDCLEKYGL  146 (220)
T ss_pred             Cc-eEEEecCCHHHHhhhHHHHHHHHhh--hchHhhhceehhhhccc---chhHHHHHHhhcCC
Confidence            43 8999999999999999999999999  68999999999999932   22223336665554


No 3  
>PF13462 Thioredoxin_4:  Thioredoxin; PDB: 3FEU_A 3HZ8_A 3DVW_A 3A3T_E 3GMF_A 1Z6M_A 3GYK_C 3BCK_A 3BD2_A 3BCI_A ....
Probab=95.05  E-value=0.077  Score=38.84  Aligned_cols=44  Identities=20%  Similarity=0.436  Sum_probs=35.7

Q ss_pred             hcCCeeEEEEEEEeCChhhHHHHHHhhHHHHHhc--cCceeEEEEee
Q psy12257         27 LRIVKAKVALYMESLCPGCHQFIKHQLYPVFMKY--SNYIQLDLIPF   71 (145)
Q Consensus        27 ~~~~kV~V~vyyESlCPd~~~Fi~~qL~P~~~~l--~d~idl~lvPf   71 (145)
                      .+..++.|.+|..=.||.|++|... |.++.+++  .+.+.+.++|+
T Consensus         9 ~~~a~~~v~~f~d~~Cp~C~~~~~~-~~~~~~~~i~~~~v~~~~~~~   54 (162)
T PF13462_consen    9 NPDAPITVTEFFDFQCPHCAKFHEE-LEKLLKKYIDPGKVKFVFRPV   54 (162)
T ss_dssp             -TTTSEEEEEEE-TTSHHHHHHHHH-HHHHHHHHTTTTTEEEEEEES
T ss_pred             CCCCCeEEEEEECCCCHhHHHHHHH-HhhhhhhccCCCceEEEEEEc
Confidence            4556899999999999999999864 55888887  77899999987


No 4  
>cd03019 DsbA_DsbA DsbA family, DsbA subfamily; DsbA is a monomeric thiol disulfide oxidoreductase protein containing a redox active CXXC motif imbedded in a TRX fold. It is involved in the oxidative protein folding pathway in prokaryotes, and is the strongest thiol oxidant known, due to the unusual stability of the thiolate anion form of the first cysteine in the CXXC motif. The highly unstable oxidized form of DsbA directly donates disulfide bonds to reduced proteins secreted into the bacterial periplasm. This rapid and unidirectional process helps to catalyze the folding of newly-synthesized polypeptides. To regain catalytic activity, reduced DsbA is then reoxidized by the membrane protein DsbB, which generates its disulfides from oxidized quinones, which in turn are reoxidized by the electron transport chain.
Probab=92.65  E-value=0.19  Score=37.42  Aligned_cols=44  Identities=20%  Similarity=0.307  Sum_probs=38.4

Q ss_pred             CCeeEEEEEEEeCChhhHHHHHHhhHHHHHhccCceeEEEEeeee
Q psy12257         29 IVKAKVALYMESLCPGCHQFIKHQLYPVFMKYSNYIQLDLIPFGN   73 (145)
Q Consensus        29 ~~kV~V~vyyESlCPd~~~Fi~~qL~P~~~~l~d~idl~lvPfG~   73 (145)
                      ..+|.|..|+-=.||.|++|-. .+.+...+..+.+.|+++|+..
T Consensus        14 ~~~~~i~~f~D~~Cp~C~~~~~-~~~~~~~~~~~~v~~~~~~~~~   57 (178)
T cd03019          14 SGKPEVIEFFSYGCPHCYNFEP-ILEAWVKKLPKDVKFEKVPVVF   57 (178)
T ss_pred             CCCcEEEEEECCCCcchhhhhH-HHHHHHHhCCCCceEEEcCCcc
Confidence            5789999999999999999985 5788888888899999999763


No 5  
>cd03023 DsbA_Com1_like DsbA family, Com1-like subfamily; composed of proteins similar to Com1, a 27-kDa outer membrane-associated immunoreactive protein originally found in both acute and chronic disease strains of the pathogenic bacteria Coxiella burnetti. It contains a CXXC motif, assumed to be imbedded in a DsbA-like structure. Its homology to DsbA suggests that the protein is a protein disulfide oxidoreductase. The role of such a protein in pathogenesis is unknown.
Probab=92.63  E-value=0.31  Score=34.96  Aligned_cols=41  Identities=10%  Similarity=0.284  Sum_probs=30.7

Q ss_pred             CCeeEEEEEEEeCChhhHHHHHHhhHHHHHhccCceeEEEEee
Q psy12257         29 IVKAKVALYMESLCPGCHQFIKHQLYPVFMKYSNYIQLDLIPF   71 (145)
Q Consensus        29 ~~kV~V~vyyESlCPd~~~Fi~~qL~P~~~~l~d~idl~lvPf   71 (145)
                      ..++.|.+|+--.||.|++|- .+|.+.+...++ +++.++||
T Consensus         4 ~a~~~i~~f~D~~Cp~C~~~~-~~l~~~~~~~~~-~~~~~~~~   44 (154)
T cd03023           4 NGDVTIVEFFDYNCGYCKKLA-PELEKLLKEDPD-VRVVFKEF   44 (154)
T ss_pred             CCCEEEEEEECCCChhHHHhh-HHHHHHHHHCCC-ceEEEEeC
Confidence            468899999999999999996 356565555554 56666666


No 6  
>PF14595 Thioredoxin_9:  Thioredoxin; PDB: 1Z6N_A.
Probab=91.50  E-value=0.44  Score=35.45  Aligned_cols=44  Identities=14%  Similarity=0.167  Sum_probs=24.9

Q ss_pred             hcCCeeEEEEEEEeCChhhHHHHHHhhHHHHHhccCceeEEEEeee
Q psy12257         27 LRIVKAKVALYMESLCPGCHQFIKHQLYPVFMKYSNYIQLDLIPFG   72 (145)
Q Consensus        27 ~~~~kV~V~vyyESlCPd~~~Fi~~qL~P~~~~l~d~idl~lvPfG   72 (145)
                      .-..++++.|+.|+-||||++++= .|..+.+ ....++++++.-.
T Consensus        38 ~~~~~~~ilvi~e~WCgD~~~~vP-~l~kiae-~~p~i~~~~i~rd   81 (129)
T PF14595_consen   38 SIQKPYNILVITETWCGDCARNVP-VLAKIAE-ANPNIEVRIILRD   81 (129)
T ss_dssp             T--S-EEEEEE--TT-HHHHHHHH-HHHHHHH-H-TTEEEEEE-HH
T ss_pred             hcCCCcEEEEEECCCchhHHHHHH-HHHHHHH-hCCCCeEEEEEec
Confidence            345788999999999999997762 2322222 3347788888764


No 7  
>cd02972 DsbA_family DsbA family; consists of DsbA and DsbA-like proteins, including DsbC, DsbG, glutathione (GSH) S-transferase kappa (GSTK), 2-hydroxychromene-2-carboxylate (HCCA) isomerase, an oxidoreductase (FrnE) presumed to be involved in frenolicin biosynthesis, a 27-kDa outer membrane protein, and similar proteins. Members of this family contain a redox active CXXC motif (except GSTK and HCCA isomerase) imbedded in a TRX fold, and an alpha helical insert of about 75 residues (shorter in DsbC and DsbG) relative to TRX. DsbA is involved in the oxidative protein folding pathway in prokaryotes, catalyzing disulfide bond formation of proteins secreted into the bacterial periplasm. DsbC and DsbG function as protein disulfide isomerases and chaperones to correct non-native disulfide bonds formed by DsbA and prevent aggregation of incorrectly folded proteins.
Probab=89.49  E-value=0.62  Score=30.25  Aligned_cols=41  Identities=20%  Similarity=0.402  Sum_probs=32.7

Q ss_pred             EEEEEEeCChhhHHHHHHhhHHHHHhccCceeEEEEeeeece
Q psy12257         34 VALYMESLCPGCHQFIKHQLYPVFMKYSNYIQLDLIPFGNAR   75 (145)
Q Consensus        34 V~vyyESlCPd~~~Fi~~qL~P~~~~l~d~idl~lvPfG~a~   75 (145)
                      |.+|+--.||.|..+.. +|.+......+.++++++|+.-..
T Consensus         1 i~~f~d~~Cp~C~~~~~-~l~~~~~~~~~~~~~~~~~~~~~~   41 (98)
T cd02972           1 IVEFFDPLCPYCYLFEP-ELEKLLYADDGGVRVVYRPFPLLG   41 (98)
T ss_pred             CeEEECCCCHhHHhhhH-HHHHHHhhcCCcEEEEEeccccCC
Confidence            46788899999999874 677766667888999999987544


No 8  
>PRK11657 dsbG disulfide isomerase/thiol-disulfide oxidase; Provisional
Probab=86.36  E-value=1.7  Score=35.69  Aligned_cols=43  Identities=28%  Similarity=0.388  Sum_probs=33.2

Q ss_pred             cCCeeEEEEEEEeCChhhHHHHHHhhHHHHHhccCceeEEEEeeee
Q psy12257         28 RIVKAKVALYMESLCPGCHQFIKHQLYPVFMKYSNYIQLDLIPFGN   73 (145)
Q Consensus        28 ~~~kV~V~vyyESlCPd~~~Fi~~qL~P~~~~l~d~idl~lvPfG~   73 (145)
                      ...|..|.||.--.||+|++|-. ++.|..+.  ..+.++++|++-
T Consensus       115 ~~ak~~I~vFtDp~CpyC~kl~~-~l~~~~~~--g~V~v~~ip~~~  157 (251)
T PRK11657        115 ADAPRIVYVFADPNCPYCKQFWQ-QARPWVDS--GKVQLRHILVGI  157 (251)
T ss_pred             CCCCeEEEEEECCCChhHHHHHH-HHHHHhhc--CceEEEEEeccc
Confidence            34678899999999999999986 46664433  348889999864


No 9  
>PF13905 Thioredoxin_8:  Thioredoxin-like; PDB: 1FG4_A 1I5G_A 1OC8_B 1O6J_A 1OC9_B 1O81_A 3FKF_A 1O85_A 1O7U_A 1O8W_A ....
Probab=85.64  E-value=3  Score=27.84  Aligned_cols=41  Identities=20%  Similarity=0.552  Sum_probs=31.3

Q ss_pred             eeEEEEEEEeCChhhHHHHHHhhHHHHHhcc--CceeEEEEeee
Q psy12257         31 KAKVALYMESLCPGCHQFIKHQLYPVFMKYS--NYIQLDLIPFG   72 (145)
Q Consensus        31 kV~V~vyyESlCPd~~~Fi~~qL~P~~~~l~--d~idl~lvPfG   72 (145)
                      |+.+-.|+-+-||.|+.++. .|..++++++  +.++|-.|...
T Consensus         2 K~~ll~fwa~~c~~c~~~~~-~l~~l~~~~~~~~~v~~v~Vs~d   44 (95)
T PF13905_consen    2 KPVLLYFWASWCPPCKKELP-KLKELYKKYKKKDDVEFVFVSLD   44 (95)
T ss_dssp             SEEEEEEE-TTSHHHHHHHH-HHHHHHHHHTTTTTEEEEEEE-S
T ss_pred             CEEEEEEECCCCHHHHHHHH-HHHHHHHHhCCCCCEEEEEEEeC
Confidence            67788899999999999874 6778887777  66777766664


No 10 
>TIGR00411 redox_disulf_1 small redox-active disulfide protein 1. This protein is homologous to a family of proteins that includes thioredoxins, glutaredoxins, protein-disulfide isomerases, and others, some of which have several such domains. The sequence of this protein at the redox-active disufide site, CPYC, matches glutaredoxins rather than thioredoxins, although its overall sequence seems closer to thioredoxins. It is suggested to be a ribonucleotide-reducing system component distinct from thioredoxin or glutaredoxin.
Probab=84.01  E-value=2.6  Score=27.22  Aligned_cols=29  Identities=21%  Similarity=0.415  Sum_probs=20.2

Q ss_pred             eEEEEEEEeCChhhHHHHHHhhHHHHHhcc
Q psy12257         32 AKVALYMESLCPGCHQFIKHQLYPVFMKYS   61 (145)
Q Consensus        32 V~V~vyyESlCPd~~~Fi~~qL~P~~~~l~   61 (145)
                      |+|.+|+-+-||.|+.... .|..+...+.
T Consensus         1 ~~v~~f~~~~C~~C~~~~~-~l~~l~~~~~   29 (82)
T TIGR00411         1 VKIELFTSPTCPYCPAAKR-VVEEVAKEMG   29 (82)
T ss_pred             CEEEEEECCCCcchHHHHH-HHHHHHHHhc
Confidence            6899999999999997643 3443333333


No 11 
>cd03020 DsbA_DsbC_DsbG DsbA family, DsbC and DsbG subfamily; V-shaped homodimeric proteins containing a redox active CXXC motif imbedded in a TRX fold. They function as protein disulfide isomerases and chaperones in the bacterial periplasm to correct non-native disulfide bonds formed by DsbA and prevent aggregation of incorrectly folded proteins. DsbC and DsbG are kept in their reduced state by the cytoplasmic membrane protein DsbD, which utilizes the TRX/TRX reductase system in the cytosol as a source of reducing equivalents. DsbG differ from DsbC in that it has a more limited substrate specificity, and it may preferentially act later in the folding process to catalyze disulfide rearrangements in folded or partially folded proteins. Also included in the alignment is the predicted protein TrbB, whose gene was sequenced from the enterohemorrhagic E. coli type IV pilus gene cluster, which is required for efficient plasmid transfer.
Probab=82.96  E-value=2.5  Score=32.71  Aligned_cols=43  Identities=21%  Similarity=0.390  Sum_probs=33.2

Q ss_pred             cCCeeEEEEEEEeCChhhHHHHHHhhHHHHHhccCceeEEEEeeeece
Q psy12257         28 RIVKAKVALYMESLCPGCHQFIKHQLYPVFMKYSNYIQLDLIPFGNAR   75 (145)
Q Consensus        28 ~~~kV~V~vyyESlCPd~~~Fi~~qL~P~~~~l~d~idl~lvPfG~a~   75 (145)
                      ...++.|.+|.--.||.|+++.. .|.+    ..+-+.|+++||....
T Consensus        75 ~~~~~~i~~f~D~~Cp~C~~~~~-~l~~----~~~~v~v~~~~~p~~~  117 (197)
T cd03020          75 GNGKRVVYVFTDPDCPYCRKLEK-ELKP----NADGVTVRIFPVPILG  117 (197)
T ss_pred             CCCCEEEEEEECCCCccHHHHHH-HHhh----ccCceEEEEEEcCcCC
Confidence            34689999999999999999875 4544    4566888888886443


No 12 
>cd02973 TRX_GRX_like Thioredoxin (TRX)-Glutaredoxin (GRX)-like family; composed of archaeal and bacterial proteins that show similarity to both TRX and GRX, including the C-terminal TRX-fold subdomain of Pyrococcus furiosus protein disulfide oxidoreductase (PfPDO). All members contain a redox-active CXXC motif and may function as PDOs. The archaeal proteins Mj0307 and Mt807 show structures more similar to GRX, but activities more similar to TRX. Some members of the family are similar to PfPDO in that they contain a second CXXC motif located in a second TRX-fold subdomain at the N-terminus; the superimposable N- and C-terminal TRX subdomains form a compact structure. PfPDO is postulated to be the archaeal counterpart of bacterial DsbA and eukaryotic protein disulfide isomerase (PDI). The C-terminal CXXC motif of PfPDO is required for its oxidase, reductase and isomerase activities. Also included in the family is the C-terminal TRX-fold subdomain of the N-terminal domain (NTD) of bacteri
Probab=82.88  E-value=3.1  Score=26.18  Aligned_cols=17  Identities=18%  Similarity=0.704  Sum_probs=15.2

Q ss_pred             eEEEEEEEeCChhhHHH
Q psy12257         32 AKVALYMESLCPGCHQF   48 (145)
Q Consensus        32 V~V~vyyESlCPd~~~F   48 (145)
                      |+|.+|+-+-||.|++.
T Consensus         1 ~~v~~f~~~~C~~C~~~   17 (67)
T cd02973           1 VNIEVFVSPTCPYCPDA   17 (67)
T ss_pred             CEEEEEECCCCCCcHHH
Confidence            68999999999999765


No 13 
>KOG2501|consensus
Probab=81.07  E-value=1.2  Score=34.84  Aligned_cols=79  Identities=15%  Similarity=0.172  Sum_probs=45.6

Q ss_pred             eeecccchhh--hhhhcCCeeEEEEEEEeCChhhHHHHHHhhHHHHHhccCc-eeEEEEeeeeceeecCCCCCcceeeeC
Q psy12257         14 RYLLGKKVEE--VSMLRIVKAKVALYMESLCPGCHQFIKHQLYPVFMKYSNY-IQLDLIPFGNARHTKNSDGTWEFKCQH   90 (145)
Q Consensus        14 ~~l~~~~~~~--~~~~~~~kV~V~vyyESlCPd~~~Fi~~qL~P~~~~l~d~-idl~lvPfG~a~~~~~~~g~~~f~CQH   90 (145)
                      +.|.+.+...  ++..-..||-+-.|--.-||+||.|- -.|.++|+.+.+- -.|++|-...-+...  +-...+.++|
T Consensus        15 ~~l~~~~~~~~~~~~~l~gKvV~lyFsA~wC~pCR~FT-P~Lk~fYe~l~~~~~~fEVvfVS~D~~~~--~~~~y~~~~~   91 (157)
T KOG2501|consen   15 NRLRKQDGTEVLASEALQGKVVGLYFSAHWCPPCRDFT-PILKDFYEELKDNAAPFEVVFVSSDRDEE--SLDEYMLEHH   91 (157)
T ss_pred             CeeeccCCccchHhHhhCCcEEEEEEEEEECCchhhCC-chHHHHHHHHHhcCCceEEEEEecCCCHH--HHHHHHHhcC
Confidence            3455544443  33234458777777788999999986 4788899887654 244444432211111  1123567778


Q ss_pred             Chhhh
Q psy12257         91 GEPEC   95 (145)
Q Consensus        91 G~~EC   95 (145)
                      |+-=.
T Consensus        92 ~~W~~   96 (157)
T KOG2501|consen   92 GDWLA   96 (157)
T ss_pred             CCeEE
Confidence            76543


No 14 
>cd03026 AhpF_NTD_C TRX-GRX-like family, Alkyl hydroperoxide reductase F subunit (AhpF) N-terminal domain (NTD) subfamily, C-terminal TRX-fold subdomain; AhpF is a homodimeric flavoenzyme which catalyzes the NADH-dependent reduction of the peroxiredoxin AhpC, which then reduces hydrogen peroxide and organic hydroperoxides. AhpF contains an NTD containing two contiguous TRX-fold subdomains similar to Pyrococcus furiosus protein disulfide oxidoreductase (PfPDO). It also contains a catalytic core similar to TRX reductase containing FAD and NADH binding domains with an active site disulfide. The proposed mechanism of action of AhpF is similar to a TRX/TRX reductase system. The flow of reducing equivalents goes from NADH - catalytic core of AhpF - NTD of AhpF - AhpC - peroxide substrates. The catalytic CXXC motif of the NTD of AhpF is contained in its C-terminal TRX subdomain.
Probab=78.10  E-value=5.2  Score=27.57  Aligned_cols=41  Identities=15%  Similarity=0.232  Sum_probs=26.6

Q ss_pred             cCCeeEEEEEEEeCChhhHHHHHHhhHHHHHhccCceeEEEEe
Q psy12257         28 RIVKAKVALYMESLCPGCHQFIKHQLYPVFMKYSNYIQLDLIP   70 (145)
Q Consensus        28 ~~~kV~V~vyyESlCPd~~~Fi~~qL~P~~~~l~d~idl~lvP   70 (145)
                      =..+|+|.+|+-.-||+|...  .++..-+....+.+++..+=
T Consensus        10 l~~pv~i~~F~~~~C~~C~~~--~~~~~~l~~~~~~i~~~~vd   50 (89)
T cd03026          10 LNGPINFETYVSLSCHNCPDV--VQALNLMAVLNPNIEHEMID   50 (89)
T ss_pred             cCCCEEEEEEECCCCCCcHHH--HHHHHHHHHHCCCceEEEEE
Confidence            347899999999999999954  34444333333345555544


No 15 
>PF01323 DSBA:  DSBA-like thioredoxin domain;  InterPro: IPR001853 DSBA is a sub-family of the Thioredoxin family []. The efficient and correct folding of bacterial disulphide bonded proteins in vivo is dependent upon a class of periplasmic oxidoreductase proteins called DsbA, after the Escherichia coli enzyme. The bacterial protein-folding factor DsbA is the most oxidizing of the thioredoxin family. DsbA catalyses disulphide-bond formation during the folding of secreted proteins. The extremely oxidizing nature of DsbA has been proposed to result from either domain motion or stabilising active-site interactions in the reduced form. DsbA's highly oxidizing nature is a result of hydrogen bond, electrostatic and helix-dipole interactions that favour the thiolate over the disulphide at the active site []. In the pathogenic bacterium Vibrio cholerae, the DsbA homologue (TcpG) is responsible for the folding, maturation and secretion of virulence factors. While the overall architecture of TcpG and DsbA is similar and the surface features are retained in TcpG, there are significant differences. For example, the kinked active site helix results from a three-residue loop in DsbA, but is caused by a proline in TcpG (making TcpG more similar to thioredoxin in this respect). Furthermore, the proposed peptide binding groove of TcpG is substantially shortened compared with that of DsbA due to a six-residue deletion. Also, the hydrophobic pocket of TcpG is more shallow and the acidic patch is much less extensive than that of E. coli DsbA [].; GO: 0015035 protein disulfide oxidoreductase activity; PDB: 3GL5_A 3DKS_D 3RPP_C 3RPN_B 1YZX_A 3L9V_C 2IMD_A 2IME_A 2IMF_A 2B3S_B ....
Probab=75.54  E-value=7.1  Score=29.18  Aligned_cols=39  Identities=18%  Similarity=0.535  Sum_probs=30.3

Q ss_pred             EEEEEEEeCChhhHHHHHHhhHHHHHhccCceeEEEEeeee
Q psy12257         33 KVALYMESLCPGCHQFIKHQLYPVFMKYSNYIQLDLIPFGN   73 (145)
Q Consensus        33 ~V~vyyESlCPd~~~Fi~~qL~P~~~~l~d~idl~lvPfG~   73 (145)
                      +|++|+--.||.|-.+.. .|..+-....+ ++|++.||.-
T Consensus         1 ~i~~~~D~~Cp~cy~~~~-~l~~l~~~~~~-~~i~~~p~~l   39 (193)
T PF01323_consen    1 TIEFFFDFICPWCYLASP-RLRKLRAEYPD-VEIEWRPFPL   39 (193)
T ss_dssp             EEEEEEBTTBHHHHHHHH-HHHHHHHHHTT-CEEEEEEESS
T ss_pred             CEEEEEeCCCHHHHHHHH-HHHHHHHHhcC-CcEEEecccc
Confidence            589999999999998875 45555555544 9999999974


No 16 
>TIGR02190 GlrX-dom Glutaredoxin-family domain. This C-terminal domain with homology to glutaredoxin is fused to an N-terminal peroxiredoxin-like domain.
Probab=69.94  E-value=3.2  Score=27.55  Aligned_cols=21  Identities=19%  Similarity=0.384  Sum_probs=16.8

Q ss_pred             CCeeEEEEEEEeCChhhHHHH
Q psy12257         29 IVKAKVALYMESLCPGCHQFI   49 (145)
Q Consensus        29 ~~kV~V~vyyESlCPd~~~Fi   49 (145)
                      ..+-+|+||.-+-||.|++-.
T Consensus         5 ~~~~~V~ly~~~~Cp~C~~ak   25 (79)
T TIGR02190         5 RKPESVVVFTKPGCPFCAKAK   25 (79)
T ss_pred             CCCCCEEEEECCCCHhHHHHH
Confidence            344568899999999999754


No 17 
>cd02066 GRX_family Glutaredoxin (GRX) family; composed of GRX, approximately 10 kDa in size, and proteins containing a GRX or GRX-like domain. GRX is a glutathione (GSH) dependent reductase, catalyzing the disulfide reduction of target proteins such as ribonucleotide reductase. It contains a redox active CXXC motif in a TRX fold and uses a similar dithiol mechanism employed by TRXs for intramolecular disulfide bond reduction of protein substrates. Unlike TRX, GRX has preference for mixed GSH disulfide substrates, in which it uses a monothiol mechanism where only the N-terminal cysteine is required. The flow of reducing equivalents in the GRX system goes from NADPH - GSH reductase - GSH - GRX - protein substrates. By altering the redox state of target proteins, GRX is involved in many cellular functions including DNA synthesis, signal transduction and the defense against oxidative stress. Different classes are known including human GRX1 and GRX2, as well as E. coli GRX1 and GRX3, which 
Probab=69.89  E-value=4  Score=24.98  Aligned_cols=17  Identities=35%  Similarity=0.757  Sum_probs=14.4

Q ss_pred             EEEEEEEeCChhhHHHH
Q psy12257         33 KVALYMESLCPGCHQFI   49 (145)
Q Consensus        33 ~V~vyyESlCPd~~~Fi   49 (145)
                      +|.+|....||+|++..
T Consensus         1 ~v~ly~~~~Cp~C~~~~   17 (72)
T cd02066           1 KVVVFSKSTCPYCKRAK   17 (72)
T ss_pred             CEEEEECCCCHHHHHHH
Confidence            37899999999999764


No 18 
>cd02964 TryX_like_family Tryparedoxin (TryX)-like family; composed of TryX and related proteins including nucleoredoxin (NRX), rod-derived cone viability factor (RdCVF) and the nematode homolog described as a 16-kD class of TRX. Most members of this family, except RdCVF, are protein disulfide oxidoreductases containing an active site CXXC motif, similar to TRX.
Probab=69.82  E-value=9.9  Score=27.24  Aligned_cols=40  Identities=20%  Similarity=0.407  Sum_probs=28.0

Q ss_pred             CeeEEEEEEEeCChhhHHHHHHhhHHHHHhccCc-eeEEEEe
Q psy12257         30 VKAKVALYMESLCPGCHQFIKHQLYPVFMKYSNY-IQLDLIP   70 (145)
Q Consensus        30 ~kV~V~vyyESlCPd~~~Fi~~qL~P~~~~l~d~-idl~lvP   70 (145)
                      .|+-|-.|+-+-||.|+..+. .|..+++++++. -+++++.
T Consensus        17 Gk~vll~F~atwC~~C~~~~p-~l~~l~~~~~~~~~~v~vi~   57 (132)
T cd02964          17 GKTVGLYFSASWCPPCRAFTP-KLVEFYEKLKEEGKNFEIVF   57 (132)
T ss_pred             CCEEEEEEECCCCchHHHHHH-HHHHHHHHHhhcCCCeEEEE
Confidence            578888888999999999764 466666666543 3444443


No 19 
>TIGR02200 GlrX_actino Glutaredoxin-like protein. This family of glutaredoxin-like proteins is limited to the Actinobacteria and contains the conserved CxxC motif.
Probab=67.95  E-value=3.8  Score=25.97  Aligned_cols=16  Identities=25%  Similarity=0.665  Sum_probs=14.0

Q ss_pred             EEEEEEEeCChhhHHH
Q psy12257         33 KVALYMESLCPGCHQF   48 (145)
Q Consensus        33 ~V~vyyESlCPd~~~F   48 (145)
                      +|.||+-+.||+|++.
T Consensus         1 ~v~ly~~~~C~~C~~~   16 (77)
T TIGR02200         1 TITVYGTTWCGYCAQL   16 (77)
T ss_pred             CEEEEECCCChhHHHH
Confidence            3789999999999974


No 20 
>cd02995 PDI_a_PDI_a'_C PDIa family, C-terminal TRX domain (a') subfamily; composed of the C-terminal redox active a' domains of PDI, ERp72, ERp57 (or ERp60) and EFP1. PDI, ERp72 and ERp57 are endoplasmic reticulum (ER)-resident eukaryotic proteins involved in oxidative protein folding. They are oxidases, catalyzing the formation of disulfide bonds of newly synthesized polypeptides in the ER. They also exhibit reductase activity in acting as isomerases to correct any non-native disulfide bonds, as well as chaperone activity to prevent protein aggregation and facilitate the folding of newly synthesized proteins. PDI and ERp57 have the abb'a' domain structure (where a and a' are redox active TRX domains while b and b' are redox inactive TRX-like domains). PDI also contains an acidic region (c domain) after the a' domain that is absent in ERp57. ERp72 has an additional a domain at the N-terminus (a"abb'a' domain structure). ERp57 interacts with the lectin chaperones, calnexin and calreticu
Probab=66.50  E-value=17  Score=24.01  Aligned_cols=36  Identities=11%  Similarity=0.141  Sum_probs=23.6

Q ss_pred             CeeEEEEEEEeCChhhHHHHHHhhHHHHHhccCceeE
Q psy12257         30 VKAKVALYMESLCPGCHQFIKHQLYPVFMKYSNYIQL   66 (145)
Q Consensus        30 ~kV~V~vyyESlCPd~~~Fi~~qL~P~~~~l~d~idl   66 (145)
                      .+.-+-.||-+-|+.|+++.. ++..+...+.+..++
T Consensus        18 ~~~~~v~f~~~~C~~C~~~~~-~~~~~~~~~~~~~~~   53 (104)
T cd02995          18 DKDVLVEFYAPWCGHCKALAP-IYEELAEKLKGDDNV   53 (104)
T ss_pred             CCcEEEEEECCCCHHHHHHhh-HHHHHHHHhcCCCCE
Confidence            466677899999999998753 454444455543333


No 21 
>PF13743 Thioredoxin_5:  Thioredoxin; PDB: 3KZQ_C.
Probab=66.39  E-value=12  Score=28.91  Aligned_cols=105  Identities=23%  Similarity=0.291  Sum_probs=52.2

Q ss_pred             EEEEeCChhhHHHHHHhhHHHHHhccCceeEEEEeeeeceeecCCCCCcceeeeCChh--hhccChHhHHH---hhhhcC
Q psy12257         36 LYMESLCPGCHQFIKHQLYPVFMKYSNYIQLDLIPFGNARHTKNSDGTWEFKCQHGEP--ECFGNLYLACA---THLLQA  110 (145)
Q Consensus        36 vyyESlCPd~~~Fi~~qL~P~~~~l~d~idl~lvPfG~a~~~~~~~g~~~f~CQHG~~--EC~gN~~~aCa---l~~~~~  110 (145)
                      +|.--+|+.|-.+-. .|..+...+...+++++||.|++.....  -.....+.+..-  +=......+|.   ...++ 
T Consensus         2 ~F~dPlc~~C~~~E~-~l~kl~~~~~~~i~~~~i~~~~~~~~~~--~~~~~~~~~~~~~~~~~~~~y~a~la~kAA~~q-   77 (176)
T PF13743_consen    2 LFVDPLCSWCWGFEP-ELRKLKEEYGNKIEFRFIPGGLMPDIND--FMPRMPINGDFWRNEPRSSSYPACLAYKAAQLQ-   77 (176)
T ss_dssp             EEE-TT-HHHHHHHH-HHHHHHHHS-TTEEEEEEE--SS-S--S--B--H----TTHHHS--BS--HHHHHHHHHHHTT-
T ss_pred             eeeCCCChHHHHhHH-HHHHHHHHcCCcEEEEEEEccchHHHHH--HHHhcCCCHHHhcCCCCCCchHHHHHHHHHHHh-
Confidence            466779999987753 4666667789999999999999865531  111112222211  12244555662   11121 


Q ss_pred             CCccccceeeeeccccC-----CCCchhhHHHHhhhcCCC
Q psy12257        111 SRPKHLIRYYNCMASAS-----SFSIEKDVKQVTEMGRVS  145 (145)
Q Consensus       111 ~~~~~~l~fI~Cm~~~~-----~~~~~~~~~~c~~~~~l~  145 (145)
                       ..+++..|+.-|....     ++..+.-+.++|+..||.
T Consensus        78 -g~k~~~~fL~~lQ~a~~~~~~~~s~~~~l~~iA~~~gLD  116 (176)
T PF13743_consen   78 -GKKKARRFLRALQEALFLEGKNYSDEELLLEIAEELGLD  116 (176)
T ss_dssp             -T-H--HHHHHHHHHHHHTS---TTSHHHHHHHHHHTT--
T ss_pred             -ChhhHHHHHHHHHHHHHhcCCCCCHHHHHHHHHHHhCCC
Confidence             4456677777775543     344446799999999984


No 22 
>KOG3425|consensus
Probab=66.34  E-value=11  Score=28.49  Aligned_cols=36  Identities=17%  Similarity=0.284  Sum_probs=25.2

Q ss_pred             EEeCChhhHHHHHHhhHHHHHhccCceeEEEEeeeec
Q psy12257         38 MESLCPGCHQFIKHQLYPVFMKYSNYIQLDLIPFGNA   74 (145)
Q Consensus        38 yESlCPd~~~Fi~~qL~P~~~~l~d~idl~lvPfG~a   74 (145)
                      .+|-||||++-. -.+..+++..+.-+.|-.|.-|+-
T Consensus        41 GqSWCPdCV~AE-Pvi~~alk~ap~~~~~v~v~VG~r   76 (128)
T KOG3425|consen   41 GQSWCPDCVAAE-PVINEALKHAPEDVHFVHVYVGNR   76 (128)
T ss_pred             CCcCCchHHHhh-HHHHHHHHhCCCceEEEEEEecCC
Confidence            356799999764 234445566777788888888864


No 23 
>cd03024 DsbA_FrnE DsbA family, FrnE subfamily; FrnE is a DsbA-like protein containing a CXXC motif. It is presumed to be a thiol oxidoreductase involved in polyketide biosynthesis, specifically in the production of the aromatic antibiotics frenolicin and nanaomycins.
Probab=66.34  E-value=11  Score=28.51  Aligned_cols=41  Identities=15%  Similarity=0.381  Sum_probs=31.6

Q ss_pred             EEEEEEeCChhhHHHHHHhhHHHHHhcc--CceeEEEEeeeece
Q psy12257         34 VALYMESLCPGCHQFIKHQLYPVFMKYS--NYIQLDLIPFGNAR   75 (145)
Q Consensus        34 V~vyyESlCPd~~~Fi~~qL~P~~~~l~--d~idl~lvPfG~a~   75 (145)
                      |++|+--.||.|--... +|..+...+.  +-++|++.||+-..
T Consensus         1 I~~~~D~~cP~cyl~~~-~l~~~~~~~~~~~~~~v~~~p~~L~~   43 (201)
T cd03024           1 IDIWSDVVCPWCYIGKR-RLEKALAELGDEVDVEIEWRPFELNP   43 (201)
T ss_pred             CeEEecCcCccHHHHHH-HHHHHHHhCCCCCceEEEEeeeeeCC
Confidence            57899999999987764 6777766664  36999999997543


No 24 
>cd03025 DsbA_FrnE_like DsbA family, FrnE-like subfamily; composed of uncharacterized proteins containing a CXXC motif with similarity to DsbA and FrnE. FrnE is presumed to be a thiol oxidoreductase involved in polyketide biosynthesis, specifically in the production of the aromatic antibiotics frenolicin and nanaomycins.
Probab=66.23  E-value=8.6  Score=28.89  Aligned_cols=42  Identities=21%  Similarity=0.323  Sum_probs=31.4

Q ss_pred             eEEEEEEEeCChhhHHHHHHhhHHHHHhccCceeEEEEeeeec
Q psy12257         32 AKVALYMESLCPGCHQFIKHQLYPVFMKYSNYIQLDLIPFGNA   74 (145)
Q Consensus        32 V~V~vyyESlCPd~~~Fi~~qL~P~~~~l~d~idl~lvPfG~a   74 (145)
                      ++|.+|+--+||.|-.... +|..+...+...++|++.+++-.
T Consensus         1 ~~i~~~~D~~cp~c~~~~~-~l~~l~~~~~~~~~v~~~~~~L~   42 (193)
T cd03025           1 LELYYFIDPLCGWCYGFEP-LLEKLKEEYGGGIEVELHLGGLL   42 (193)
T ss_pred             CeEEEEECCCCchhhCchH-HHHHHHHHhCCCceEEEEecccc
Confidence            4688999999999987653 56666666655688888887743


No 25 
>cd02949 TRX_NTR TRX domain, novel NADPH thioredoxin reductase (NTR) family; composed of fusion proteins found only in oxygenic photosynthetic organisms containing both TRX and NTR domains. The TRX domain functions as a protein disulfide reductase via the reversible oxidation of an active center dithiol present in a CXXC motif, while the NTR domain functions as a reductant to oxidized TRX. The fusion protein is  bifunctional, showing both TRX and NTR activities, but it is not an independent NTR/TRX system. In plants, the protein is found exclusively in shoots and mature leaves and is localized in the chloroplast. It is involved in plant protection against oxidative stress.
Probab=66.01  E-value=21  Score=24.07  Aligned_cols=35  Identities=17%  Similarity=0.325  Sum_probs=26.7

Q ss_pred             hcCCeeEEEEEEEeCChhhHHHHHHhhHHHHHhccC
Q psy12257         27 LRIVKAKVALYMESLCPGCHQFIKHQLYPVFMKYSN   62 (145)
Q Consensus        27 ~~~~kV~V~vyyESlCPd~~~Fi~~qL~P~~~~l~d   62 (145)
                      ...+++-+-+|+-+-||.|+.+.. .|-++...+.+
T Consensus        10 ~~~~~~vlv~f~a~~C~~C~~~~~-~l~~l~~~~~~   44 (97)
T cd02949          10 HESDRLILVLYTSPTCGPCRTLKP-ILNKVIDEFDG   44 (97)
T ss_pred             HhCCCeEEEEEECCCChhHHHHHH-HHHHHHHHhCC
Confidence            456888899999999999998864 45555556655


No 26 
>cd03419 GRX_GRXh_1_2_like Glutaredoxin (GRX) family, GRX human class 1 and 2 (h_1_2)-like subfamily; composed of proteins similar to human GRXs, approximately 10 kDa in size, and proteins containing a GRX or GRX-like domain. GRX is a glutathione (GSH) dependent reductase, catalyzing the disulfide reduction of target proteins such as ribonucleotide reductase. It contains a redox active CXXC motif in a TRX fold and uses a similar dithiol mechanism employed by TRXs for intramolecular disulfide bond reduction of protein substrates. Unlike TRX, GRX has preference for mixed GSH disulfide substrates, in which it uses a monothiol mechanism where only the N-terminal cysteine is required. The flow of reducing equivalents in the GRX system goes from NADPH - GSH reductase - GSH - GRX - protein substrates. By altering the redox state of target proteins, GRX is involved in many cellular functions including DNA synthesis, signal transduction and the defense against oxidative stress. Different classes
Probab=65.35  E-value=5.6  Score=25.69  Aligned_cols=17  Identities=29%  Similarity=0.708  Sum_probs=14.6

Q ss_pred             EEEEEEEeCChhhHHHH
Q psy12257         33 KVALYMESLCPGCHQFI   49 (145)
Q Consensus        33 ~V~vyyESlCPd~~~Fi   49 (145)
                      +|.+|+...||+|....
T Consensus         1 ~v~~y~~~~Cp~C~~~~   17 (82)
T cd03419           1 PVVVFSKSYCPYCKRAK   17 (82)
T ss_pred             CEEEEEcCCCHHHHHHH
Confidence            37899999999999764


No 27 
>PF13728 TraF:  F plasmid transfer operon protein
Probab=64.59  E-value=7.4  Score=31.26  Aligned_cols=38  Identities=24%  Similarity=0.556  Sum_probs=30.9

Q ss_pred             CeeEEEEEEEeCChhhHHHHHHhhHHHHHhccCceeEEEEeee
Q psy12257         30 VKAKVALYMESLCPGCHQFIKHQLYPVFMKYSNYIQLDLIPFG   72 (145)
Q Consensus        30 ~kV~V~vyyESlCPd~~~Fi~~qL~P~~~~l~d~idl~lvPfG   72 (145)
                      .+.-+-+||+|-||.|+.|     .|++..+.+.-.|+++|+-
T Consensus       120 ~~~gL~~F~~~~C~~C~~~-----~pil~~~~~~yg~~v~~vs  157 (215)
T PF13728_consen  120 QKYGLFFFYRSDCPYCQQQ-----APILQQFADKYGFSVIPVS  157 (215)
T ss_pred             hCeEEEEEEcCCCchhHHH-----HHHHHHHHHHhCCEEEEEe
Confidence            7888999999999999854     5667777777788888874


No 28 
>cd03012 TlpA_like_DipZ_like TlpA-like family, DipZ-like subfamily; composed uncharacterized proteins containing a TlpA-like TRX domain. Some members show domain architectures similar to that of E. coli DipZ protein (also known as DsbD). The only eukaryotic members of the TlpA family belong to this subfamily. TlpA is a disulfide reductase known to have a crucial role in the biogenesis of cytochrome aa3.
Probab=64.59  E-value=19  Score=25.40  Aligned_cols=41  Identities=20%  Similarity=0.194  Sum_probs=30.8

Q ss_pred             CCeeEEEEEEEeCChhhHHHHHHhhHHHHHhccCceeEEEEee
Q psy12257         29 IVKAKVALYMESLCPGCHQFIKHQLYPVFMKYSNYIQLDLIPF   71 (145)
Q Consensus        29 ~~kV~V~vyyESlCPd~~~Fi~~qL~P~~~~l~d~idl~lvPf   71 (145)
                      ..|+-|-.|+-+-||.|++.+. .|..+++++.+ -++.++..
T Consensus        22 ~gk~vvl~F~a~~C~~C~~~~p-~l~~l~~~~~~-~~~~vi~i   62 (126)
T cd03012          22 RGKVVLLDFWTYCCINCLHTLP-YLTDLEQKYKD-DGLVVIGV   62 (126)
T ss_pred             CCCEEEEEEECCCCccHHHHHH-HHHHHHHHcCc-CCeEEEEe
Confidence            3578888889999999999875 58888888775 34555543


No 29 
>PRK10877 protein disulfide isomerase II DsbC; Provisional
Probab=63.61  E-value=19  Score=29.10  Aligned_cols=42  Identities=17%  Similarity=0.350  Sum_probs=29.5

Q ss_pred             cCCeeEEEEEEEeCChhhHHHHHHhhHHHHHhccCceeEEEEeeee
Q psy12257         28 RIVKAKVALYMESLCPGCHQFIKHQLYPVFMKYSNYIQLDLIPFGN   73 (145)
Q Consensus        28 ~~~kV~V~vyyESlCPd~~~Fi~~qL~P~~~~l~d~idl~lvPfG~   73 (145)
                      ...+..|.+|.--.||+|+++-. +|.+ +.+  .-+.+.+++|..
T Consensus       105 ~~~k~~I~vFtDp~CpyCkkl~~-~l~~-~~~--~~v~v~~~~~P~  146 (232)
T PRK10877        105 PQEKHVITVFTDITCGYCHKLHE-QMKD-YNA--LGITVRYLAFPR  146 (232)
T ss_pred             CCCCEEEEEEECCCChHHHHHHH-HHHH-Hhc--CCeEEEEEeccC
Confidence            44688899999999999999974 3433 222  237777776654


No 30 
>PF11287 DUF3088:  Protein of unknown function (DUF3088);  InterPro: IPR021439  This family of proteins with unknown function appears to be restricted to Proteobacteria. 
Probab=62.55  E-value=3.7  Score=30.44  Aligned_cols=34  Identities=21%  Similarity=0.492  Sum_probs=28.7

Q ss_pred             CChhhHHHHHHhhHHHHHhccCceeEEEEeeeecee
Q psy12257         41 LCPGCHQFIKHQLYPVFMKYSNYIQLDLIPFGNARH   76 (145)
Q Consensus        41 lCPd~~~Fi~~qL~P~~~~l~d~idl~lvPfG~a~~   76 (145)
                      .||+|..  .+-|.-.|..+.+.+|++.|+|-+-+.
T Consensus        23 ~Cp~c~~--iEGlLa~~P~l~~~ldV~rV~f~RPR~   56 (112)
T PF11287_consen   23 YCPHCAA--IEGLLASFPDLRERLDVRRVDFPRPRQ   56 (112)
T ss_pred             ECCchHH--HHhHHhhChhhhhcccEEEeCCCCchH
Confidence            5999994  456888889999999999999986653


No 31 
>PF00462 Glutaredoxin:  Glutaredoxin;  InterPro: IPR002109 Glutaredoxins [, , ], also known as thioltransferases (disulphide reductases, are small proteins of approximately one hundred amino-acid residues which utilise glutathione and NADPH as cofactors. Oxidized glutathione is regenerated by glutathione reductase. Together these components compose the glutathione system [].  Glutaredoxin functions as an electron carrier in the glutathione-dependent synthesis of deoxyribonucleotides by the enzyme ribonucleotide reductase. Like thioredoxin, which functions in a similar way, glutaredoxin possesses an active centre disulphide bond []. It exists in either a reduced or an oxidized form where the two cysteine residues are linked in an intramolecular disulphide bond. Glutaredoxin has been sequenced in a variety of species. On the basis of extensive sequence similarity, it has been proposed [] that Vaccinia virus protein O2L is most probably a glutaredoxin. Finally, it must be noted that Bacteriophage T4 thioredoxin seems also to be evolutionary related. In position 5 of the pattern T4 thioredoxin has Val instead of Pro.  This entry represents Glutaredoxin.; GO: 0009055 electron carrier activity, 0015035 protein disulfide oxidoreductase activity, 0045454 cell redox homeostasis; PDB: 1QFN_A 1GRX_A 1EGO_A 1EGR_A 3RHC_A 3RHB_A 3IPZ_A 1NHO_A 3GX8_A 3D5J_A ....
Probab=61.34  E-value=7.7  Score=24.01  Aligned_cols=17  Identities=29%  Similarity=0.690  Sum_probs=14.6

Q ss_pred             EEEEEEeCChhhHHHHH
Q psy12257         34 VALYMESLCPGCHQFIK   50 (145)
Q Consensus        34 V~vyyESlCPd~~~Fi~   50 (145)
                      |.+|...-||+|++...
T Consensus         1 V~vy~~~~C~~C~~~~~   17 (60)
T PF00462_consen    1 VVVYTKPGCPYCKKAKE   17 (60)
T ss_dssp             EEEEESTTSHHHHHHHH
T ss_pred             cEEEEcCCCcCHHHHHH
Confidence            68999999999997753


No 32 
>PRK13703 conjugal pilus assembly protein TraF; Provisional
Probab=61.31  E-value=7.3  Score=32.40  Aligned_cols=38  Identities=18%  Similarity=0.237  Sum_probs=30.1

Q ss_pred             CeeEEEEEEEeCChhhHHHHHHhhHHHHHhccCceeEEEEeee
Q psy12257         30 VKAKVALYMESLCPGCHQFIKHQLYPVFMKYSNYIQLDLIPFG   72 (145)
Q Consensus        30 ~kV~V~vyyESlCPd~~~Fi~~qL~P~~~~l~d~idl~lvPfG   72 (145)
                      .+--+-+||+|-||.|+.     +.|+...+.+.-.|.++|+.
T Consensus       143 ~~~GL~fFy~s~Cp~C~~-----~aPil~~fa~~yg~~v~~VS  180 (248)
T PRK13703        143 EHYGLMFFYRGQDPIDGQ-----LAQVINDFRDTYGLSVIPVS  180 (248)
T ss_pred             hcceEEEEECCCCchhHH-----HHHHHHHHHHHhCCeEEEEe
Confidence            446788999999999984     55777777777778888874


No 33 
>TIGR02180 GRX_euk Glutaredoxin. This model represents eukaryotic glutaredoxins and includes sequences from fungi, plants and metazoans as well as viruses.
Probab=60.92  E-value=6.3  Score=25.43  Aligned_cols=16  Identities=31%  Similarity=0.764  Sum_probs=14.0

Q ss_pred             EEEEEEeCChhhHHHH
Q psy12257         34 VALYMESLCPGCHQFI   49 (145)
Q Consensus        34 V~vyyESlCPd~~~Fi   49 (145)
                      |.+|+.+.||+|++..
T Consensus         1 V~~f~~~~Cp~C~~~~   16 (84)
T TIGR02180         1 VVVFSKSYCPYCKKAK   16 (84)
T ss_pred             CEEEECCCChhHHHHH
Confidence            5789999999999775


No 34 
>cd03027 GRX_DEP Glutaredoxin (GRX) family, Dishevelled, Egl-10, and Pleckstrin (DEP) subfamily; composed of uncharacterized proteins containing a GRX domain and additional domains DEP and DUF547, both of which have unknown functions.  GRX is a glutathione (GSH) dependent reductase containing a redox active CXXC motif in a TRX fold. It has preference for mixed GSH disulfide substrates, in which it uses a monothiol mechanism where only the N-terminal cysteine is required. By altering the redox state of target proteins, GRX is involved in many cellular functions.
Probab=60.49  E-value=7.4  Score=25.11  Aligned_cols=17  Identities=24%  Similarity=0.581  Sum_probs=14.8

Q ss_pred             EEEEEEEeCChhhHHHH
Q psy12257         33 KVALYMESLCPGCHQFI   49 (145)
Q Consensus        33 ~V~vyyESlCPd~~~Fi   49 (145)
                      +|+||.-+.||+|++-.
T Consensus         2 ~v~ly~~~~C~~C~ka~   18 (73)
T cd03027           2 RVTIYSRLGCEDCTAVR   18 (73)
T ss_pred             EEEEEecCCChhHHHHH
Confidence            47899999999999765


No 35 
>cd03418 GRX_GRXb_1_3_like Glutaredoxin (GRX) family, GRX bacterial class 1 and 3 (b_1_3)-like subfamily; composed of bacterial GRXs, approximately 10 kDa in size, and proteins containing a GRX or GRX-like domain. GRX is a glutathione (GSH) dependent reductase, catalyzing the disulfide reduction of target proteins such as ribonucleotide reductase. It contains a redox active CXXC motif in a TRX fold and uses a similar dithiol mechanism employed by TRXs for intramolecular disulfide bond reduction of protein substrates. Unlike TRX, GRX has preference for mixed GSH disulfide substrates, in which it uses a monothiol mechanism where only the N-terminal cysteine is required. The flow of reducing equivalents in the GRX system goes from NADPH - GSH reductase - GSH - GRX - protein substrates. By altering the redox state of target proteins, GRX is involved in many cellular functions including DNA synthesis, signal transduction and the defense against oxidative stress. Different classes are known i
Probab=59.45  E-value=6.2  Score=25.15  Aligned_cols=17  Identities=35%  Similarity=0.723  Sum_probs=14.5

Q ss_pred             EEEEEEEeCChhhHHHH
Q psy12257         33 KVALYMESLCPGCHQFI   49 (145)
Q Consensus        33 ~V~vyyESlCPd~~~Fi   49 (145)
                      +|.||.-+.||+|.+..
T Consensus         1 ~i~ly~~~~Cp~C~~ak   17 (75)
T cd03418           1 KVEIYTKPNCPYCVRAK   17 (75)
T ss_pred             CEEEEeCCCChHHHHHH
Confidence            37899999999999764


No 36 
>PF00085 Thioredoxin:  Thioredoxin;  InterPro: IPR013766 Thioredoxins [, , , ] are small disulphide-containing redox proteins that have been found in all the kingdoms of living organisms. Thioredoxin serves as a general protein disulphide oxidoreductase. It interacts with a broad range of proteins by a redox mechanism based on reversible oxidation of two cysteine thiol groups to a disulphide, accompanied by the transfer of two electrons and two protons. The net result is the covalent interconversion of a disulphide and a dithiol. In the NADPH-dependent protein disulphide reduction, thioredoxin reductase (TR) catalyses the reduction of oxidised thioredoxin (trx) by NADPH using FAD and its redox-active disulphide; reduced thioredoxin then directly reduces the disulphide in the substrate protein [].  Thioredoxin is present in prokaryotes and eukaryotes and the sequence around the redox-active disulphide bond is well conserved. All thioredoxins contain a cis-proline located in a loop preceding beta-strand 4, which makes contact with the active site cysteines, and is important for stability and function []. Thioredoxin belongs to a structural family that includes glutaredoxin, glutathione peroxidase, bacterial protein disulphide isomerase DsbA, and the N-terminal domain of glutathione transferase []. Thioredoxins have a beta-alpha unit preceding the motif common to all these proteins.  A number of eukaryotic proteins contain domains evolutionary related to thioredoxin, most of them are protein disulphide isomerases (PDI). PDI (5.3.4.1 from EC) [, , ] is an endoplasmic reticulum multi-functional enzyme that catalyses the formation and rearrangement of disulphide bonds during protein folding []. All PDI contains two or three (ERp72) copies of the thioredoxin domain, each of which contributes to disulphide isomerase activity, but which are functionally non-equivalent []. Moreover, PDI exhibits chaperone-like activity towards proteins that contain no disulphide bonds, i.e. behaving independently of its disulphide isomerase activity []. The various forms of PDI which are currently known are:   PDI major isozyme; a multifunctional protein that also function as the beta subunit of prolyl 4-hydroxylase (1.14.11.2 from EC), as a component of oligosaccharyl transferase (2.4.1.119 from EC), as thyroxine deiodinase (3.8.1.4 from EC), as glutathione-insulin transhydrogenase (1.8.4.2 from EC) and as a thyroid hormone-binding protein ERp60 (ER-60; 58 Kd microsomal protein). ERp60 was originally thought to be a phosphoinositide-specific phospholipase C isozyme and later to be a protease. ERp72. ERp5.    Bacterial proteins that act as thiol:disulphide interchange proteins that allows disulphide bond formation in some periplasmic proteins also contain a thioredoxin domain. These proteins include:    Escherichia coli DsbA (or PrfA) and its orthologs in Vibrio cholerae (TtcpG) and Haemophilus influenzae (Por). E. coli DsbC (or XpRA) and its orthologues in Erwinia chrysanthemi and H. influenzae. E. coli DsbD (or DipZ) and its H. influenzae orthologue. E. coli DsbE (or CcmG) and orthologues in H. influenzae.  Rhodobacter capsulatus (Rhodopseudomonas capsulata) (HelX), Rhiziobiacae (CycY and TlpA).   This entry represents the thioredoxin domain.; GO: 0045454 cell redox homeostasis; PDB: 3ED3_B 1EP7_A 1EP8_B 1TOF_A 2OE3_B 2OE1_B 2OE0_B 1V98_A 3H79_A 3CXG_A ....
Probab=57.03  E-value=31  Score=22.55  Aligned_cols=33  Identities=24%  Similarity=0.472  Sum_probs=22.7

Q ss_pred             CCeeEEEEEEEeCChhhHHHHHHhhHHHHHhccC
Q psy12257         29 IVKAKVALYMESLCPGCHQFIKHQLYPVFMKYSN   62 (145)
Q Consensus        29 ~~kV~V~vyyESlCPd~~~Fi~~qL~P~~~~l~d   62 (145)
                      ..+.-|-.||...||.|+.+. ..|..+...+.+
T Consensus        16 ~~~~vvv~f~~~~C~~C~~~~-~~~~~~~~~~~~   48 (103)
T PF00085_consen   16 SDKPVVVYFYAPWCPPCKAFK-PILEKLAKEYKD   48 (103)
T ss_dssp             TSSEEEEEEESTTSHHHHHHH-HHHHHHHHHTTT
T ss_pred             cCCCEEEEEeCCCCCcccccc-ceeccccccccc
Confidence            356677788889999999875 344444445554


No 37 
>PHA03050 glutaredoxin; Provisional
Probab=56.11  E-value=7.6  Score=27.90  Aligned_cols=17  Identities=29%  Similarity=0.804  Sum_probs=14.4

Q ss_pred             EEEEEEEeCChhhHHHH
Q psy12257         33 KVALYMESLCPGCHQFI   49 (145)
Q Consensus        33 ~V~vyyESlCPd~~~Fi   49 (145)
                      +|.||.-+-||+|++-.
T Consensus        14 ~V~vys~~~CPyC~~ak   30 (108)
T PHA03050         14 KVTIFVKFTCPFCRNAL   30 (108)
T ss_pred             CEEEEECCCChHHHHHH
Confidence            37889999999998754


No 38 
>TIGR02189 GlrX-like_plant Glutaredoxin-like family. This family of glutaredoxin-like proteins is aparrently limited to plants. Multiple isoforms are found in A. thaliana and O.sativa.
Probab=56.07  E-value=7.6  Score=27.22  Aligned_cols=18  Identities=28%  Similarity=0.587  Sum_probs=15.1

Q ss_pred             EEEEEEEeCChhhHHHHH
Q psy12257         33 KVALYMESLCPGCHQFIK   50 (145)
Q Consensus        33 ~V~vyyESlCPd~~~Fi~   50 (145)
                      +|.||.-+.||+|++.-.
T Consensus         9 ~Vvvysk~~Cp~C~~ak~   26 (99)
T TIGR02189         9 AVVIFSRSSCCMCHVVKR   26 (99)
T ss_pred             CEEEEECCCCHHHHHHHH
Confidence            388899999999997653


No 39 
>TIGR02196 GlrX_YruB Glutaredoxin-like protein, YruB-family. This glutaredoxin-like protein family contains the conserved CxxC motif and includes the Clostridium pasteurianum protein YruB which has been cloned from a rubredoxin operon. Somewhat related to NrdH, it is unknown whether this protein actually interacts with glutathione/glutathione reducatase, or, like NrdH, some other reductant system.
Probab=55.79  E-value=7  Score=24.06  Aligned_cols=15  Identities=33%  Similarity=0.897  Sum_probs=13.6

Q ss_pred             EEEEEEeCChhhHHH
Q psy12257         34 VALYMESLCPGCHQF   48 (145)
Q Consensus        34 V~vyyESlCPd~~~F   48 (145)
                      |++|+-+-||.|++.
T Consensus         2 i~lf~~~~C~~C~~~   16 (74)
T TIGR02196         2 VKVYTTPWCPPCKKA   16 (74)
T ss_pred             EEEEcCCCChhHHHH
Confidence            789999999999974


No 40 
>cd03009 TryX_like_TryX_NRX Tryparedoxin (TryX)-like family, TryX and nucleoredoxin (NRX) subfamily; TryX and NRX are thioredoxin (TRX)-like protein disulfide oxidoreductases that alter the redox state of target proteins via the reversible oxidation of an active center CXXC motif. TryX is involved in the regulation of oxidative stress in parasitic trypanosomatids by reducing TryX peroxidase, which in turn catalyzes the reduction of hydrogen peroxide and organic hydroperoxides. TryX derives reducing equivalents from reduced trypanothione, a polyamine peptide conjugate unique to trypanosomatids, which is regenerated by the NADPH-dependent flavoprotein trypanothione reductase. Vertebrate NRX is a 400-amino acid nuclear protein with one redox active TRX domain containing a CPPC active site motif followed by one redox inactive TRX-like domain. Mouse NRX transcripts are expressed in all adult tissues but is restricted to the nervous system and limb buds in embryos. Plant NRX, longer than the 
Probab=55.56  E-value=33  Score=24.19  Aligned_cols=41  Identities=20%  Similarity=0.412  Sum_probs=26.6

Q ss_pred             CeeEEEEEEEeCChhhHHHHHHhhHHHHHhccCc-eeEEEEee
Q psy12257         30 VKAKVALYMESLCPGCHQFIKHQLYPVFMKYSNY-IQLDLIPF   71 (145)
Q Consensus        30 ~kV~V~vyyESlCPd~~~Fi~~qL~P~~~~l~d~-idl~lvPf   71 (145)
                      .|+-|-.||-+-||.|++.+. .|..+++++.+. -+++++..
T Consensus        18 gk~vll~Fwa~wC~~C~~~~p-~l~~~~~~~~~~~~~~~vv~i   59 (131)
T cd03009          18 GKTVGLYFSASWCPPCRAFTP-KLVEFYEKLKESGKNFEIVFI   59 (131)
T ss_pred             CcEEEEEEECCCChHHHHHhH-HHHHHHHHHHhcCCCEEEEEE
Confidence            466677788899999998753 466666665432 24444443


No 41 
>PRK13728 conjugal transfer protein TrbB; Provisional
Probab=55.14  E-value=24  Score=27.97  Aligned_cols=34  Identities=35%  Similarity=0.773  Sum_probs=24.2

Q ss_pred             EEEEEEeCChhhHHHHHHhhHHHHHhccCceeEEEEeee
Q psy12257         34 VALYMESLCPGCHQFIKHQLYPVFMKYSNYIQLDLIPFG   72 (145)
Q Consensus        34 V~vyyESlCPd~~~Fi~~qL~P~~~~l~d~idl~lvPfG   72 (145)
                      |-+||.|-||.|+.++- .|..+++++    .+.++++.
T Consensus        73 lV~FwaswCp~C~~e~P-~L~~l~~~~----g~~Vi~Vs  106 (181)
T PRK13728         73 VVLFMQGHCPYCHQFDP-VLKQLAQQY----GFSVFPYT  106 (181)
T ss_pred             EEEEECCCCHhHHHHHH-HHHHHHHHc----CCEEEEEE
Confidence            67799999999999863 344444444    47777764


No 42 
>PRK11200 grxA glutaredoxin 1; Provisional
Probab=53.70  E-value=11  Score=25.12  Aligned_cols=17  Identities=24%  Similarity=0.446  Sum_probs=15.1

Q ss_pred             EEEEEEEeCChhhHHHH
Q psy12257         33 KVALYMESLCPGCHQFI   49 (145)
Q Consensus        33 ~V~vyyESlCPd~~~Fi   49 (145)
                      +|+||+-+-||.|++-.
T Consensus         2 ~v~iy~~~~C~~C~~a~   18 (85)
T PRK11200          2 FVVIFGRPGCPYCVRAK   18 (85)
T ss_pred             EEEEEeCCCChhHHHHH
Confidence            68999999999999765


No 43 
>cd02969 PRX_like1 Peroxiredoxin (PRX)-like 1 family; hypothetical proteins that show sequence similarity to PRXs. Members of this group contain a conserved cysteine that aligns to the first cysteine in the CXXC motif of TRX. This does not correspond to the peroxidatic cysteine found in PRXs, which aligns to the second cysteine in the CXXC motif of TRX. In addition, these proteins do not contain the other two conserved residues of the catalytic triad of PRX. PRXs confer a protective antioxidant role in cells through their peroxidase activity in which hydrogen peroxide, peroxynitrate, and organic hydroperoxides are reduced and detoxified using reducing equivalents derived from either thioredoxin, glutathione, trypanothione and AhpF.
Probab=53.63  E-value=31  Score=25.68  Aligned_cols=41  Identities=17%  Similarity=0.290  Sum_probs=29.0

Q ss_pred             CCeeEEEEEEEeCChhhHHHHHHhhHHHHHhccCceeEEEEee
Q psy12257         29 IVKAKVALYMESLCPGCHQFIKHQLYPVFMKYSNYIQLDLIPF   71 (145)
Q Consensus        29 ~~kV~V~vyyESlCPd~~~Fi~~qL~P~~~~l~d~idl~lvPf   71 (145)
                      ..++.|-.|+-+-||.|++-+ ..|...++++++ -++++|-+
T Consensus        24 ~~k~~ll~f~~t~Cp~c~~~~-~~l~~l~~~~~~-~~v~~v~i   64 (171)
T cd02969          24 DGKALVVMFICNHCPYVKAIE-DRLNRLAKEYGA-KGVAVVAI   64 (171)
T ss_pred             CCCEEEEEEECCCCccHHHHH-HHHHHHHHHHhh-CCeEEEEE
Confidence            567888889999999998775 467777777753 23444433


No 44 
>cd01659 TRX_superfamily Thioredoxin (TRX) superfamily; a large, diverse group of proteins containing a TRX-fold. Many members contain a classic TRX domain with a redox active CXXC motif. They function as protein disulfide oxidoreductases (PDOs), altering the redox state of target proteins via the reversible oxidation of their active site dithiol. The PDO members of this superfamily include TRX, protein disulfide isomerase (PDI), tlpA-like, glutaredoxin, NrdH redoxin, and the bacterial Dsb (DsbA, DsbC, DsbG, DsbE, DsbDgamma) protein families. Members of the superfamily that do not function as PDOs but contain a TRX-fold domain include phosducins, peroxiredoxins and glutathione (GSH) peroxidases, SCO proteins, GSH transferases (GST, N-terminal domain), arsenic reductases, TRX-like ferredoxins and calsequestrin, among others.
Probab=53.47  E-value=30  Score=19.11  Aligned_cols=35  Identities=14%  Similarity=0.410  Sum_probs=21.0

Q ss_pred             EEEEEEeCChhhHHHHHHhhHHHHHhccCceeEEEEe
Q psy12257         34 VALYMESLCPGCHQFIKHQLYPVFMKYSNYIQLDLIP   70 (145)
Q Consensus        34 V~vyyESlCPd~~~Fi~~qL~P~~~~l~d~idl~lvP   70 (145)
                      |.+|+.+-||.|++... ++... ....+.+++..+.
T Consensus         1 l~~~~~~~c~~c~~~~~-~~~~~-~~~~~~~~~~~~~   35 (69)
T cd01659           1 LVLFYAPWCPFCQALRP-VLAEL-ALLNKGVKFEAVD   35 (69)
T ss_pred             CEEEECCCChhHHhhhh-HHHHH-HhhCCCcEEEEEE
Confidence            35789999999998853 34333 3334444444443


No 45 
>TIGR02181 GRX_bact Glutaredoxin, GrxC family. This family of glutaredoxins includes the E. coli protein GrxC (Grx3) which appears to have a secondary role in reducing ribonucleotide reductase (in the absence of GrxA) possibly indicating a role in the reduction of other protein disulfides.
Probab=52.71  E-value=8.6  Score=24.99  Aligned_cols=16  Identities=31%  Similarity=0.812  Sum_probs=13.6

Q ss_pred             EEEEEEeCChhhHHHH
Q psy12257         34 VALYMESLCPGCHQFI   49 (145)
Q Consensus        34 V~vyyESlCPd~~~Fi   49 (145)
                      |+||..+-||+|.+-.
T Consensus         1 v~ly~~~~Cp~C~~a~   16 (79)
T TIGR02181         1 VTIYTKPYCPYCTRAK   16 (79)
T ss_pred             CEEEecCCChhHHHHH
Confidence            5789999999999754


No 46 
>TIGR02739 TraF type-F conjugative transfer system pilin assembly protein TraF. This protein is part of a large group of proteins involved in conjugative transfer of plasmid DNA, specifically the F-type system. This protein has been predicted to contain a thioredoxin fold and has been shown to be localized to the periplasm. Unlike the related protein TrbB (TIGR02738), TraF does not contain a conserved pair of cysteines and has been shown not to function as a thiol disulfide isomerase by complementation of an Ecoli DsbA defect. The protein is believed to be involved in pilin assembly. Even more closely related than TrbB is a clade of genes (TIGR02740) which do contain the CXXC motif, but it is unclear whether these genes are involved in type-F conjugation systems per se.
Probab=52.67  E-value=12  Score=31.12  Aligned_cols=38  Identities=13%  Similarity=0.337  Sum_probs=29.9

Q ss_pred             CeeEEEEEEEeCChhhHHHHHHhhHHHHHhccCceeEEEEeee
Q psy12257         30 VKAKVALYMESLCPGCHQFIKHQLYPVFMKYSNYIQLDLIPFG   72 (145)
Q Consensus        30 ~kV~V~vyyESlCPd~~~Fi~~qL~P~~~~l~d~idl~lvPfG   72 (145)
                      .+--+-+||+|.||.|+.     +.|+...+.+.-.|.++|+.
T Consensus       150 ~~~gL~fFy~~~C~~C~~-----~apil~~fa~~ygi~v~~VS  187 (256)
T TIGR02739       150 QSYGLFFFYRGKSPISQK-----MAPVIQAFAKEYGISVIPIS  187 (256)
T ss_pred             hceeEEEEECCCCchhHH-----HHHHHHHHHHHhCCeEEEEe
Confidence            457889999999999985     55666777777778888874


No 47 
>TIGR01126 pdi_dom protein disulfide-isomerase domain. This model describes a domain of eukaryotic protein disulfide isomerases, generally found in two copies. The high cutoff for total score reflects the expectation of finding both copies. The domain is similar to thioredoxin but the redox-active disulfide region motif is APWCGHCK.
Probab=52.67  E-value=33  Score=22.44  Aligned_cols=21  Identities=14%  Similarity=0.373  Sum_probs=18.9

Q ss_pred             CCeeEEEEEEEeCChhhHHHH
Q psy12257         29 IVKAKVALYMESLCPGCHQFI   49 (145)
Q Consensus        29 ~~kV~V~vyyESlCPd~~~Fi   49 (145)
                      ..++.+-.||.+-||.|+.+.
T Consensus        12 ~~~~~~i~f~~~~C~~c~~~~   32 (102)
T TIGR01126        12 SNKDVLVEFYAPWCGHCKNLA   32 (102)
T ss_pred             cCCcEEEEEECCCCHHHHhhC
Confidence            678889999999999999985


No 48 
>COG1651 DsbG Protein-disulfide isomerase [Posttranslational modification, protein turnover, chaperones]
Probab=52.65  E-value=27  Score=27.58  Aligned_cols=41  Identities=20%  Similarity=0.473  Sum_probs=25.2

Q ss_pred             CeeEEEEEEEeCChhhHHHHHHhhHHHHHhccCc-eeEEEEee
Q psy12257         30 VKAKVALYMESLCPGCHQFIKHQLYPVFMKYSNY-IQLDLIPF   71 (145)
Q Consensus        30 ~kV~V~vyyESlCPd~~~Fi~~qL~P~~~~l~d~-idl~lvPf   71 (145)
                      .+|.|.+|.+-.||.|.+.+- .|...+....+. ..++.+||
T Consensus        84 ~~v~v~~f~d~~Cp~C~~~~~-~l~~~~i~~~~~~~~~~~~~f  125 (244)
T COG1651          84 APVTVVEFFDYTCPYCKEAFP-ELKKKYIDDGKVRLVLREFPF  125 (244)
T ss_pred             CCceEEEEecCcCccHHHHHH-HHHHHhhhcCCCceEEEEeec
Confidence            489999999999999955443 333333333333 44444444


No 49 
>cd02976 NrdH NrdH-redoxin (NrdH) family; NrdH is a small monomeric protein with a conserved redox active CXXC motif within a TRX fold, characterized by a glutaredoxin (GRX)-like sequence and TRX-like activity profile. In vitro, it displays protein disulfide reductase activity that is dependent on TRX reductase, not glutathione (GSH). It is part of the NrdHIEF operon, where NrdEF codes for class Ib ribonucleotide reductase (RNR-Ib), an efficient enzyme at low oxygen levels. Under these conditions when GSH is mostly conjugated to spermidine, NrdH can still function and act as a hydrogen donor for RNR-Ib. It has been suggested that the NrdHEF system may be the oldest RNR reducing system, capable of functioning in a microaerophilic environment, where GSH was not yet available. NrdH from Corynebacterium ammoniagenes can form domain-swapped dimers, although it is unknown if this happens in vivo. Domain-swapped dimerization, which results in the blocking of the TRX reductase binding site, cou
Probab=52.27  E-value=11  Score=23.05  Aligned_cols=16  Identities=31%  Similarity=0.762  Sum_probs=13.8

Q ss_pred             EEEEEEEeCChhhHHH
Q psy12257         33 KVALYMESLCPGCHQF   48 (145)
Q Consensus        33 ~V~vyyESlCPd~~~F   48 (145)
                      +|.+|+.+-||+|++.
T Consensus         1 ~v~l~~~~~c~~c~~~   16 (73)
T cd02976           1 EVTVYTKPDCPYCKAT   16 (73)
T ss_pred             CEEEEeCCCChhHHHH
Confidence            3789999999999974


No 50 
>cd03008 TryX_like_RdCVF Tryparedoxin (TryX)-like family, Rod-derived cone viability factor (RdCVF) subfamily; RdCVF is a thioredoxin (TRX)-like protein specifically expressed in photoreceptors. RdCVF was isolated and identified as a factor that supports cone survival in retinal cultures. Cone photoreceptor loss is responsible for the visual handicap resulting from the inherited disease, retinitis pigmentosa. RdCVF shows 33% similarity to TRX but does not exhibit any detectable thiol oxidoreductase activity.
Probab=52.09  E-value=38  Score=25.71  Aligned_cols=32  Identities=16%  Similarity=0.466  Sum_probs=24.7

Q ss_pred             CeeEEEEEEEeCChhhHHHHHHhhHHHHHhccC
Q psy12257         30 VKAKVALYMESLCPGCHQFIKHQLYPVFMKYSN   62 (145)
Q Consensus        30 ~kV~V~vyyESlCPd~~~Fi~~qL~P~~~~l~d   62 (145)
                      .|+-+--|+-|-||.|+.++- .|..+|.++.+
T Consensus        25 gk~vlL~FwAsWCppCr~e~P-~L~~ly~~~~~   56 (146)
T cd03008          25 NRVLLLFFGAVVSPQCQLFAP-KLKDFFVRLTD   56 (146)
T ss_pred             CCEEEEEEECCCChhHHHHHH-HHHHHHHHHHh
Confidence            578888899999999999985 46666665543


No 51 
>cd02950 TxlA TRX-like protein A (TxlA) family; TxlA was originally isolated from the cyanobacterium Synechococcus. It is found only in oxygenic photosynthetic organisms. TRX is a small enzyme that participate in redox reactions, via the reversible oxidation of an active site dithiol present in a CXXC motif. Disruption of the txlA gene suggests that the protein is involved in the redox regulation  of the structure and function of photosynthetic apparatus. The plant homolog (designated as HCF164) is localized in the chloroplast and is involved in the assembly of the cytochrome b6f complex, which takes a central position in photosynthetic electron transport.
Probab=49.69  E-value=44  Score=24.65  Aligned_cols=36  Identities=14%  Similarity=0.338  Sum_probs=23.5

Q ss_pred             cCCeeEEEEEEEeCChhhHHHHHHhhHHHHHhccCce
Q psy12257         28 RIVKAKVALYMESLCPGCHQFIKHQLYPVFMKYSNYI   64 (145)
Q Consensus        28 ~~~kV~V~vyyESlCPd~~~Fi~~qL~P~~~~l~d~i   64 (145)
                      ...++-|-.||-+-||.|+.+.- .|..+.+.+.+.+
T Consensus        18 ~~gk~vvV~F~A~WC~~C~~~~p-~l~~l~~~~~~~~   53 (142)
T cd02950          18 SNGKPTLVEFYADWCTVCQEMAP-DVAKLKQKYGDQV   53 (142)
T ss_pred             hCCCEEEEEEECCcCHHHHHhHH-HHHHHHHHhccCe
Confidence            45677777889999999998753 3434444444433


No 52 
>cd03029 GRX_hybridPRX5 Glutaredoxin (GRX) family, PRX5 hybrid subfamily; composed of hybrid proteins containing peroxiredoxin (PRX) and GRX domains, which is found in some pathogenic bacteria and cyanobacteria. PRXs are thiol-specific antioxidant (TSA) proteins that confer a protective antioxidant role in cells through their peroxidase activity in which hydrogen peroxide, peroxynitrate, and organic hydroperoxides are reduced and detoxified using reducing equivalents derived from either thioredoxin, glutathione, trypanothione and AhpF. GRX is a glutathione (GSH) dependent reductase, catalyzing the disulfide reduction of target proteins. PRX-GRX hybrid proteins from Haemophilus influenza and Neisseria meningitis exhibit GSH-dependent peroxidase activity. The flow of reducing equivalents in the catalytic cycle of the hybrid protein goes from NADPH - GSH reductase - GSH - GRX domain of hybrid - PRX domain of hybrid - peroxide substrate.
Probab=48.73  E-value=15  Score=23.53  Aligned_cols=17  Identities=29%  Similarity=0.628  Sum_probs=14.8

Q ss_pred             EEEEEEEeCChhhHHHH
Q psy12257         33 KVALYMESLCPGCHQFI   49 (145)
Q Consensus        33 ~V~vyyESlCPd~~~Fi   49 (145)
                      +|.||.-+-||+|.+-.
T Consensus         2 ~v~lys~~~Cp~C~~ak   18 (72)
T cd03029           2 SVSLFTKPGCPFCARAK   18 (72)
T ss_pred             eEEEEECCCCHHHHHHH
Confidence            58899999999999763


No 53 
>PRK09381 trxA thioredoxin; Provisional
Probab=47.73  E-value=58  Score=22.09  Aligned_cols=34  Identities=15%  Similarity=0.246  Sum_probs=22.6

Q ss_pred             cCCeeEEEEEEEeCChhhHHHHHHhhHHHHHhccC
Q psy12257         28 RIVKAKVALYMESLCPGCHQFIKHQLYPVFMKYSN   62 (145)
Q Consensus        28 ~~~kV~V~vyyESlCPd~~~Fi~~qL~P~~~~l~d   62 (145)
                      ..++.-|-.||-+-||.|+.+.. .|..+.+++.+
T Consensus        19 ~~~~~vvv~f~~~~C~~C~~~~p-~~~~l~~~~~~   52 (109)
T PRK09381         19 KADGAILVDFWAEWCGPCKMIAP-ILDEIADEYQG   52 (109)
T ss_pred             cCCCeEEEEEECCCCHHHHHHhH-HHHHHHHHhCC
Confidence            34566688888999999998753 34444444444


No 54 
>COG0695 GrxC Glutaredoxin and related proteins [Posttranslational modification, protein turnover, chaperones]
Probab=47.66  E-value=12  Score=25.19  Aligned_cols=17  Identities=29%  Similarity=0.712  Sum_probs=14.6

Q ss_pred             EEEEEEEeCChhhHHHH
Q psy12257         33 KVALYMESLCPGCHQFI   49 (145)
Q Consensus        33 ~V~vyyESlCPd~~~Fi   49 (145)
                      +|+||.-+-||+|.+--
T Consensus         2 ~v~iyt~~~CPyC~~ak   18 (80)
T COG0695           2 NVTIYTKPGCPYCKRAK   18 (80)
T ss_pred             CEEEEECCCCchHHHHH
Confidence            48899999999999753


No 55 
>cd02961 PDI_a_family Protein Disulfide Isomerase (PDIa) family, redox active TRX domains; composed of eukaryotic proteins involved in oxidative protein folding in the endoplasmic reticulum (ER) by acting as catalysts and folding assistants. Members of this family include PDI and PDI-related proteins like ERp72, ERp57 (or ERp60), ERp44, P5, PDIR, ERp46 and the transmembrane PDIs. PDI, ERp57, ERp72, P5, PDIR and ERp46 are all oxidases, catalyzing the formation of disulfide bonds of newly synthesized polypeptides in the ER. They also exhibit reductase activity in acting as isomerases to correct any non-native disulfide bonds, as well as chaperone activity to prevent protein aggregation and facilitate the folding of newly synthesized proteins. These proteins usually contain multiple copies of a redox active TRX (a) domain containing a CXXC motif, and may also contain one or more redox inactive TRX-like (b) domains. Only one a domain is required for the oxidase function but multiple copies 
Probab=47.61  E-value=63  Score=20.55  Aligned_cols=30  Identities=10%  Similarity=0.253  Sum_probs=20.7

Q ss_pred             CeeEEEEEEEeCChhhHHHHHHhhHHHHHhc
Q psy12257         30 VKAKVALYMESLCPGCHQFIKHQLYPVFMKY   60 (145)
Q Consensus        30 ~kV~V~vyyESlCPd~~~Fi~~qL~P~~~~l   60 (145)
                      .+.-+-.||.+-||.|+.+.. .+..+.+.+
T Consensus        15 ~~~~~v~f~~~~C~~C~~~~~-~~~~~~~~~   44 (101)
T cd02961          15 SKDVLVEFYAPWCGHCKALAP-EYEKLAKEL   44 (101)
T ss_pred             CCcEEEEEECCCCHHHHhhhH-HHHHHHHHh
Confidence            336778888899999998864 344444444


No 56 
>cd02970 PRX_like2 Peroxiredoxin (PRX)-like 2 family; hypothetical proteins that show sequence similarity to PRXs. Members of this group contain a CXXC motif, similar to TRX. The second cysteine in the motif corresponds to the peroxidatic cysteine of PRX, however, these proteins do not contain the other two residues of the catalytic triad of PRX. PRXs confer a protective antioxidant role in cells through their peroxidase activity in which hydrogen peroxide, peroxynitrate, and organic hydroperoxides are reduced and detoxified using reducing equivalents derived from either thioredoxin, glutathione, trypanothione and AhpF. TRXs alter the redox state of target proteins by catalyzing the reduction of their disulfide bonds via the CXXC motif using reducing equivalents derived from either NADPH or ferredoxins.
Probab=47.37  E-value=51  Score=23.25  Aligned_cols=41  Identities=20%  Similarity=0.496  Sum_probs=26.1

Q ss_pred             CeeEEEEEEEeCChhhHHHHHHhhHHHHHhccCceeEEEEeee
Q psy12257         30 VKAKVALYMESLCPGCHQFIKHQLYPVFMKYSNYIQLDLIPFG   72 (145)
Q Consensus        30 ~kV~V~vyyESlCPd~~~Fi~~qL~P~~~~l~d~idl~lvPfG   72 (145)
                      .++-|-.|.-+-||.|++-+. .|...++++.+ -++.+|-.+
T Consensus        24 ~~~vl~f~~~~~Cp~C~~~~~-~l~~~~~~~~~-~~v~vv~V~   64 (149)
T cd02970          24 GPVVVVFYRGFGCPFCREYLR-ALSKLLPELDA-LGVELVAVG   64 (149)
T ss_pred             CCEEEEEECCCCChhHHHHHH-HHHHHHHHHHh-cCeEEEEEe
Confidence            444454455789999999875 57777776642 234555443


No 57 
>TIGR02183 GRXA Glutaredoxin, GrxA family. This model includes the E. coli glyutaredoxin GrxA which appears to have primary responsibility for the reduction of ribonucleotide reductase.
Probab=46.83  E-value=13  Score=25.04  Aligned_cols=16  Identities=25%  Similarity=0.542  Sum_probs=14.0

Q ss_pred             EEEEEEeCChhhHHHH
Q psy12257         34 VALYMESLCPGCHQFI   49 (145)
Q Consensus        34 V~vyyESlCPd~~~Fi   49 (145)
                      |.||..+-||+|.+--
T Consensus         2 V~vys~~~Cp~C~~ak   17 (86)
T TIGR02183         2 VVIFGRPGCPYCVRAK   17 (86)
T ss_pred             EEEEeCCCCccHHHHH
Confidence            7899999999999754


No 58 
>PF00578 AhpC-TSA:  AhpC/TSA family;  InterPro: IPR000866 Peroxiredoxins (Prxs) are a ubiquitous family of antioxidant enzymes that also control cytokine-induced peroxide levels which mediate signal transduction in mammalian cells. Prxs can be regulated by changes to phosphorylation, redox and possibly oligomerisation states. Prxs are divided into three classes: typical 2-Cys Prxs; atypical 2-Cys Prxs; and 1-Cys Prxs. All Prxs share the same basic catalytic mechanism, in which an active-site cysteine (the peroxidatic cysteine) is oxidised to a sulphenic acid by the peroxide substrate. The recycling of the sulphenic acid back to a thiol is what distinguishes the three enzyme classes. Using crystal structures, a detailed catalytic cycle has been derived for typical 2-Cys Prxs, including a model for the redox-regulated oligomeric state proposed to control enzyme activity []. Alkyl hydroperoxide reductase (AhpC) is responsible for directly reducing organic hyperoxides in its reduced dithiol form. Thiol specific antioxidant (TSA) is a physiologically important antioxidant which constitutes an enzymatic defence against sulphur-containing radicals. This family contains AhpC and TSA, as well as related proteins.; GO: 0016209 antioxidant activity, 0016491 oxidoreductase activity, 0055114 oxidation-reduction process; PDB: 1QMV_A 1PRX_B 3HJP_C 3HA9_A 2V41_G 2V32_C 2V2G_C 3LWA_A 3IA1_B 1ZYE_G ....
Probab=46.19  E-value=45  Score=22.75  Aligned_cols=40  Identities=25%  Similarity=0.453  Sum_probs=26.6

Q ss_pred             CeeEEEEEEEe-CChhhHHHHHHhhHHHHHhccC-ceeEEEEe
Q psy12257         30 VKAKVALYMES-LCPGCHQFIKHQLYPVFMKYSN-YIQLDLIP   70 (145)
Q Consensus        30 ~kV~V~vyyES-lCPd~~~Fi~~qL~P~~~~l~d-~idl~lvP   70 (145)
                      .|..|-++|.+ .||.|+.-+. +|...+.++++ .+++-.|-
T Consensus        25 gk~~vl~f~~~~~c~~c~~~l~-~l~~~~~~~~~~~~~vi~is   66 (124)
T PF00578_consen   25 GKPVVLFFWPTAWCPFCQAELP-ELNELYKKYKDKGVQVIGIS   66 (124)
T ss_dssp             TSEEEEEEESTTTSHHHHHHHH-HHHHHHHHHHTTTEEEEEEE
T ss_pred             CCcEEEEEeCccCccccccchh-HHHHHhhhhccceEEeeecc
Confidence            45666667777 9999998875 57777776654 34443333


No 59 
>cd03002 PDI_a_MPD1_like PDI family, MPD1-like subfamily; composed of eukaryotic proteins similar to Saccharomyces cerevisiae MPD1 protein, which contains a single redox active TRX domain located at the N-terminus, and an ER retention signal at the C-terminus indicative of an ER-resident protein. MPD1 has been shown to suppress the maturation defect of carboxypeptidase Y caused by deletion of the yeast PDI1 gene. Other characterized members of this subfamily include the Aspergillus niger prpA protein and Giardia PDI-1. PrpA is non-essential to strain viability, however, its transcript level is induced by heterologous protein expression suggesting a possible role in oxidative protein folding during high protein production. Giardia PDI-1 has the ability to refold scrambled RNase and exhibits transglutaminase activity.
Probab=44.86  E-value=62  Score=21.69  Aligned_cols=22  Identities=9%  Similarity=0.320  Sum_probs=17.9

Q ss_pred             cCCeeEEEEEEEeCChhhHHHH
Q psy12257         28 RIVKAKVALYMESLCPGCHQFI   49 (145)
Q Consensus        28 ~~~kV~V~vyyESlCPd~~~Fi   49 (145)
                      ...+.-|-.||-+-||.|+++.
T Consensus        16 ~~~~~~lv~f~a~wC~~C~~~~   37 (109)
T cd03002          16 NTNYTTLVEFYAPWCGHCKNLK   37 (109)
T ss_pred             cCCCeEEEEEECCCCHHHHhhC
Confidence            4567678889999999999765


No 60 
>cd02968 SCO SCO (an acronym for Synthesis of Cytochrome c Oxidase) family; composed of proteins similar to Sco1, a membrane-anchored protein possessing a soluble domain with a TRX fold. Members of this family are required for the proper assembly of cytochrome c oxidase (COX). They contain a metal binding motif, typically CXXXC, which is located in a flexible loop. COX, the terminal enzyme in the respiratory chain, is imbedded in the inner mitochondrial membrane of all eukaryotes and in the plasma membrane of some prokaryotes. It is composed of two subunits, COX I and COX II. It has been proposed that Sco1 specifically delivers copper to the CuA site, a dinuclear copper center, of the COX II subunit. Mutations in human Sco1 and Sco2 cause fatal infantile hepatoencephalomyopathy and cardioencephalomyopathy, respectively. Both disorders are associated with severe COX deficiency in affected tissues. More recently, it has been argued that the redox sensitivity of the copper binding properti
Probab=44.78  E-value=53  Score=23.14  Aligned_cols=34  Identities=15%  Similarity=0.280  Sum_probs=26.0

Q ss_pred             CCeeEEEEEEEeCChh-hHHHHHHhhHHHHHhccCc
Q psy12257         29 IVKAKVALYMESLCPG-CHQFIKHQLYPVFMKYSNY   63 (145)
Q Consensus        29 ~~kV~V~vyyESlCPd-~~~Fi~~qL~P~~~~l~d~   63 (145)
                      ..|+.|-+|+-+-||. |++-+. .|...+.++.+.
T Consensus        21 ~gk~~vl~f~~~~C~~~C~~~l~-~l~~~~~~~~~~   55 (142)
T cd02968          21 KGKPVLVYFGYTHCPDVCPTTLA-NLAQALKQLGAD   55 (142)
T ss_pred             CCCEEEEEEEcCCCcccCHHHHH-HHHHHHHHhhHh
Confidence            4577888889999998 998875 477777777553


No 61 
>TIGR01068 thioredoxin thioredoxin. Several proteins, such as protein disulfide isomerase, have two or more copies of a domain closely related to thioredoxin. This model is designed to recognize authentic thioredoxin, a small protein that should be hit exactly once by this model.
Probab=44.54  E-value=66  Score=20.78  Aligned_cols=33  Identities=15%  Similarity=0.242  Sum_probs=21.6

Q ss_pred             cCCeeEEEEEEEeCChhhHHHHHHhhHHHHHhcc
Q psy12257         28 RIVKAKVALYMESLCPGCHQFIKHQLYPVFMKYS   61 (145)
Q Consensus        28 ~~~kV~V~vyyESlCPd~~~Fi~~qL~P~~~~l~   61 (145)
                      ..++.-|-.||..-||.|+.+.. .|..+...+.
T Consensus        12 ~~~~~vvi~f~~~~C~~C~~~~~-~l~~~~~~~~   44 (101)
T TIGR01068        12 SSDKPVLVDFWAPWCGPCKMIAP-ILEELAKEYE   44 (101)
T ss_pred             hcCCcEEEEEECCCCHHHHHhCH-HHHHHHHHhc
Confidence            34556677888999999998853 3433333444


No 62 
>PTZ00051 thioredoxin; Provisional
Probab=44.12  E-value=75  Score=20.88  Aligned_cols=31  Identities=6%  Similarity=0.113  Sum_probs=21.9

Q ss_pred             cCCeeEEEEEEEeCChhhHHHHHHhhHHHHHh
Q psy12257         28 RIVKAKVALYMESLCPGCHQFIKHQLYPVFMK   59 (145)
Q Consensus        28 ~~~kV~V~vyyESlCPd~~~Fi~~qL~P~~~~   59 (145)
                      +..+.-+-.||.+-||.|+.+.. .|..+..+
T Consensus        16 ~~~~~vli~f~~~~C~~C~~~~~-~l~~l~~~   46 (98)
T PTZ00051         16 SQNELVIVDFYAEWCGPCKRIAP-FYEECSKE   46 (98)
T ss_pred             hcCCeEEEEEECCCCHHHHHHhH-HHHHHHHH
Confidence            45677788899999999998853 34333333


No 63 
>cd02966 TlpA_like_family TlpA-like family; composed of  TlpA, ResA, DsbE and similar proteins. TlpA, ResA and DsbE are bacterial protein disulfide reductases with important roles in cytochrome maturation. They are membrane-anchored proteins with a soluble TRX domain containing a CXXC motif located in the periplasm. The TRX domains of this family contain an insert, approximately 25 residues in length, which correspond to an extra alpha helix and a beta strand when compared with TRX. TlpA catalyzes an essential reaction in the biogenesis of cytochrome aa3, while ResA and DsbE are essential proteins in cytochrome c maturation. Also included in this family are proteins containing a TlpA-like TRX domain with domain architectures similar to E. coli DipZ protein, and the N-terminal TRX domain of PilB protein from Neisseria which acts as a disulfide reductase that can recylce methionine sulfoxide reductases.
Probab=43.88  E-value=77  Score=20.41  Aligned_cols=31  Identities=23%  Similarity=0.433  Sum_probs=22.4

Q ss_pred             CeeEEEEEEEeCChhhHHHHHHhhHHHHHhcc
Q psy12257         30 VKAKVALYMESLCPGCHQFIKHQLYPVFMKYS   61 (145)
Q Consensus        30 ~kV~V~vyyESlCPd~~~Fi~~qL~P~~~~l~   61 (145)
                      .|..|-.|+-+-||.|++++ ..|.....++.
T Consensus        19 ~k~~ll~f~~~~C~~C~~~~-~~l~~~~~~~~   49 (116)
T cd02966          19 GKVVLVNFWASWCPPCRAEM-PELEALAKEYK   49 (116)
T ss_pred             CCEEEEEeecccChhHHHHh-HHHHHHHHHhC
Confidence            56778888889999999875 34555555553


No 64 
>PRK10638 glutaredoxin 3; Provisional
Probab=43.59  E-value=23  Score=23.46  Aligned_cols=17  Identities=35%  Similarity=0.856  Sum_probs=14.8

Q ss_pred             EEEEEEEeCChhhHHHH
Q psy12257         33 KVALYMESLCPGCHQFI   49 (145)
Q Consensus        33 ~V~vyyESlCPd~~~Fi   49 (145)
                      +|++|..+-||.|++..
T Consensus         3 ~v~ly~~~~Cp~C~~a~   19 (83)
T PRK10638          3 NVEIYTKATCPFCHRAK   19 (83)
T ss_pred             cEEEEECCCChhHHHHH
Confidence            58899999999999764


No 65 
>PRK03147 thiol-disulfide oxidoreductase; Provisional
Probab=43.28  E-value=69  Score=23.39  Aligned_cols=32  Identities=16%  Similarity=0.362  Sum_probs=24.1

Q ss_pred             CeeEEEEEEEeCChhhHHHHHHhhHHHHHhccC
Q psy12257         30 VKAKVALYMESLCPGCHQFIKHQLYPVFMKYSN   62 (145)
Q Consensus        30 ~kV~V~vyyESlCPd~~~Fi~~qL~P~~~~l~d   62 (145)
                      .|..+-.||-+.||.|++.+ ..|.....++.+
T Consensus        61 ~k~~~l~f~a~~C~~C~~~~-~~l~~~~~~~~~   92 (173)
T PRK03147         61 GKGVFLNFWGTWCKPCEKEM-PYMNELYPKYKE   92 (173)
T ss_pred             CCEEEEEEECCcCHHHHHHH-HHHHHHHHHhhc
Confidence            46666788899999999876 467777766654


No 66 
>TIGR02187 GlrX_arch Glutaredoxin-like domain protein. This family of archaeal proteins contains a C-terminal domain with homology to bacterial and eukaryotic glutaredoxins, including a CPYC motif. There is an N-terminal domain which has even more distant homology to glutaredoxins. The name "glutaredoxin" may be inappropriate in the sense of working in tandem with glutathione and glutathione reductase which may not be present in the archaea. The overall domain structure appears to be related to bacterial alkylhydroperoxide reductases, but the homology may be distant enough that the function of this family is wholly different.
Probab=43.11  E-value=56  Score=25.62  Aligned_cols=21  Identities=14%  Similarity=0.420  Sum_probs=17.8

Q ss_pred             cCCeeEEEEEEEeCChhhHHH
Q psy12257         28 RIVKAKVALYMESLCPGCHQF   48 (145)
Q Consensus        28 ~~~kV~V~vyyESlCPd~~~F   48 (145)
                      ...+|.|.+|+-+-||.|...
T Consensus       131 ~~~pv~I~~F~a~~C~~C~~~  151 (215)
T TIGR02187       131 LDEPVRIEVFVTPTCPYCPYA  151 (215)
T ss_pred             cCCCcEEEEEECCCCCCcHHH
Confidence            356889999999999999954


No 67 
>cd03010 TlpA_like_DsbE TlpA-like family, DsbE (also known as CcmG and CycY) subfamily; DsbE is a membrane-anchored, periplasmic TRX-like reductase containing a CXXC motif that specifically donates reducing equivalents to apocytochrome c via CcmH, another cytochrome c maturation (Ccm) factor with a redox active CXXC motif. Assembly of cytochrome c requires the ligation of heme to reduced thiols of the apocytochrome. In bacteria, this assembly occurs in the periplasm. The reductase activity of DsbE in the oxidizing environment of the periplasm is crucial in the maturation of cytochrome c.
Probab=42.92  E-value=37  Score=23.70  Aligned_cols=20  Identities=20%  Similarity=0.218  Sum_probs=16.5

Q ss_pred             CeeEEEEEEEeCChhhHHHH
Q psy12257         30 VKAKVALYMESLCPGCHQFI   49 (145)
Q Consensus        30 ~kV~V~vyyESlCPd~~~Fi   49 (145)
                      .|+-|-.|+-+-||.|+..+
T Consensus        25 gk~vvv~F~a~~C~~C~~~~   44 (127)
T cd03010          25 GKPYLLNVWASWCAPCREEH   44 (127)
T ss_pred             CCEEEEEEEcCcCHHHHHHH
Confidence            46667788899999999875


No 68 
>cd03001 PDI_a_P5 PDIa family, P5 subfamily; composed of eukaryotic proteins similar to human P5, a PDI-related protein with a domain structure of aa'b (where a and a' are redox active TRX domains and b is a redox inactive TRX-like domain). Like PDI, P5 is located in the endoplasmic reticulum (ER) and displays both isomerase and chaperone activities, which are independent of each other. Compared to PDI, the isomerase and chaperone activities of P5 are lower. The first cysteine in the CXXC motif of both redox active domains in P5 is necessary for isomerase activity. The P5 gene was first isolated as an amplified gene from a hydroxyurea-resistant hamster cell line. The zebrafish P5 homolog has been implicated to play a critical role in establishing left/right asymmetries in the embryonic midline. Some members of this subfamily are P5-like proteins containing only one redox active TRX domain.
Probab=42.76  E-value=86  Score=20.61  Aligned_cols=22  Identities=9%  Similarity=0.288  Sum_probs=16.9

Q ss_pred             cCCeeEEEEEEEeCChhhHHHH
Q psy12257         28 RIVKAKVALYMESLCPGCHQFI   49 (145)
Q Consensus        28 ~~~kV~V~vyyESlCPd~~~Fi   49 (145)
                      ...+.-+-.+|-+-|+.|+.+.
T Consensus        16 ~~~~~vlv~f~a~~C~~C~~~~   37 (103)
T cd03001          16 NSDDVWLVEFYAPWCGHCKNLA   37 (103)
T ss_pred             cCCCcEEEEEECCCCHHHHHHh
Confidence            4455566678889999999885


No 69 
>PF08534 Redoxin:  Redoxin;  InterPro: IPR013740 This redoxin domain is found in peroxiredoxin, thioredoxin and glutaredoxin proteins. Peroxiredoxins (Prxs) constitute a family of thiol peroxidases that reduce hydrogen peroxide, peroxinitrite, and hydroperoxides using a strictly conserved cysteine []. Chloroplast thioredoxin systems in plants regulate the enzymes involved in photosynthetic carbon assimilation []. It is thought that redoxins have a large role to play in anti-oxidant defence. Cadmium-sensitive proteins are also regulated via thioredoxin and glutaredoxin thiol redox systems [].; GO: 0016491 oxidoreductase activity; PDB: 2H30_A 1TP9_A 1Y25_A 1XVQ_A 2B1K_A 2G0F_A 2B1L_B 3K8N_A 1Z5Y_E 3OR5_A ....
Probab=42.71  E-value=60  Score=23.12  Aligned_cols=40  Identities=23%  Similarity=0.354  Sum_probs=27.7

Q ss_pred             CCeeEEEEEEEe-CChhhHHHHHHhhHHHHHhccCc-eeEEEE
Q psy12257         29 IVKAKVALYMES-LCPGCHQFIKHQLYPVFMKYSNY-IQLDLI   69 (145)
Q Consensus        29 ~~kV~V~vyyES-lCPd~~~Fi~~qL~P~~~~l~d~-idl~lv   69 (145)
                      ..|+.|-.+|-+ -||.|+.-+. .|..+.+++.+. +++-.|
T Consensus        27 ~gk~~vv~f~~~~~Cp~C~~~~p-~l~~l~~~~~~~~v~~v~v   68 (146)
T PF08534_consen   27 KGKPVVVNFWASAWCPPCRKELP-YLNELQEKYKDKGVDVVGV   68 (146)
T ss_dssp             TTSEEEEEEESTTTSHHHHHHHH-HHHHHHHHHHTTTCEEEEE
T ss_pred             CCCeEEEEEEccCCCCcchhhhh-hHHhhhhhhccCceEEEEe
Confidence            356677788888 9999998876 666666554433 555555


No 70 
>cd02998 PDI_a_ERp38 PDIa family, endoplasmic reticulum protein 38 (ERp38) subfamily; composed of proteins similar to the P5-like protein first isolated from alfalfa, which contains two redox active TRX (a) domains at the N-terminus, like human P5, and a C-terminal domain with homology to the C-terminal domain of ERp29, unlike human P5. The cDNA clone of this protein (named G1) was isolated from an alfalfa cDNA library by screening with human protein disulfide isomerase (PDI) cDNA. The G1 protein is constitutively expressed in all major organs of the plant and its expression is induced by treatment with tunicamycin, indicating that it may be a glucose-regulated protein. The G1 homolog in the eukaryotic social amoeba Dictyostelium discoideum is also described as a P5-like protein, which is located in the endoplasmic reticulum (ER) despite the absence of an ER-retrieval signal. G1 homologs from Aspergillus niger and Neurospora crassa have also been characterized, and are named TIGA and ER
Probab=42.30  E-value=81  Score=20.63  Aligned_cols=23  Identities=13%  Similarity=0.251  Sum_probs=17.9

Q ss_pred             hcCCeeEEEEEEEeCChhhHHHH
Q psy12257         27 LRIVKAKVALYMESLCPGCHQFI   49 (145)
Q Consensus        27 ~~~~kV~V~vyyESlCPd~~~Fi   49 (145)
                      .+..+.-|-.||-+-||.|+++.
T Consensus        15 ~~~~~~~~v~f~a~~C~~C~~~~   37 (105)
T cd02998          15 GDDKKDVLVEFYAPWCGHCKNLA   37 (105)
T ss_pred             cCCCCcEEEEEECCCCHHHHhhC
Confidence            33455678889999999999874


No 71 
>cd03004 PDI_a_ERdj5_C PDIa family, C-terminal ERdj5 subfamily; ERdj5, also known as  JPDI and macrothioredoxin, is a protein containing an N-terminal DnaJ domain and four redox active TRX domains. This subfamily is composed of the three TRX domains located at the C-terminal half of the protein. ERdj5 is a ubiquitous protein localized in the endoplasmic reticulum (ER) and is abundant in secretory cells. It's transcription is induced during ER stress. It interacts with BiP through its DnaJ domain in an ATP-dependent manner. BiP, an ER-resident member of the Hsp70 chaperone family, functions in ER-associated degradation and protein translocation. Also included in the alignment is the single complete TRX domain of an uncharacterized protein from Tetraodon nigroviridis, which also contains a DnaJ domain at its N-terminus.
Probab=42.25  E-value=1e+02  Score=20.62  Aligned_cols=22  Identities=9%  Similarity=0.339  Sum_probs=17.4

Q ss_pred             cCCeeEEEEEEEeCChhhHHHH
Q psy12257         28 RIVKAKVALYMESLCPGCHQFI   49 (145)
Q Consensus        28 ~~~kV~V~vyyESlCPd~~~Fi   49 (145)
                      ...++-|-.||-+-||.|+++.
T Consensus        17 ~~~~~v~v~f~a~wC~~C~~~~   38 (104)
T cd03004          17 NRKEPWLVDFYAPWCGPCQALL   38 (104)
T ss_pred             cCCCeEEEEEECCCCHHHHHHH
Confidence            4456777789999999999863


No 72 
>PRK15317 alkyl hydroperoxide reductase subunit F; Provisional
Probab=41.69  E-value=51  Score=29.37  Aligned_cols=21  Identities=14%  Similarity=0.338  Sum_probs=18.5

Q ss_pred             CCeeEEEEEEEeCChhhHHHH
Q psy12257         29 IVKAKVALYMESLCPGCHQFI   49 (145)
Q Consensus        29 ~~kV~V~vyyESlCPd~~~Fi   49 (145)
                      ..+++|.+|+-.-||+|.+.+
T Consensus       115 ~~~~~i~~fv~~~Cp~Cp~~v  135 (517)
T PRK15317        115 DGDFHFETYVSLSCHNCPDVV  135 (517)
T ss_pred             CCCeEEEEEEcCCCCCcHHHH
Confidence            468999999999999999754


No 73 
>cd02992 PDI_a_QSOX PDIa family, Quiescin-sulfhydryl oxidase (QSOX) subfamily; QSOX is a eukaryotic protein containing an N-terminal redox active TRX domain, similar to that of PDI, and a small C-terminal flavin adenine dinucleotide (FAD)-binding domain homologous to the yeast ERV1p protein. QSOX oxidizes thiol groups to disulfides like PDI, however, unlike PDI, this oxidation is accompanied by the reduction of oxygen to hydrogen peroxide. QSOX is localized in high concentrations in cells with heavy secretory load and prefers peptides and proteins as substrates, not monothiols like glutathione. Inside the cell, QSOX is found in the endoplasmic reticulum and Golgi. The flow of reducing equivalents in a QSOX-catalyzed reaction goes from the dithiol substrate - dithiol of the QSOX TRX domain - dithiols of the QSOX ERV1p domain - FAD - oxygen.
Probab=41.33  E-value=1.1e+02  Score=21.48  Aligned_cols=23  Identities=22%  Similarity=0.377  Sum_probs=18.4

Q ss_pred             cCCeeEEEEEEEeCChhhHHHHH
Q psy12257         28 RIVKAKVALYMESLCPGCHQFIK   50 (145)
Q Consensus        28 ~~~kV~V~vyyESlCPd~~~Fi~   50 (145)
                      ...+.-|-.||-+-||.|+.+..
T Consensus        17 ~~~~~vvV~f~a~wC~~C~~~~~   39 (114)
T cd02992          17 GSPSAWLVEFYASWCGHCRAFAP   39 (114)
T ss_pred             cCCCeEEEEEECCCCHHHHHHhH
Confidence            44577788899999999998743


No 74 
>cd02953 DsbDgamma DsbD gamma family; DsbD gamma is the C-terminal periplasmic domain of the bacterial protein DsbD. It contains a CXXC motif in a TRX fold and shuttles the reducing potential from the membrane domain (DsbD beta) to the N-terminal periplasmic domain (DsbD alpha).  DsbD beta, a transmembrane domain comprising of eight helices, acquires its reducing potential from the cytoplasmic thioredoxin. DsbD alpha transfers the acquired reducing potential from DsbD gamma to target proteins such as the periplasmic protein disulphide isomerases, DsbC and DsbG. This flow of reducing potential from the cytoplasm through DsbD allows DsbC and DsbG to act as isomerases in the oxidizing environment of the bacterial periplasm. DsbD also transfers reducing potential from the cytoplasm to specific reductases in the periplasm which are involved in the maturation of cytochromes.
Probab=40.99  E-value=60  Score=21.85  Aligned_cols=23  Identities=17%  Similarity=0.192  Sum_probs=17.9

Q ss_pred             cCCeeEEEEEEEeCChhhHHHHH
Q psy12257         28 RIVKAKVALYMESLCPGCHQFIK   50 (145)
Q Consensus        28 ~~~kV~V~vyyESlCPd~~~Fi~   50 (145)
                      ...+.-+-.||-+-||.|+.+..
T Consensus         9 ~~~k~vlv~f~a~wC~~C~~~~~   31 (104)
T cd02953           9 AQGKPVFVDFTADWCVTCKVNEK   31 (104)
T ss_pred             HcCCeEEEEEEcchhHHHHHHHH
Confidence            34566677888999999999864


No 75 
>TIGR01295 PedC_BrcD bacteriocin transport accessory protein, putative. This model describes a small family of proteins believed to aid in the export of various class II bacteriocins, which are ribosomally-synthesized, non-lantibiotic bacterial peptide antibiotics. Members of this family are found in operons for pediocin PA-1 from Pediococcus acidilactici and brochocin-C from Brochothrix campestris.
Probab=40.40  E-value=24  Score=25.56  Aligned_cols=22  Identities=18%  Similarity=0.393  Sum_probs=17.0

Q ss_pred             cCCeeEEEEEEEeCChhhHHHH
Q psy12257         28 RIVKAKVALYMESLCPGCHQFI   49 (145)
Q Consensus        28 ~~~kV~V~vyyESlCPd~~~Fi   49 (145)
                      ...+.-|-.|+-+-||+|+.|-
T Consensus        21 ~~~~~~iv~f~~~~Cp~C~~~~   42 (122)
T TIGR01295        21 DKKETATFFIGRKTCPYCRKFS   42 (122)
T ss_pred             HcCCcEEEEEECCCChhHHHHh
Confidence            4455567789999999999774


No 76 
>KOG1752|consensus
Probab=40.31  E-value=18  Score=26.14  Aligned_cols=39  Identities=28%  Similarity=0.462  Sum_probs=25.2

Q ss_pred             EEEEEEEeCChhhHHHHHHhhHHHHHhccCceeEEEEeeee
Q psy12257         33 KVALYMESLCPGCHQFIKHQLYPVFMKYSNYIQLDLIPFGN   73 (145)
Q Consensus        33 ~V~vyyESlCPd~~~Fi~~qL~P~~~~l~d~idl~lvPfG~   73 (145)
                      +|-||.-|.||+|.+ +++ |+-.+.--...++|.-.|-|.
T Consensus        15 ~VVifSKs~C~~c~~-~k~-ll~~~~v~~~vvELD~~~~g~   53 (104)
T KOG1752|consen   15 PVVIFSKSSCPYCHR-AKE-LLSDLGVNPKVVELDEDEDGS   53 (104)
T ss_pred             CEEEEECCcCchHHH-HHH-HHHhCCCCCEEEEccCCCCcH
Confidence            377899999999998 554 433332233566766666553


No 77 
>PTZ00256 glutathione peroxidase; Provisional
Probab=40.07  E-value=65  Score=24.61  Aligned_cols=42  Identities=19%  Similarity=0.366  Sum_probs=27.4

Q ss_pred             cCCeeEEEEEEEeCChhhHHHHHHhhHHHHHhccCceeEEEEee
Q psy12257         28 RIVKAKVALYMESLCPGCHQFIKHQLYPVFMKYSNYIQLDLIPF   71 (145)
Q Consensus        28 ~~~kV~V~vyyESlCPd~~~Fi~~qL~P~~~~l~d~idl~lvPf   71 (145)
                      ...+|-|-+++-|-||.|++-+- .|...++++++. ++++|-+
T Consensus        39 ~Gk~vvlv~n~atwCp~C~~e~p-~l~~l~~~~~~~-gv~vv~v   80 (183)
T PTZ00256         39 KGKKAIIVVNVACKCGLTSDHYT-QLVELYKQYKSQ-GLEILAF   80 (183)
T ss_pred             CCCcEEEEEEECCCCCchHHHHH-HHHHHHHHHhhC-CcEEEEE
Confidence            44445566779999999998774 466666666542 3444444


No 78 
>cd02948 TRX_NDPK TRX domain, TRX and NDP-kinase (NDPK) fusion protein family; most members of this group are fusion proteins which contain one redox active TRX domain containing a CXXC motif and three NDPK domains, and are characterized as intermediate chains (ICs) of axonemal outer arm dynein. Dyneins are molecular motors that generate force against microtubules to produce cellular movement, and are divided into two classes: axonemal and cytoplasmic. They are supramolecular complexes consisting of three protein groups classified according to size: dynein heavy, intermediate and light chains. Axonemal dyneins form two structures, the inner and outer arms, which are attached to doublet microtubules throughout the cilia and flagella. The human homolog is the sperm-specific Sptrx-2, presumed to be a  component of the human sperm axoneme architecture. Included in this group is another human protein, TRX-like protein 2, a smaller fusion protein containing one TRX and one NDPK domain, which 
Probab=39.95  E-value=1.1e+02  Score=20.73  Aligned_cols=33  Identities=9%  Similarity=0.132  Sum_probs=23.6

Q ss_pred             cCCeeEEEEEEEeCChhhHHHHHHhhHHHHHhcc
Q psy12257         28 RIVKAKVALYMESLCPGCHQFIKHQLYPVFMKYS   61 (145)
Q Consensus        28 ~~~kV~V~vyyESlCPd~~~Fi~~qL~P~~~~l~   61 (145)
                      ...++-|-.||-+-||.|+.+.. .|.++...+.
T Consensus        15 ~~~~~vvv~F~a~wC~~Ck~~~p-~l~~~~~~~~   47 (102)
T cd02948          15 SNKGLTVVDVYQEWCGPCKAVVS-LFKKIKNELG   47 (102)
T ss_pred             ccCCeEEEEEECCcCHhHHHHhH-HHHHHHHHcC
Confidence            45677788899999999998754 3444445444


No 79 
>PRK10996 thioredoxin 2; Provisional
Probab=39.86  E-value=66  Score=23.51  Aligned_cols=34  Identities=18%  Similarity=0.193  Sum_probs=25.0

Q ss_pred             cCCeeEEEEEEEeCChhhHHHHHHhhHHHHHhccC
Q psy12257         28 RIVKAKVALYMESLCPGCHQFIKHQLYPVFMKYSN   62 (145)
Q Consensus        28 ~~~kV~V~vyyESlCPd~~~Fi~~qL~P~~~~l~d   62 (145)
                      ..++.-+-.||-+-||.|+.+.. .|..+..++.+
T Consensus        50 ~~~k~vvv~F~a~wC~~C~~~~~-~l~~l~~~~~~   83 (139)
T PRK10996         50 QDDLPVVIDFWAPWCGPCRNFAP-IFEDVAAERSG   83 (139)
T ss_pred             hCCCeEEEEEECCCCHHHHHHHH-HHHHHHHHhCC
Confidence            44677888999999999999864 45555555554


No 80 
>TIGR02540 gpx7 putative glutathione peroxidase Gpx7. This model represents one of several families of known and probable glutathione peroxidases. This family is restricted to animals and designated GPX7.
Probab=39.43  E-value=64  Score=23.58  Aligned_cols=40  Identities=15%  Similarity=0.140  Sum_probs=27.9

Q ss_pred             CeeEEEEEEEeCChhhHHHHHHhhHHHHHhccC-ceeEEEEe
Q psy12257         30 VKAKVALYMESLCPGCHQFIKHQLYPVFMKYSN-YIQLDLIP   70 (145)
Q Consensus        30 ~kV~V~vyyESlCPd~~~Fi~~qL~P~~~~l~d-~idl~lvP   70 (145)
                      .|+-|-+++-+-||.|++-+. .|...+.++++ -+.+--|+
T Consensus        22 Gk~vvv~~~as~C~~c~~~~~-~l~~l~~~~~~~~~~v~~i~   62 (153)
T TIGR02540        22 GKVSLVVNVASECGFTDQNYR-ALQELHRELGPSHFNVLAFP   62 (153)
T ss_pred             CCEEEEEEeCCCCCchhhhHH-HHHHHHHHHhhCCeEEEEEe
Confidence            466666799999999998875 57777777754 34443333


No 81 
>PF13098 Thioredoxin_2:  Thioredoxin-like domain; PDB: 1T3B_A 2L57_A 1EEJ_B 1TJD_A 1JZD_B 1JZO_A 1G0T_B 3GV1_A 1V58_A 2H0H_A ....
Probab=38.97  E-value=65  Score=21.77  Aligned_cols=26  Identities=31%  Similarity=0.732  Sum_probs=18.3

Q ss_pred             CCeeEEEEEEEeCChhhHHHHHHhhHH
Q psy12257         29 IVKAKVALYMESLCPGCHQFIKHQLYP   55 (145)
Q Consensus        29 ~~kV~V~vyyESlCPd~~~Fi~~qL~P   55 (145)
                      ..|-.|-+|+-.-||.|+.+-. +|.+
T Consensus         4 ~~k~~v~~F~~~~C~~C~~~~~-~~~~   29 (112)
T PF13098_consen    4 NGKPIVVVFTDPWCPYCKKLEK-ELFP   29 (112)
T ss_dssp             TSSEEEEEEE-TT-HHHHHHHH-HHHH
T ss_pred             CCCEEEEEEECCCCHHHHHHHH-HHHH
Confidence            4566788889999999999865 4554


No 82 
>cd02967 mauD Methylamine utilization (mau) D family; mauD protein is the translation product of the mauD gene found in methylotrophic bacteria, which are able to use methylamine as a sole carbon source and a nitrogen source. mauD is an essential accessory protein for the biosynthesis of methylamine dehydrogenase (MADH), the enzyme that catalyzes the oxidation of methylamine and other primary amines. MADH possesses an alpha2beta2 subunit structure; the alpha subunit is also referred to as the large subunit. Each beta (small) subunit contains a tryptophan tryptophylquinone (TTQ) prosthetic group. Accessory proteins are essential for the proper transport of MADH to the periplasm, TTQ synthesis and the formation of several structural disulfide bonds. Bacterial mutants containing an insertion on the mauD gene were unable to grow on methylamine as a sole carbon source, were found to lack the MADH small subunit and had decreased amounts of the MADH large subunit.
Probab=38.93  E-value=84  Score=21.21  Aligned_cols=32  Identities=9%  Similarity=0.437  Sum_probs=21.2

Q ss_pred             CeeEEEEEEEeCChhhHHHHHHhhHHHHHhccC
Q psy12257         30 VKAKVALYMESLCPGCHQFIKHQLYPVFMKYSN   62 (145)
Q Consensus        30 ~kV~V~vyyESlCPd~~~Fi~~qL~P~~~~l~d   62 (145)
                      .|+-|-.||-+-||.|+..+.. |..++++..+
T Consensus        21 gk~vvl~F~~~wC~~C~~~~p~-l~~~~~~~~~   52 (114)
T cd02967          21 GRPTLLFFLSPTCPVCKKLLPV-IRSIARAEAD   52 (114)
T ss_pred             CCeEEEEEECCCCcchHhHhHH-HHHHHHHhcC
Confidence            5666777899999999987532 4444444433


No 83 
>cd02993 PDI_a_APS_reductase PDIa family, 5'-Adenylylsulfate (APS) reductase subfamily; composed of plant-type APS reductases containing a C-terminal redox active TRX domain and an N-terminal reductase domain which is part of a superfamily that includes N type ATP PPases. APS reductase catalyzes the reduction of activated sulfate to sulfite, a key step in the biosynthesis of sulfur-containing metabolites. Sulfate is first activated by ATP sulfurylase, forming APS, which can be phosphorylated to 3'-phosphoadenosine-5'-phosphosulfate (PAPS). Depending on the organism, either APS or PAPS can be used for sulfate reduction. Prokaryotes and fungi use PAPS, whereas plants use both APS and PAPS. Since plant-type APS reductase uses glutathione (GSH) as its electron donor, the C-terminal domain may function like glutaredoxin, a GSH-dependent member of the TRX superfamily. The flow of reducing equivalents goes from GSH - C-terminal TRX domain - N-terminal reductase domain - APS. Plant-type APS red
Probab=38.54  E-value=86  Score=21.54  Aligned_cols=22  Identities=18%  Similarity=0.475  Sum_probs=18.2

Q ss_pred             cCCeeEEEEEEEeCChhhHHHH
Q psy12257         28 RIVKAKVALYMESLCPGCHQFI   49 (145)
Q Consensus        28 ~~~kV~V~vyyESlCPd~~~Fi   49 (145)
                      ..+++-+-.||-+-||.|+++.
T Consensus        19 ~~~k~vlv~f~a~wC~~C~~~~   40 (109)
T cd02993          19 RRNQSTLVVLYAPWCPFCQAME   40 (109)
T ss_pred             hcCCCEEEEEECCCCHHHHHHh
Confidence            3567888889999999999764


No 84 
>PRK10329 glutaredoxin-like protein; Provisional
Probab=38.44  E-value=26  Score=23.59  Aligned_cols=15  Identities=27%  Similarity=0.882  Sum_probs=13.7

Q ss_pred             EEEEEEEeCChhhHH
Q psy12257         33 KVALYMESLCPGCHQ   47 (145)
Q Consensus        33 ~V~vyyESlCPd~~~   47 (145)
                      +|+||.-+-||+|.+
T Consensus         2 ~v~lYt~~~Cp~C~~   16 (81)
T PRK10329          2 RITIYTRNDCVQCHA   16 (81)
T ss_pred             EEEEEeCCCCHhHHH
Confidence            588999999999997


No 85 
>TIGR02738 TrbB type-F conjugative transfer system pilin assembly thiol-disulfide isomerase TrbB. This protein is part of a large group of proteins involved in conjugative transfer of plasmid DNA, specifically the F-type system. This protein has been predicted to contain a thioredoxin fold, contains a conserved pair of cysteines and has been shown to function as a thiol disulfide isomerase by complementation of an Ecoli DsbA defect. The protein is believed to be involved in pilin assembly. The protein is closely related to TraF (TIGR02739) which is somewhat longer, lacks the cysteine motif and is apparently not functional as a disulfide bond isomerase.
Probab=37.83  E-value=40  Score=25.62  Aligned_cols=19  Identities=37%  Similarity=0.891  Sum_probs=15.9

Q ss_pred             eeEEEEEEEeCChhhHHHH
Q psy12257         31 KAKVALYMESLCPGCHQFI   49 (145)
Q Consensus        31 kV~V~vyyESlCPd~~~Fi   49 (145)
                      +..|-.||.|-||.|++.+
T Consensus        51 ~~~lvnFWAsWCppCr~e~   69 (153)
T TIGR02738        51 DYALVFFYQSTCPYCHQFA   69 (153)
T ss_pred             CCEEEEEECCCChhHHHHH
Confidence            4448889999999999885


No 86 
>cd03022 DsbA_HCCA_Iso DsbA family, 2-hydroxychromene-2-carboxylate (HCCA) isomerase subfamily; HCCA isomerase is a glutathione (GSH) dependent enzyme involved in the naphthalene catabolic pathway. It converts HCCA, a hemiketal formed spontaneously after ring cleavage of 1,2-dihydroxynapthalene by a dioxygenase, into cis-o-hydroxybenzylidenepyruvate (cHBPA). This is the fourth reaction in a six-step pathway that converts napthalene into salicylate. HCCA isomerase is unique to bacteria that degrade polycyclic aromatic compounds. It is closely related to the eukaryotic protein, GSH transferase kappa (GSTK).
Probab=37.80  E-value=59  Score=24.17  Aligned_cols=35  Identities=11%  Similarity=0.173  Sum_probs=24.2

Q ss_pred             EEEEEEeCChhhHHHHHHhhHHHHHhccCceeEEEEee
Q psy12257         34 VALYMESLCPGCHQFIKHQLYPVFMKYSNYIQLDLIPF   71 (145)
Q Consensus        34 V~vyyESlCPd~~~Fi~~qL~P~~~~l~d~idl~lvPf   71 (145)
                      |++|+--.||.|--... .|..+...+.  ++|++.||
T Consensus         1 i~~~~D~~cP~cy~~~~-~l~~~~~~~~--~~i~~~p~   35 (192)
T cd03022           1 IDFYFDFSSPYSYLAHE-RLPALAARHG--ATVRYRPI   35 (192)
T ss_pred             CeEEEeCCChHHHHHHH-HHHHHHHHhC--CeeEEeee
Confidence            57899999999976543 3444433443  77888888


No 87 
>PF13192 Thioredoxin_3:  Thioredoxin domain; PDB: 1ZYP_B 1ZYN_A 1HYU_A 1ILO_A 1J08_F 2YWM_B 2AYT_B 2HLS_B 1A8L_A 2K8S_B ....
Probab=37.36  E-value=1.1e+02  Score=19.87  Aligned_cols=35  Identities=20%  Similarity=0.497  Sum_probs=20.7

Q ss_pred             eEEEEEEEeCChhhHHHHHHhhHHHHHhccCceeEEEEe
Q psy12257         32 AKVALYMESLCPGCHQFIKHQLYPVFMKYSNYIQLDLIP   70 (145)
Q Consensus        32 V~V~vyyESlCPd~~~Fi~~qL~P~~~~l~d~idl~lvP   70 (145)
                      ++|.+ +-+-||.|.+... -+..+...+ + ++++++-
T Consensus         1 m~I~v-~~~~C~~C~~~~~-~~~~~~~~~-~-i~~ei~~   35 (76)
T PF13192_consen    1 MKIKV-FSPGCPYCPELVQ-LLKEAAEEL-G-IEVEIID   35 (76)
T ss_dssp             EEEEE-ECSSCTTHHHHHH-HHHHHHHHT-T-EEEEEEE
T ss_pred             CEEEE-eCCCCCCcHHHHH-HHHHHHHhc-C-CeEEEEE
Confidence            56788 5666999995542 233344444 3 6665554


No 88 
>cd02999 PDI_a_ERp44_like PDIa family, endoplasmic reticulum protein 44 (ERp44)-like subfamily; composed of uncharacterized PDI-like eukaryotic proteins containing only one redox active TRX (a) domain with a CXXS motif, similar to ERp44. CXXS is still a redox active motif; however, the mixed disulfide formed with the substrate is more stable than those formed by CXXC motif proteins. PDI-related proteins are usually involved in the oxidative protein folding in the ER by acting as catalysts and folding assistants. ERp44 is involved in thiol-mediated retention in the ER.
Probab=36.28  E-value=1.2e+02  Score=20.77  Aligned_cols=22  Identities=23%  Similarity=0.350  Sum_probs=18.7

Q ss_pred             cCCeeEEEEEEEeCChhhHHHH
Q psy12257         28 RIVKAKVALYMESLCPGCHQFI   49 (145)
Q Consensus        28 ~~~kV~V~vyyESlCPd~~~Fi   49 (145)
                      ...++-|-.||-+-||.|+++.
T Consensus        16 ~~g~~vlV~F~a~WC~~C~~~~   37 (100)
T cd02999          16 NREDYTAVLFYASWCPFSASFR   37 (100)
T ss_pred             cCCCEEEEEEECCCCHHHHhHh
Confidence            5578888899999999999764


No 89 
>TIGR02194 GlrX_NrdH Glutaredoxin-like protein NrdH. NrdH-redoxin is a representative of a class of small redox proteins that contain a conserved CXXC motif and are characterized by a glutaredoxin-like amino acid sequence and thioredoxin-like activity profile. Unlike other the glutaredoxins to which it is most closely related, NrdH aparrently does not interact with glutathione/glutathione reductase, but rather with thioredoxin reductase to catalyze the reduction of ribonucleotide reductase.
Probab=35.49  E-value=23  Score=22.78  Aligned_cols=16  Identities=19%  Similarity=0.553  Sum_probs=13.5

Q ss_pred             EEEEEEeCChhhHHHH
Q psy12257         34 VALYMESLCPGCHQFI   49 (145)
Q Consensus        34 V~vyyESlCPd~~~Fi   49 (145)
                      |+||.-+-||.|++-.
T Consensus         1 v~ly~~~~Cp~C~~ak   16 (72)
T TIGR02194         1 ITVYSKNNCVQCKMTK   16 (72)
T ss_pred             CEEEeCCCCHHHHHHH
Confidence            5789999999999754


No 90 
>COG2761 FrnE Predicted dithiol-disulfide isomerase involved in polyketide biosynthesis [Secondary metabolites biosynthesis, transport, and catabolism]
Probab=35.48  E-value=67  Score=26.48  Aligned_cols=112  Identities=14%  Similarity=0.155  Sum_probs=61.8

Q ss_pred             cCCeeEEEEEEEeCChhhHHHHHHhhHHHHHhccCc--eeEEEEeeeeceeecCC-------------------------
Q psy12257         28 RIVKAKVALYMESLCPGCHQFIKHQLYPVFMKYSNY--IQLDLIPFGNARHTKNS-------------------------   80 (145)
Q Consensus        28 ~~~kV~V~vyyESlCPd~~~Fi~~qL~P~~~~l~d~--idl~lvPfG~a~~~~~~-------------------------   80 (145)
                      ...+|+|+||..=.||.|--. ...|-.+...+.+.  +++..-||=-.-.....                         
T Consensus         2 ~~~~i~I~v~sD~vCPwC~ig-~~rL~ka~~~~~~~~~v~i~w~pf~l~p~~~~~g~~~~~~l~~k~g~~~~~~~~~~~~   80 (225)
T COG2761           2 NPMKIEIDVFSDVVCPWCYIG-KRRLEKALAEYPQEVRVEIRWRPFELDPDLPPEGLDRKEYLAQKYGISEEQKAAHARL   80 (225)
T ss_pred             CCceEEEEEEeCCcCchhhcC-HHHHHHHHHhcCcceeEEEEecccccCCCCCcccccHHHHHHHHhCccHHHHHHHHHH
Confidence            457899999999999999643 23455566666654  44455565422111100                         


Q ss_pred             -------CCCcceeeeCChhhhccChHhHHHhhhhcCCCcc-ccceeeeeccccCC-----CCchhhHHHHhhhcCCC
Q psy12257         81 -------DGTWEFKCQHGEPECFGNLYLACATHLLQASRPK-HLIRYYNCMASASS-----FSIEKDVKQVTEMGRVS  145 (145)
Q Consensus        81 -------~g~~~f~CQHG~~EC~gN~~~aCal~~~~~~~~~-~~l~fI~Cm~~~~~-----~~~~~~~~~c~~~~~l~  145 (145)
                             +..+.|.=    .-=..|.+.||-+.+.. ..+. .+..|+.=+.+.+.     -..+.-.-++|+.+||.
T Consensus        81 ~~~~~~~Gi~~~f~~----~~~~~nt~~Ah~l~~~A-~~~G~~~~~~~~~lf~AyF~eg~nI~D~dVL~diA~~~GLD  153 (225)
T COG2761          81 EELAEEEGIDFNFDA----IVPAPNTLDAHRLIKAA-ELQGKAQDRFLEALFEAYFEEGRNIGDEDVLADIAEEVGLD  153 (225)
T ss_pred             HHhhHhcCcccchhh----ccCCCchHHHHHHHHHH-HHhCchHHHHHHHHHHHHhccCCCCCcHHHHHHHHHHhCCC
Confidence                   00011100    00234667888766652 2223 46666665555442     23345578888888874


No 91 
>cd02956 ybbN ybbN protein family; ybbN is a hypothetical protein containing a redox-inactive TRX-like domain. Its gene has been sequenced from several gammaproteobacteria and actinobacteria.
Probab=35.33  E-value=1.3e+02  Score=19.67  Aligned_cols=22  Identities=9%  Similarity=0.149  Sum_probs=17.7

Q ss_pred             cCCeeEEEEEEEeCChhhHHHH
Q psy12257         28 RIVKAKVALYMESLCPGCHQFI   49 (145)
Q Consensus        28 ~~~kV~V~vyyESlCPd~~~Fi   49 (145)
                      +..++-|-.||-+-||.|+.+.
T Consensus        10 ~~~~~vlv~f~a~wC~~C~~~~   31 (96)
T cd02956          10 STQVPVVVDFWAPRSPPSKELL   31 (96)
T ss_pred             cCCCeEEEEEECCCChHHHHHH
Confidence            3366778889999999999764


No 92 
>TIGR02740 TraF-like TraF-like protein. This protein is related to the F-type conjugation system pilus assembly proteins TraF (TIGR02739)and TrbB (TIGR02738) both of which exhibit a thioredoxin fold. The protein represented by this model has the same length and architecture as TraF, but lacks the CXXC-motif found in TrbB and believed to be responsible for the disulfide isomerase activity of that protein.
Probab=33.69  E-value=49  Score=27.41  Aligned_cols=38  Identities=24%  Similarity=0.654  Sum_probs=25.0

Q ss_pred             CeeEEEEEEEeCChhhHHHHHHhhHHHHHhccCceeEEEEeee
Q psy12257         30 VKAKVALYMESLCPGCHQFIKHQLYPVFMKYSNYIQLDLIPFG   72 (145)
Q Consensus        30 ~kV~V~vyyESlCPd~~~Fi~~qL~P~~~~l~d~idl~lvPfG   72 (145)
                      .++-|-.||.+-||.|+.+.     |++..+.+...+++++..
T Consensus       166 ~k~~Lv~F~AswCp~C~~~~-----P~L~~la~~yg~~Vi~Vs  203 (271)
T TIGR02740       166 KKSGLFFFFKSDCPYCHQQA-----PILQAFEDRYGIEVLPVS  203 (271)
T ss_pred             CCeEEEEEECCCCccHHHHh-----HHHHHHHHHcCcEEEEEe
Confidence            56778889999999999753     444444333346666653


No 93 
>cd02997 PDI_a_PDIR PDIa family, PDIR subfamily; composed of proteins similar to human PDIR (for Protein Disulfide Isomerase Related). PDIR is composed of three redox active TRX (a) domains and an N-terminal redox inactive TRX-like (b) domain. Similar to PDI, it is involved in oxidative protein folding in the endoplasmic reticulum (ER) through its isomerase and chaperone activities. These activities are lower compared to PDI, probably due to PDIR acting only on a subset of proteins. PDIR is preferentially expressed in cells actively secreting proteins and its expression is induced by stress. Similar to PDI, the isomerase and chaperone activities of PDIR are independent; CXXC mutants lacking isomerase activity retain chaperone activity.
Probab=33.64  E-value=74  Score=20.91  Aligned_cols=31  Identities=10%  Similarity=0.311  Sum_probs=20.5

Q ss_pred             CeeEEEEEEEeCChhhHHHHHHhhHHHHHhcc
Q psy12257         30 VKAKVALYMESLCPGCHQFIKHQLYPVFMKYS   61 (145)
Q Consensus        30 ~kV~V~vyyESlCPd~~~Fi~~qL~P~~~~l~   61 (145)
                      .+.-+-.||-+-||.|+.+.. .+..+...+.
T Consensus        17 ~~~~~v~f~a~wC~~C~~~~~-~~~~~~~~~~   47 (104)
T cd02997          17 EKHVLVMFYAPWCGHCKKMKP-EFTKAATELK   47 (104)
T ss_pred             CCCEEEEEECCCCHHHHHhCH-HHHHHHHHHh
Confidence            446688899999999998853 2333333343


No 94 
>KOG2613|consensus
Probab=33.05  E-value=34  Score=31.10  Aligned_cols=20  Identities=15%  Similarity=0.627  Sum_probs=15.9

Q ss_pred             CChhhHHHHHHhhHHHHHhc
Q psy12257         41 LCPGCHQFIKHQLYPVFMKY   60 (145)
Q Consensus        41 lCPd~~~Fi~~qL~P~~~~l   60 (145)
                      +||||.|+-..+.|.+.-.+
T Consensus       139 ~C~DC~R~eakdfW~a~vQv  158 (502)
T KOG2613|consen  139 QCPDCARVEAKDFWRALVQV  158 (502)
T ss_pred             cCchhhhhhhhHHHHHHHHH
Confidence            59999999888888765443


No 95 
>cd03006 PDI_a_EFP1_N PDIa family, N-terminal EFP1 subfamily; EFP1 is a binding partner protein of thyroid oxidase (ThOX), also called Duox. ThOX proteins are responsible for the generation of hydrogen peroxide, a crucial substrate of thyroperoxidase, which functions to iodinate thyroglobulin and synthesize thyroid hormones. EFP1 was isolated through a yeast two-hybrid method using the EF-hand fragment of dog Duox1 as a bait. It could be one of the partners in the assembly of a multiprotein complex constituting the thyroid hydrogen peroxide generating system. EFP1 contains two TRX domains related to the redox active TRX domains of protein disulfide isomerase (PDI). This subfamily is composed of the N-terminal TRX domain of EFP1, which contains a CXXS sequence in place of the typical CXXC motif, similar to ERp44. The CXXS motif allows the formation of stable mixed disulfides, crucial for the ER-retention function of ERp44.
Probab=32.94  E-value=1.8e+02  Score=20.71  Aligned_cols=30  Identities=7%  Similarity=0.056  Sum_probs=22.6

Q ss_pred             hcCCeeEEEEEEEeCChhhHHHHHHhhHHHHHhcc
Q psy12257         27 LRIVKAKVALYMESLCPGCHQFIKHQLYPVFMKYS   61 (145)
Q Consensus        27 ~~~~kV~V~vyyESlCPd~~~Fi~~qL~P~~~~l~   61 (145)
                      ....++-|-.||-+-|+.|+.+     .|.|+++.
T Consensus        26 ~~~~~~vlV~FyA~WC~~Ck~l-----~p~~~~la   55 (113)
T cd03006          26 RTDAEVSLVMYYAPWDAQSQAA-----RQEFEQVA   55 (113)
T ss_pred             ccCCCEEEEEEECCCCHHHHHH-----HHHHHHHH
Confidence            4667888999999999999964     45554443


No 96 
>cd02951 SoxW SoxW family; SoxW is a bacterial periplasmic TRX, containing a redox active CXXC motif, encoded by a genetic locus (sox operon) involved in thiosulfate oxidation. Sulfur bacteria oxidize sulfur compounds to provide reducing equivalents for carbon dioxide fixation during autotrophic growth and the respiratory electron transport chain. It is unclear what the role of SoxW is, since it has been found to be dispensable in the oxidation of thiosulfate to sulfate. SoxW is specifically kept in the reduced state by SoxV, which is essential in thiosulfate oxidation.
Probab=32.72  E-value=1.2e+02  Score=21.05  Aligned_cols=20  Identities=25%  Similarity=0.642  Sum_probs=17.2

Q ss_pred             eeEEEEEEEeCChhhHHHHH
Q psy12257         31 KAKVALYMESLCPGCHQFIK   50 (145)
Q Consensus        31 kV~V~vyyESlCPd~~~Fi~   50 (145)
                      |+-+-.||.+-||.|+++..
T Consensus        15 k~vlv~f~a~wC~~C~~~~~   34 (125)
T cd02951          15 KPLLLLFSQPGCPYCDKLKR   34 (125)
T ss_pred             CcEEEEEeCCCCHHHHHHHH
Confidence            67777889999999999864


No 97 
>cd03040 GST_N_mPGES2 GST_N family; microsomal Prostaglandin E synthase Type 2 (mPGES2) subfamily; mPGES2 is a membrane-anchored dimeric protein containing a CXXC motif which catalyzes the isomerization of PGH2 to PGE2. Unlike cytosolic PGE synthase (cPGES) and microsomal PGES Type 1 (mPGES1), mPGES2 does not require glutathione (GSH) for its activity, although its catalytic rate is increased two- to four-fold in the presence of DTT, GSH or other thiol compounds. PGE2 is widely distributed in various tissues and is implicated in the sleep/wake cycle, relaxation/contraction of smooth muscle, excretion of sodium ions, maintenance of body temperature and mediation of inflammation. mPGES2 contains an N-terminal hydrophobic domain which is membrane associated, and a C-terminal soluble domain with a GST-like structure.
Probab=32.60  E-value=32  Score=21.97  Aligned_cols=17  Identities=35%  Similarity=0.727  Sum_probs=14.5

Q ss_pred             EEEEEEEeCChhhHHHH
Q psy12257         33 KVALYMESLCPGCHQFI   49 (145)
Q Consensus        33 ~V~vyyESlCPd~~~Fi   49 (145)
                      ++++|+-..||.|++-.
T Consensus         1 ~i~Ly~~~~~p~c~kv~   17 (77)
T cd03040           1 KITLYQYKTCPFCCKVR   17 (77)
T ss_pred             CEEEEEcCCCHHHHHHH
Confidence            47889999999999764


No 98 
>cd02957 Phd_like Phosducin (Phd)-like family; composed of Phd and Phd-like proteins (PhLP), characterized as cytosolic regulators of G protein functions. Phd and PhLPs specifically bind G protein betagamma (Gbg)-subunits with high affinity, resulting in the solubilization of Gbg from the plasma membrane and impeding G protein-mediated signal transduction by inhibiting the formation of a functional G protein trimer (G protein alphabetagamma). Phd also inhibits the GTPase activity of G protein alpha. Phd can be phosphorylated by protein kinase A and G protein-coupled receptor kinase 2, leading to its inactivation. Phd was originally isolated from the retina, where it is highly expressed and has been implicated to play an important role in light adaptation. It is also found in the pineal gland, liver, spleen, striated muscle and the brain. The C-terminal domain of Phd adopts a thioredoxin fold, but it does not contain a CXXC motif. Phd interacts with G protein beta mostly through the N-te
Probab=32.57  E-value=73  Score=22.11  Aligned_cols=18  Identities=22%  Similarity=0.407  Sum_probs=14.7

Q ss_pred             eeEEEEEEEeCChhhHHH
Q psy12257         31 KAKVALYMESLCPGCHQF   48 (145)
Q Consensus        31 kV~V~vyyESlCPd~~~F   48 (145)
                      +.-|-.||.+-||.|+.+
T Consensus        25 ~~vvv~F~a~~c~~C~~l   42 (113)
T cd02957          25 TRVVVHFYEPGFPRCKIL   42 (113)
T ss_pred             CEEEEEEeCCCCCcHHHH
Confidence            566678999999999953


No 99 
>COG4545 Glutaredoxin-related protein [Posttranslational modification, protein turnover, chaperones]
Probab=32.55  E-value=28  Score=24.50  Aligned_cols=16  Identities=31%  Similarity=0.874  Sum_probs=13.9

Q ss_pred             EEEEEeCChhhHHHHH
Q psy12257         35 ALYMESLCPGCHQFIK   50 (145)
Q Consensus        35 ~vyyESlCPd~~~Fi~   50 (145)
                      .+|+--+||||.-|+.
T Consensus         5 ~lfgsn~Cpdca~a~e   20 (85)
T COG4545           5 KLFGSNLCPDCAPAVE   20 (85)
T ss_pred             eeeccccCcchHHHHH
Confidence            6799999999998873


No 100
>TIGR03140 AhpF alkyl hydroperoxide reductase, F subunit. This enzyme is the partner of the peroxiredoxin (alkyl hydroperoxide reductase) AhpC which contains the peroxide-reactive cysteine. AhpF contains the reductant (NAD(P)H) binding domain (pfam00070) and presumably acts to resolve the disulfide which forms after oxidation of the active site cysteine in AphC. This proteins contains two paired conserved cysteine motifs, CxxCP and CxHCDGP.
Probab=31.91  E-value=98  Score=27.60  Aligned_cols=21  Identities=14%  Similarity=0.381  Sum_probs=18.2

Q ss_pred             CCeeEEEEEEEeCChhhHHHH
Q psy12257         29 IVKAKVALYMESLCPGCHQFI   49 (145)
Q Consensus        29 ~~kV~V~vyyESlCPd~~~Fi   49 (145)
                      ..+++|++|+-.-||+|.+-+
T Consensus       116 ~~~~~i~~f~~~~Cp~Cp~~v  136 (515)
T TIGR03140       116 NGPLHFETYVSLTCQNCPDVV  136 (515)
T ss_pred             CCCeEEEEEEeCCCCCCHHHH
Confidence            468999999999999998643


No 101
>TIGR00385 dsbE periplasmic protein thiol:disulfide oxidoreductases, DsbE subfamily. Involved in the biogenesis of c-type cytochromes as well as in disulfide bond formation in some periplasmic proteins.
Probab=30.03  E-value=71  Score=24.02  Aligned_cols=21  Identities=24%  Similarity=0.270  Sum_probs=17.8

Q ss_pred             CCeeEEEEEEEeCChhhHHHH
Q psy12257         29 IVKAKVALYMESLCPGCHQFI   49 (145)
Q Consensus        29 ~~kV~V~vyyESlCPd~~~Fi   49 (145)
                      ..|+-|-.||-+-||.|++++
T Consensus        62 ~gk~vll~F~a~wC~~C~~~~   82 (173)
T TIGR00385        62 QGKPVLLNVWASWCPPCRAEH   82 (173)
T ss_pred             CCCEEEEEEECCcCHHHHHHH
Confidence            467888888999999999875


No 102
>cd03003 PDI_a_ERdj5_N PDIa family, N-terminal ERdj5 subfamily; ERdj5, also known as JPDI and macrothioredoxin, is a protein containing an N-terminal DnaJ domain and four redox active TRX domains. This subfamily is comprised of the first TRX domain of ERdj5 located after the DnaJ domain at the N-terminal half of the protein. ERdj5 is a ubiquitous protein localized in the endoplasmic reticulum (ER) and is abundant in secretory cells. It's transcription is induced during ER stress. It interacts with BiP through its DnaJ domain in an ATP-dependent manner. BiP, an ER-resident member of the Hsp70 chaperone family, functions in ER-associated degradation and protein translocation.
Probab=29.83  E-value=1.7e+02  Score=19.42  Aligned_cols=20  Identities=15%  Similarity=0.388  Sum_probs=16.2

Q ss_pred             CCeeEEEEEEEeCChhhHHH
Q psy12257         29 IVKAKVALYMESLCPGCHQF   48 (145)
Q Consensus        29 ~~kV~V~vyyESlCPd~~~F   48 (145)
                      ..++-+-.||-+-||.|+.+
T Consensus        17 ~~~~~~v~f~a~wC~~C~~~   36 (101)
T cd03003          17 SGEIWFVNFYSPRCSHCHDL   36 (101)
T ss_pred             CCCeEEEEEECCCChHHHHh
Confidence            34777888999999999954


No 103
>cd02996 PDI_a_ERp44 PDIa family, endoplasmic reticulum protein 44 (ERp44) subfamily; ERp44 is an ER-resident protein, induced during stress, involved in thiol-mediated ER retention. It contains an N-terminal TRX domain, similar to that of PDIa, with a CXFS motif followed by two redox inactive TRX-like domains, homologous to the b and b' domains of PDI. The CXFS motif in the N-terminal domain allows ERp44 to form stable reversible mixed disulfides with its substrates. Through this activity, ERp44 mediates the ER localization of Ero1alpha, a protein that oxidizes protein disulfide isomerases into their active form. ERp44 also prevents the secretion of unassembled cargo protein with unpaired cysteines. It also modulates the activity of inositol 1,4,5-triphosphate type I receptor (IP3R1), an intracellular channel protein that mediates calcium release from the ER to the cytosol.
Probab=29.05  E-value=1.6e+02  Score=19.91  Aligned_cols=22  Identities=5%  Similarity=0.111  Sum_probs=17.4

Q ss_pred             cCCeeEEEEEEEeCChhhHHHH
Q psy12257         28 RIVKAKVALYMESLCPGCHQFI   49 (145)
Q Consensus        28 ~~~kV~V~vyyESlCPd~~~Fi   49 (145)
                      ...+.-+-.||-+-||.|+++.
T Consensus        16 ~~~~~vlv~F~a~wC~~C~~~~   37 (108)
T cd02996          16 QSAELVLVNFYADWCRFSQMLH   37 (108)
T ss_pred             hcCCEEEEEEECCCCHHHHhhH
Confidence            4456668889999999999864


No 104
>TIGR03399 RNA_3prim_cycl RNA 3'-phosphate cyclase. Members of this protein family are RNA 3'-phosphate cyclase (6.5.1.4), an enzyme whose function is conserved from E. coli to human. The modification this enzyme performs enables certain RNA ligations to occur, although the full biological roll for this enzyme is not fully described. This model separates this enzyme from a related protein, present only in eukaryotes, localized to the nucleolus, and involved in ribosomal modification.
Probab=28.77  E-value=1.6e+02  Score=25.25  Aligned_cols=63  Identities=11%  Similarity=0.197  Sum_probs=48.1

Q ss_pred             hhhcCCeeEEEEEEEeCChh--hHHHHHHhhHHHHHhccCceeEEEEeeeeceeecCCCCCcceeeeC
Q psy12257         25 SMLRIVKAKVALYMESLCPG--CHQFIKHQLYPVFMKYSNYIQLDLIPFGNARHTKNSDGTWEFKCQH   90 (145)
Q Consensus        25 ~~~~~~kV~V~vyyESlCPd--~~~Fi~~qL~P~~~~l~d~idl~lvPfG~a~~~~~~~g~~~f~CQH   90 (145)
                      +.....++.+++-.-+.-|-  +.+|+++.+.|++.++.=.+++++.=.|-.-   ...|...|.|++
T Consensus       105 l~f~~~p~~l~l~GgT~~~~sPsvDy~~~v~lP~l~~~G~~~~l~v~rRG~yP---~GGGeV~~~i~p  169 (326)
T TIGR03399       105 LLFANGPSRVTVSGGTDVPWAPPVDYLRNVFLPLLERMGIRAELELLRRGFYP---RGGGEVRLRVEP  169 (326)
T ss_pred             HHhCCCCeEEEEEcccCCCCCCCHHHHHHHHHHHHHhCCCcEEEEEEeCCcCC---CCCEEEEEEEcc
Confidence            33467789999999998887  8999999999999988767899998777431   124456666665


No 105
>cd03011 TlpA_like_ScsD_MtbDsbE TlpA-like family, suppressor for copper sensitivity D protein (ScsD) and actinobacterial DsbE homolog subfamily; composed of ScsD, the DsbE homolog of Mycobacterium tuberculosis (MtbDsbE) and similar proteins, all containing a redox-active CXXC motif. The Salmonella typhimurium ScsD is a thioredoxin-like protein which confers copper tolerance to copper-sensitive mutants of E. coli. MtbDsbE has been characterized as an oxidase in vitro, catalyzing the disulfide bond formation of substrates like hirudin. The reduced form of MtbDsbE is more stable than its oxidized form, consistent with an oxidase function. This is in contrast to the function of DsbE from gram-negative bacteria which is a specific reductase of apocytochrome c.
Probab=27.76  E-value=1e+02  Score=21.08  Aligned_cols=29  Identities=14%  Similarity=0.295  Sum_probs=20.2

Q ss_pred             CeeEEEEEEEeCChhhHHHHHHhhHHHHHh
Q psy12257         30 VKAKVALYMESLCPGCHQFIKHQLYPVFMK   59 (145)
Q Consensus        30 ~kV~V~vyyESlCPd~~~Fi~~qL~P~~~~   59 (145)
                      .++.|-.||-+-||.|+.++. .|...+++
T Consensus        20 ~k~~vl~F~~~~C~~C~~~~~-~l~~~~~~   48 (123)
T cd03011          20 GKPVLVYFWATWCPVCRFTSP-TVNQLAAD   48 (123)
T ss_pred             CCEEEEEEECCcChhhhhhCh-HHHHHHhh
Confidence            377777888888999998853 34444444


No 106
>cd03028 GRX_PICOT_like Glutaredoxin (GRX) family, PKC-interacting cousin of TRX (PICOT)-like subfamily; composed of PICOT and GRX-PICOT-like proteins. The non-PICOT members of this family contain only the GRX-like domain, whereas PICOT contains an N-terminal TRX-like domain followed by one to three GRX-like domains. It is interesting to note that PICOT from plants contain three repeats of the GRX-like domain, metazoan proteins (except for insect) have two repeats, while fungal sequences contain only one copy of the domain. PICOT is a protein that interacts with protein kinase C (PKC) theta, a calcium independent PKC isoform selectively expressed in skeletal muscle and T lymphocytes. PICOT inhibits the activation of c-Jun N-terminal kinase and the transcription factors, AP-1 and NF-kB, induced by PKC theta or T-cell activating stimuli. Both GRX and TRX domains of PICOT are required for its activity. Characterized non-PICOT members of this family include CXIP1, a CAX-interacting protein 
Probab=27.37  E-value=42  Score=22.74  Aligned_cols=16  Identities=25%  Similarity=0.474  Sum_probs=12.3

Q ss_pred             EEEEEEEe-----CChhhHHH
Q psy12257         33 KVALYMES-----LCPGCHQF   48 (145)
Q Consensus        33 ~V~vyyES-----lCPd~~~F   48 (145)
                      +|.||..+     .||+|++-
T Consensus         9 ~vvvf~k~~~~~~~Cp~C~~a   29 (90)
T cd03028           9 PVVLFMKGTPEEPRCGFSRKV   29 (90)
T ss_pred             CEEEEEcCCCCCCCCcHHHHH
Confidence            47778774     89999974


No 107
>PF06110 DUF953:  Eukaryotic protein of unknown function (DUF953);  InterPro: IPR010357 This family consists of several hypothetical eukaryotic proteins of unknown function that are thioredoxin-like.; PDB: 1V9W_A 1WOU_A.
Probab=26.96  E-value=1.3e+02  Score=22.23  Aligned_cols=34  Identities=24%  Similarity=0.423  Sum_probs=18.5

Q ss_pred             EeCChhhHHHHHHhhHHHHHhccCceeEEEEeeee
Q psy12257         39 ESLCPGCHQFIKHQLYPVFMKYSNYIQLDLIPFGN   73 (145)
Q Consensus        39 ESlCPd~~~Fi~~qL~P~~~~l~d~idl~lvPfG~   73 (145)
                      .|=||||++--- .+..++...++-..|-.+..|.
T Consensus        35 ~sWCPDC~~aep-~v~~~f~~~~~~~~lv~v~VG~   68 (119)
T PF06110_consen   35 QSWCPDCVAAEP-VVEKAFKKAPENARLVYVEVGD   68 (119)
T ss_dssp             -BSSHHHHHHHH-HHHHHHHH-STTEEEEEEE---
T ss_pred             CcccHHHHHHHH-HHHHHHHhCCCCceEEEEEcCC
Confidence            467999997642 4445555666555555555554


No 108
>cd00340 GSH_Peroxidase Glutathione (GSH) peroxidase family; tetrameric selenoenzymes that catalyze the reduction of a variety of hydroperoxides including lipid peroxidases, using GSH as a specific electron donor substrate. GSH peroxidase contains one selenocysteine residue per subunit, which is involved in catalysis. Different isoenzymes are known in mammals,which are involved in protection against reactive oxygen species, redox regulation of many metabolic processes, peroxinitrite scavenging, and modulation of inflammatory processes.
Probab=25.73  E-value=1.8e+02  Score=21.17  Aligned_cols=39  Identities=21%  Similarity=0.297  Sum_probs=26.9

Q ss_pred             CeeEEEEEEEeCChhhHHHHHHhhHHHHHhccCceeEEEEee
Q psy12257         30 VKAKVALYMESLCPGCHQFIKHQLYPVFMKYSNYIQLDLIPF   71 (145)
Q Consensus        30 ~kV~V~vyyESlCPd~~~Fi~~qL~P~~~~l~d~idl~lvPf   71 (145)
                      .|+-|-.|+-+-|| |+.=+- .|..+++++++. ++++|.+
T Consensus        22 Gk~vvl~fwatwC~-C~~e~p-~l~~l~~~~~~~-~~~vv~v   60 (152)
T cd00340          22 GKVLLIVNVASKCG-FTPQYE-GLEALYEKYKDR-GLVVLGF   60 (152)
T ss_pred             CCEEEEEEEcCCCC-chHHHH-HHHHHHHHhcCC-CEEEEEe
Confidence            57778888999999 987764 566666666532 3555544


No 109
>cd02994 PDI_a_TMX PDIa family, TMX subfamily; composed of proteins similar to the TRX-related human transmembrane protein, TMX. TMX is a type I integral membrane protein; the N-terminal redox active TRX domain is present in the endoplasmic reticulum (ER) lumen while the C-terminus is oriented towards the cytoplasm. It is expressed in many cell types and its active site motif (CPAC) is unique. In vitro, TMX reduces interchain disulfides of insulin and renatures inactive RNase containing incorrect disulfide bonds. The C. elegans homolog, DPY-11, is expressed only in the hypodermis and resides in the cytoplasm. It is required for body and sensory organ morphogeneis. Another uncharacterized TRX-related transmembrane protein, human TMX4, is included in the alignment. The active site sequence of TMX4 is CPSC.
Probab=25.59  E-value=79  Score=21.03  Aligned_cols=24  Identities=21%  Similarity=0.682  Sum_probs=17.2

Q ss_pred             EEEEEEEeCChhhHHHHHHhhHHHHHhcc
Q psy12257         33 KVALYMESLCPGCHQFIKHQLYPVFMKYS   61 (145)
Q Consensus        33 ~V~vyyESlCPd~~~Fi~~qL~P~~~~l~   61 (145)
                      .|-.||-+-||.|+.+     .|.|+++.
T Consensus        19 ~lv~f~a~wC~~C~~~-----~p~~~~l~   42 (101)
T cd02994          19 WMIEFYAPWCPACQQL-----QPEWEEFA   42 (101)
T ss_pred             EEEEEECCCCHHHHHH-----hHHHHHHH
Confidence            4778899999999975     44454443


No 110
>smart00594 UAS UAS domain.
Probab=24.96  E-value=75  Score=22.64  Aligned_cols=44  Identities=14%  Similarity=0.097  Sum_probs=26.1

Q ss_pred             cCCeeEEEEEEEeCChhhHHHHHHhhHHHHHhccCceeEEEEeeee
Q psy12257         28 RIVKAKVALYMESLCPGCHQFIKHQLYPVFMKYSNYIQLDLIPFGN   73 (145)
Q Consensus        28 ~~~kV~V~vyyESlCPd~~~Fi~~qL~P~~~~l~d~idl~lvPfG~   73 (145)
                      ...|..+-.++-.-|++|+.|.++.|.-  ..+.++++=++|.|+-
T Consensus        25 ~~~K~~lv~~~~~~c~~c~~~~r~vl~~--~~V~~~i~~~fv~~~~   68 (122)
T smart00594       25 RQRRLLWLYLHSQDSPDSQVFNRDVLCN--EAVKSLIRENFIFWQV   68 (122)
T ss_pred             hhcCCEEEEEeCCCCchHHHHHHHHccC--HHHHHHHHcCEEEEEe
Confidence            3345555555556799999999865533  2233444436777663


No 111
>PRK15412 thiol:disulfide interchange protein DsbE; Provisional
Probab=24.91  E-value=1e+02  Score=23.53  Aligned_cols=22  Identities=18%  Similarity=0.277  Sum_probs=18.6

Q ss_pred             CCeeEEEEEEEeCChhhHHHHH
Q psy12257         29 IVKAKVALYMESLCPGCHQFIK   50 (145)
Q Consensus        29 ~~kV~V~vyyESlCPd~~~Fi~   50 (145)
                      ..|+-|-.||-+-||.|++.+-
T Consensus        67 ~gk~vvv~FwatwC~~C~~e~p   88 (185)
T PRK15412         67 QGKPVLLNVWATWCPTCRAEHQ   88 (185)
T ss_pred             CCCEEEEEEECCCCHHHHHHHH
Confidence            4678888899999999998864


No 112
>TIGR01617 arsC_related transcriptional regulator, Spx/MgsR family. This model represents a portion of the proteins within the larger set covered by Pfam model pfam03960. That larger family includes a glutaredoxin-dependent arsenate reductase (TIGR00014). Characterized members of this family include Spx and MgsR from Bacillus subtili. Spx is a global regulator for response to thiol-specific oxidative stress. It interacts with RNA polymerase. MgsR (modulator of the general stress response, also called YqgZ) provides a second level of regulation for more than a third of the proteins in the B. subtilis general stress regulon controlled by Sigma-B.
Probab=24.80  E-value=54  Score=23.31  Aligned_cols=16  Identities=19%  Similarity=0.538  Sum_probs=14.0

Q ss_pred             EEEEEEeCChhhHHHH
Q psy12257         34 VALYMESLCPGCHQFI   49 (145)
Q Consensus        34 V~vyyESlCPd~~~Fi   49 (145)
                      |+||+-+-||.|++-.
T Consensus         1 i~iY~~~~C~~c~ka~   16 (117)
T TIGR01617         1 IKVYGSPNCTTCKKAR   16 (117)
T ss_pred             CEEEeCCCCHHHHHHH
Confidence            4789999999999865


No 113
>cd02965 HyaE HyaE family; HyaE is also called HupG and HoxO. They are proteins serving a critical role in the assembly of multimeric [NiFe] hydrogenases, the enzymes that catalyze the oxidation of molecular hydrogen to enable microorganisms to utilize hydrogen as the sole energy source. The E. coli HyaE protein is a chaperone that specifically interacts with the twin-arginine translocation (Tat) signal peptide of the [NiFe] hydrogenase-1 beta subunit precursor. Tat signal peptides target precursor proteins to the Tat protein export system, which facilitates the transport of fully folded proteins across the inner membrane. HyaE may be involved in regulating the traffic of [NiFe] hydrogenase-1 on the Tat transport pathway.
Probab=24.71  E-value=1.6e+02  Score=21.47  Aligned_cols=21  Identities=14%  Similarity=0.001  Sum_probs=14.8

Q ss_pred             cCCeeEEEEEEEe--CChhhHHH
Q psy12257         28 RIVKAKVALYMES--LCPGCHQF   48 (145)
Q Consensus        28 ~~~kV~V~vyyES--lCPd~~~F   48 (145)
                      +.+.+.|-.||..  .||+|+.+
T Consensus        25 ~~~~~~v~~f~~~~~~cp~c~~i   47 (111)
T cd02965          25 AAGGDLVLLLAGDPVRFPEVLDV   47 (111)
T ss_pred             hCCCCEEEEecCCcccCcchhhh
Confidence            4455566667777  69999854


No 114
>PRK13675 GTP cyclohydrolase; Provisional
Probab=24.66  E-value=1.2e+02  Score=25.94  Aligned_cols=24  Identities=13%  Similarity=0.303  Sum_probs=19.1

Q ss_pred             CeeEEEEEEEeCChhhHHHHHHhh
Q psy12257         30 VKAKVALYMESLCPGCHQFIKHQL   53 (145)
Q Consensus        30 ~kV~V~vyyESlCPd~~~Fi~~qL   53 (145)
                      ..+.|+|.|.|+||=|+...+..+
T Consensus       145 ~~l~v~V~~~T~CPCS~~is~~~~  168 (308)
T PRK13675        145 KEIGAEVVGMTACPCAQEMMKERA  168 (308)
T ss_pred             EEEEEEEEEEEcChhhHHHHHHHH
Confidence            468899999999999888765433


No 115
>cd02962 TMX2 TMX2 family; composed of proteins similar to human TMX2, a 372-amino acid TRX-related transmembrane protein, identified and characterized through the cloning of its cDNA from a human fetal library. It contains a TRX domain but the redox active CXXC motif is replaced with SXXC. Sequence analysis predicts that TMX2 may be a Type I membrane protein, with its C-terminal half protruding on the luminal side of the endoplasmic reticulum (ER). In addition to the TRX domain, transmembrane region and ER-retention signal, TMX2 also contains a Myb DNA-binding domain repeat signature and a dileucine motif in the tail.
Probab=24.53  E-value=1.2e+02  Score=23.08  Aligned_cols=21  Identities=14%  Similarity=0.344  Sum_probs=16.3

Q ss_pred             cCCeeEEEEEEEeCChhhHHH
Q psy12257         28 RIVKAKVALYMESLCPGCHQF   48 (145)
Q Consensus        28 ~~~kV~V~vyyESlCPd~~~F   48 (145)
                      ...++-|-.||-+-||.|+.+
T Consensus        45 ~~~~~vvV~Fya~wC~~Ck~l   65 (152)
T cd02962          45 DKRVTWLVEFFTTWSPECVNF   65 (152)
T ss_pred             cCCCEEEEEEECCCCHHHHHH
Confidence            335667888999999999954


No 116
>cd03037 GST_N_GRX2 GST_N family, Glutaredoxin 2 (GRX2) subfamily; composed of bacterial proteins similar to E. coli GRX2, an atypical GRX with a molecular mass of about 24kD, compared with other GRXs which are 9-12kD in size. GRX2 adopts a GST fold containing an N-terminal thioredoxin-fold domain and a C-terminal alpha helical domain. It contains a redox active CXXC motif located in the N-terminal domain but is not able to reduce ribonucleotide reductase like other GRXs. However, it catalyzes GSH-dependent protein disulfide reduction of other substrates efficiently. GRX2 is thought to function primarily  in catalyzing the reversible glutathionylation of proteins in cellular redox regulation including stress responses.
Probab=24.48  E-value=38  Score=21.27  Aligned_cols=14  Identities=36%  Similarity=0.764  Sum_probs=12.0

Q ss_pred             EEEEEeCChhhHHH
Q psy12257         35 ALYMESLCPGCHQF   48 (145)
Q Consensus        35 ~vyyESlCPd~~~F   48 (145)
                      .+|+-..||+|++-
T Consensus         2 ~Ly~~~~~p~~~rv   15 (71)
T cd03037           2 KLYIYEHCPFCVKA   15 (71)
T ss_pred             ceEecCCCcHhHHH
Confidence            58999999999964


No 117
>cd02975 PfPDO_like_N Pyrococcus furiosus protein disulfide oxidoreductase (PfPDO)-like family, N-terminal TRX-fold subdomain; composed of proteins with similarity to PfPDO, a redox active thermostable protein believed to be the archaeal counterpart of bacterial DsbA and eukaryotic protein disulfide isomerase (PDI), which are both involved in oxidative protein folding. PfPDO contains two redox active CXXC motifs in two contiguous TRX-fold subdomains. The active site in the N-terminal TRX-fold subdomain is required for isomerase but not for reductase activity of PfPDO. The exclusive presence of PfPDO-like proteins in extremophiles may suggest that they have a special role in adaptation to extreme conditions.
Probab=24.13  E-value=1.7e+02  Score=20.55  Aligned_cols=19  Identities=11%  Similarity=0.312  Sum_probs=13.3

Q ss_pred             CeeEEEEE-EEeCChhhHHH
Q psy12257         30 VKAKVALY-MESLCPGCHQF   48 (145)
Q Consensus        30 ~kV~V~vy-yESlCPd~~~F   48 (145)
                      .++.+.|+ |-+-||.|+.+
T Consensus        21 ~~~~vvv~f~a~wC~~C~~~   40 (113)
T cd02975          21 NPVDLVVFSSKEGCQYCEVT   40 (113)
T ss_pred             CCeEEEEEeCCCCCCChHHH
Confidence            35556666 67899999854


No 118
>TIGR02661 MauD methylamine dehydrogenase accessory protein MauD. This protein, MauD, appears critical to proper formation of the small subunit of methylamine dehydrogenase, which has both an unusual tryptophan tryptophylquinone cofactor and multiple disulfide bonds. MauD shares sequence similarity, including a CPxC motif, with a number of thiol:disulfide interchange proteins. In MauD mutants, the small subunit apparently does not form properly and is rapidly degraded.
Probab=24.11  E-value=1.1e+02  Score=23.55  Aligned_cols=28  Identities=11%  Similarity=0.418  Sum_probs=19.8

Q ss_pred             CCeeEEEEEEEeCChhhHHHHHHhhHHHH
Q psy12257         29 IVKAKVALYMESLCPGCHQFIKHQLYPVF   57 (145)
Q Consensus        29 ~~kV~V~vyyESlCPd~~~Fi~~qL~P~~   57 (145)
                      ..|+-|-.|+-+-||.|++.+- .+...+
T Consensus        73 ~gk~vvl~F~atwCp~C~~~lp-~l~~~~  100 (189)
T TIGR02661        73 PGRPTLLMFTAPSCPVCDKLFP-IIKSIA  100 (189)
T ss_pred             CCCEEEEEEECCCChhHHHHHH-HHHHHH
Confidence            3566777889999999997753 344443


No 119
>cd02954 DIM1 Dim1 family; Dim1 is also referred to as U5 small nuclear ribonucleoprotein particle (snRNP)-specific 15kD protein. It is a component of U5 snRNP, which pre-assembles with U4/U6 snRNPs to form a [U4/U6:U5] tri-snRNP complex required for pre-mRNA splicing. Dim1 interacts with multiple splicing-associated proteins, suggesting that it functions at multiple control points in the splicing of pre-mRNA as part of a large spliceosomal complex involving many protein-protein interactions. U5 snRNP contains seven core proteins (common to all snRNPs) and nine U5-specific proteins, one of which is Dim1. Dim1 adopts a thioredoxin fold but does not contain the redox active CXXC motif. It is essential for G2/M phase transition, as a consequence to its role in pre-mRNA splicing.
Probab=23.81  E-value=86  Score=22.89  Aligned_cols=28  Identities=25%  Similarity=0.243  Sum_probs=20.6

Q ss_pred             cCCeeEEEEEEEeCChhhHHHHHHhhHHHHHhc
Q psy12257         28 RIVKAKVALYMESLCPGCHQFIKHQLYPVFMKY   60 (145)
Q Consensus        28 ~~~kV~V~vyyESlCPd~~~Fi~~qL~P~~~~l   60 (145)
                      ...++-|--||-+-||.|+     +|.|+++++
T Consensus        12 ~~~~~vVV~F~A~WCgpCk-----~m~P~le~l   39 (114)
T cd02954          12 EEEKVVVIRFGRDWDPVCM-----QMDEVLAKI   39 (114)
T ss_pred             cCCCEEEEEEECCCChhHH-----HHHHHHHHH
Confidence            3567778889999999999     345555444


No 120
>cd00874 RNA_Cyclase_Class_II RNA 3' phosphate cyclase domain (class II). These proteins function as RNA cyclase to catalyze the ATP-dependent conversion of 3'-phosphate to a 2'.3'-cyclic phosphodiester at the end of RNA molecule. A conserved catalytic histidine residue is found in all members of this subfamily.
Probab=23.43  E-value=2.4e+02  Score=24.18  Aligned_cols=62  Identities=10%  Similarity=0.135  Sum_probs=47.3

Q ss_pred             hhcCCeeEEEEEEEeCChh--hHHHHHHhhHHHHHhccCceeEEEEeeeeceeecCCCCCcceeeeC
Q psy12257         26 MLRIVKAKVALYMESLCPG--CHQFIKHQLYPVFMKYSNYIQLDLIPFGNARHTKNSDGTWEFKCQH   90 (145)
Q Consensus        26 ~~~~~kV~V~vyyESlCPd--~~~Fi~~qL~P~~~~l~d~idl~lvPfG~a~~~~~~~g~~~f~CQH   90 (145)
                      .....++.|++-.-+.-|.  +.+|+++.+.|++.++.-.+++++.=.|-.-   ...|...|.|++
T Consensus       104 ~f~~~~~~l~l~GgT~~~~sPsvD~~~~v~lP~l~~~G~~~~l~v~rRG~yP---~GgGeV~~~v~p  167 (326)
T cd00874         104 LFADGPSTVTISGGTDVPWAPPIDYLRNVTLPLLERMGIEAELEVLRRGFYP---RGGGEVVLTVEP  167 (326)
T ss_pred             hcCCCCEEEEEEcccCCCCCCCHHHHHHHHHHHHHhCCCcEEEEEEeCCcCC---CCCEEEEEEEec
Confidence            3467788999999988886  5999999999999988766888887777431   124556667765


No 121
>PHA02125 thioredoxin-like protein
Probab=23.31  E-value=68  Score=20.74  Aligned_cols=15  Identities=20%  Similarity=0.654  Sum_probs=13.1

Q ss_pred             EEEEEEeCChhhHHH
Q psy12257         34 VALYMESLCPGCHQF   48 (145)
Q Consensus        34 V~vyyESlCPd~~~F   48 (145)
                      |.+||-+-||.|+.+
T Consensus         2 iv~f~a~wC~~Ck~~   16 (75)
T PHA02125          2 IYLFGAEWCANCKMV   16 (75)
T ss_pred             EEEEECCCCHhHHHH
Confidence            678999999999964


No 122
>cd02987 Phd_like_Phd Phosducin (Phd)-like family, Phd subfamily; Phd is a cytosolic regulator of G protein functions. It specifically binds G protein betagamma (Gbg)-subunits with high affinity, resulting in the solubilization of Gbg from the plasma membrane. This impedes the formation of a functional G protein trimer (G protein alphabetagamma), thereby inhibiting G protein-mediated signal transduction. Phd also inhibits the GTPase activity of G protein alpha. Phd can be phosphorylated by protein kinase A and G protein-coupled receptor kinase 2, leading to its inactivation. Phd was originally isolated from the retina, where it is highly expressed and has been implicated to play an important role in light adaptation. It is also found in the pineal gland, liver, spleen, striated muscle and the brain. The C-terminal domain of Phd adopts a thioredoxin fold, but it does not contain a CXXC motif. Phd interacts with G protein beta mostly through the N-terminal helical domain.
Probab=22.62  E-value=1.5e+02  Score=22.83  Aligned_cols=18  Identities=28%  Similarity=0.462  Sum_probs=13.9

Q ss_pred             eeEEEEEEEeCChhhHHH
Q psy12257         31 KAKVALYMESLCPGCHQF   48 (145)
Q Consensus        31 kV~V~vyyESlCPd~~~F   48 (145)
                      ++-|--||..-||.|+.+
T Consensus        84 ~~VVV~Fya~wc~~Ck~m  101 (175)
T cd02987          84 TTVVVHIYEPGIPGCAAL  101 (175)
T ss_pred             cEEEEEEECCCCchHHHH
Confidence            356667889999999943


No 123
>PLN02412 probable glutathione peroxidase
Probab=22.61  E-value=1.6e+02  Score=22.14  Aligned_cols=32  Identities=22%  Similarity=0.266  Sum_probs=24.6

Q ss_pred             CeeEEEEEEEeCChhhHHHHHHhhHHHHHhccC
Q psy12257         30 VKAKVALYMESLCPGCHQFIKHQLYPVFMKYSN   62 (145)
Q Consensus        30 ~kV~V~vyyESlCPd~~~Fi~~qL~P~~~~l~d   62 (145)
                      .|+-|-.|+-+-||.|++-+. .|...++++++
T Consensus        29 gk~vlv~f~a~~C~~c~~e~~-~l~~l~~~~~~   60 (167)
T PLN02412         29 GKVLLIVNVASKCGLTDSNYK-ELNVLYEKYKE   60 (167)
T ss_pred             CCEEEEEEeCCCCCChHHHHH-HHHHHHHHHhh
Confidence            577788888999999998653 56777777664


No 124
>cd03005 PDI_a_ERp46 PDIa family, endoplasmic reticulum protein 46 (ERp46) subfamily; ERp46 is an ER-resident protein containing three redox active TRX domains. Yeast complementation studies show that ERp46 can substitute for protein disulfide isomerase (PDI) function in vivo. It has been detected in many tissues, however, transcript and protein levels do not correlate in all tissues, suggesting regulation at a posttranscriptional level. An identical protein, named endoPDI, has been identified as an endothelial PDI that is highly expressed in the endothelium of tumors and hypoxic lesions. It has a protective effect on cells exposed to hypoxia.
Probab=22.57  E-value=1.7e+02  Score=19.03  Aligned_cols=28  Identities=11%  Similarity=0.376  Sum_probs=18.6

Q ss_pred             EEEEEEEeCChhhHHHHHHhhHHHHHhcc
Q psy12257         33 KVALYMESLCPGCHQFIKHQLYPVFMKYS   61 (145)
Q Consensus        33 ~V~vyyESlCPd~~~Fi~~qL~P~~~~l~   61 (145)
                      -+-.||-+-||.|+.+.. .+..+.+++.
T Consensus        19 ~lv~f~a~wC~~C~~~~p-~~~~~~~~~~   46 (102)
T cd03005          19 HFVKFFAPWCGHCKRLAP-TWEQLAKKFN   46 (102)
T ss_pred             EEEEEECCCCHHHHHhCH-HHHHHHHHHh
Confidence            566788999999998853 2433434443


No 125
>cd02989 Phd_like_TxnDC9 Phosducin (Phd)-like family, Thioredoxin (TRX) domain containing protein 9 (TxnDC9) subfamily; composed of predominantly uncharacterized eukaryotic proteins, containing a TRX-like domain without the redox active CXXC motif. The gene name for the human protein is TxnDC9. The two characterized members are described as Phd-like proteins, PLP1 of Saccharomyces cerevisiae and PhLP3 of Dictyostelium discoideum. Gene disruption experiments show that both PLP1 and PhLP3 are non-essential proteins. Unlike Phd and most Phd-like proteins, members of this group do not contain the Phd N-terminal helical domain which is implicated in binding to the G protein betagamma subunit.
Probab=21.97  E-value=1.1e+02  Score=21.58  Aligned_cols=20  Identities=10%  Similarity=0.122  Sum_probs=15.4

Q ss_pred             CCeeEEEEEEEeCChhhHHH
Q psy12257         29 IVKAKVALYMESLCPGCHQF   48 (145)
Q Consensus        29 ~~kV~V~vyyESlCPd~~~F   48 (145)
                      ..+.-|-.||...||.|+.+
T Consensus        21 ~~~~vvV~f~a~~c~~C~~~   40 (113)
T cd02989          21 SSERVVCHFYHPEFFRCKIM   40 (113)
T ss_pred             CCCcEEEEEECCCCccHHHH
Confidence            34566777899999999954


No 126
>cd02984 TRX_PICOT TRX domain, PICOT (for PKC-interacting cousin of TRX) subfamily; PICOT is a protein that interacts with protein kinase C (PKC) theta, a calcium independent PKC isoform selectively expressed in skeletal muscle and T lymphocytes. PICOT contains an N-terminal TRX-like domain, which does not contain the catalytic CXXC motif, followed by one to three glutaredoxin domains. The TRX-like domain is required for interaction with PKC theta. PICOT inhibits the activation of c-Jun N-terminal kinase and the transcription factors, AP-1 and NF-kB, induced by PKC theta or T-cell activating stimuli.
Probab=21.68  E-value=2.4e+02  Score=18.26  Aligned_cols=20  Identities=20%  Similarity=0.252  Sum_probs=16.7

Q ss_pred             CeeEEEEEEEeCChhhHHHH
Q psy12257         30 VKAKVALYMESLCPGCHQFI   49 (145)
Q Consensus        30 ~kV~V~vyyESlCPd~~~Fi   49 (145)
                      ++.-|-.||-+-|+.|+++.
T Consensus        14 ~~~v~v~f~~~~C~~C~~~~   33 (97)
T cd02984          14 SKLLVLHFWAPWAEPCKQMN   33 (97)
T ss_pred             CCEEEEEEECCCCHHHHHHh
Confidence            57778888999999999664


No 127
>cd03000 PDI_a_TMX3 PDIa family, TMX3 subfamily; composed of eukaryotic proteins similar to human TMX3, a TRX related transmembrane protein containing one redox active TRX domain at the N-terminus and a classical ER retrieval sequence for type I transmembrane proteins at the C-terminus. The TMX3 transcript is found in a variety of tissues with the highest levels detected in skeletal muscle and the heart. In vitro, TMX3 showed oxidase activity albeit slightly lower than that of protein disulfide isomerase.
Probab=21.04  E-value=2.7e+02  Score=18.64  Aligned_cols=31  Identities=10%  Similarity=0.111  Sum_probs=21.9

Q ss_pred             CCeeEEEEEEEeCChhhHHHHHHhhHHHHHhc
Q psy12257         29 IVKAKVALYMESLCPGCHQFIKHQLYPVFMKY   60 (145)
Q Consensus        29 ~~kV~V~vyyESlCPd~~~Fi~~qL~P~~~~l   60 (145)
                      ..++-+-.||-+-||.|+.+.. .|..+...+
T Consensus        14 ~~~~vlv~f~a~wC~~C~~~~p-~l~~l~~~~   44 (104)
T cd03000          14 KEDIWLVDFYAPWCGHCKKLEP-VWNEVGAEL   44 (104)
T ss_pred             cCCeEEEEEECCCCHHHHhhCh-HHHHHHHHH
Confidence            3566788899999999998764 444444444


No 128
>TIGR00365 monothiol glutaredoxin, Grx4 family. The gene for the member of this glutaredoxin family in E. coli, originally designated ydhD, is now designated grxD. Its protein, Grx4, is a monothiol glutaredoxin similar to Grx5 of yeast, which is involved in iron-sulfur cluster formation.
Probab=20.78  E-value=68  Score=22.22  Aligned_cols=16  Identities=31%  Similarity=0.540  Sum_probs=11.6

Q ss_pred             EEEEEE-----eCChhhHHHH
Q psy12257         34 VALYME-----SLCPGCHQFI   49 (145)
Q Consensus        34 V~vyyE-----SlCPd~~~Fi   49 (145)
                      |.||..     +.||+|.+-.
T Consensus        14 Vvvf~kg~~~~~~Cp~C~~ak   34 (97)
T TIGR00365        14 VVLYMKGTPQFPQCGFSARAV   34 (97)
T ss_pred             EEEEEccCCCCCCCchHHHHH
Confidence            566765     6799999754


No 129
>COG4665 FcbT2 TRAP-type mannitol/chloroaromatic compound transport system, small permease component [Secondary metabolites biosynthesis, transport, and catabolism]
Probab=20.14  E-value=65  Score=25.81  Aligned_cols=23  Identities=13%  Similarity=0.203  Sum_probs=20.6

Q ss_pred             hcCCeeEEEEEEEeCChhhHHHH
Q psy12257         27 LRIVKAKVALYMESLCPGCHQFI   49 (145)
Q Consensus        27 ~~~~kV~V~vyyESlCPd~~~Fi   49 (145)
                      ..++.|+|+++|+++-|..|.++
T Consensus        71 ~~neHVRvDi~Y~~ls~R~qa~v   93 (182)
T COG4665          71 KQNEHVRVDIIYGSLSRRTQAWV   93 (182)
T ss_pred             hcCCceEEEeeccccCHHHHHHH
Confidence            46689999999999999999886


No 130
>PRK10606 btuE putative glutathione peroxidase; Provisional
Probab=20.04  E-value=2.1e+02  Score=22.30  Aligned_cols=39  Identities=15%  Similarity=0.226  Sum_probs=27.2

Q ss_pred             CeeEEEEEEEeCChhhHHHHHHhhHHHHHhccCceeEEEEee
Q psy12257         30 VKAKVALYMESLCPGCHQFIKHQLYPVFMKYSNYIQLDLIPF   71 (145)
Q Consensus        30 ~kV~V~vyyESlCPd~~~Fi~~qL~P~~~~l~d~idl~lvPf   71 (145)
                      .||-|-+++-|.||.|..+  .+|...++++++. +|+++-|
T Consensus        25 GKvvLVvf~AS~C~~~~q~--~~L~~L~~~y~~~-gl~Vlg~   63 (183)
T PRK10606         25 GNVLLIVNVASKCGLTPQY--EQLENIQKAWADQ-GFVVLGF   63 (183)
T ss_pred             CCEEEEEEEeCCCCCcHHH--HHHHHHHHHHhhC-CeEEEEe
Confidence            5888999999999999753  3677777777542 3444433


Done!