Query         psy12258
Match_columns 171
No_of_seqs    137 out of 1906
Neff          10.9
Searched_HMMs 46136
Date          Fri Aug 16 22:45:58 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy12258.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/12258hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG2462|consensus              100.0 1.7E-32 3.8E-37  185.3   4.7  131    1-134   132-265 (279)
  2 KOG2462|consensus               99.9 7.5E-25 1.6E-29  148.5   5.4  103    1-106   163-265 (279)
  3 KOG1074|consensus               99.9 1.5E-22 3.1E-27  154.5   1.9   87   56-142   605-698 (958)
  4 KOG3608|consensus               99.8 5.5E-21 1.2E-25  133.6   7.5  133    2-136   182-316 (467)
  5 KOG3576|consensus               99.8 7.5E-20 1.6E-24  119.1   2.1  115   26-141   116-241 (267)
  6 KOG1074|consensus               99.8 2.1E-19 4.6E-24  137.5   4.7  143    1-144   607-939 (958)
  7 KOG3608|consensus               99.7 1.9E-18 4.1E-23  121.1   5.9  132    2-136   240-376 (467)
  8 KOG3576|consensus               99.7 3.5E-19 7.5E-24  116.0   2.0  110    2-112   120-240 (267)
  9 KOG3623|consensus               99.7 1.1E-17 2.5E-22  126.6   2.6  106   28-133   211-330 (1007)
 10 KOG3623|consensus               99.6 2.8E-16 6.1E-21  119.2   3.8   80   54-133   892-971 (1007)
 11 PLN03086 PRLI-interacting fact  99.4 2.9E-13 6.3E-18  102.5   5.3  103   26-136   452-564 (567)
 12 PHA00733 hypothetical protein   99.3 6.1E-12 1.3E-16   78.8   4.3   82   54-137    38-124 (128)
 13 PHA00733 hypothetical protein   99.2 2.6E-11 5.7E-16   75.9   3.7   83   25-109    38-124 (128)
 14 PHA02768 hypothetical protein;  99.1 3.2E-11   7E-16   62.9   2.1   44   84-129     5-48  (55)
 15 PLN03086 PRLI-interacting fact  99.1 1.7E-10 3.7E-15   87.8   6.3   98    1-106   455-562 (567)
 16 PHA02768 hypothetical protein;  98.9   7E-10 1.5E-14   58.0   2.1   39   28-69      6-44  (55)
 17 KOG3993|consensus               98.8 4.1E-10 8.8E-15   81.5  -0.3   49    1-49    269-317 (500)
 18 PF13465 zf-H2C2_2:  Zinc-finge  98.8 3.1E-09 6.8E-14   47.6   1.9   25   99-123     1-25  (26)
 19 PF13465 zf-H2C2_2:  Zinc-finge  98.8 4.4E-09 9.6E-14   47.1   2.0   25   14-38      1-25  (26)
 20 KOG3993|consensus               98.7 2.7E-09 5.8E-14   77.3  -0.1  110   28-138   268-382 (500)
 21 PHA00616 hypothetical protein   98.6 4.8E-08   1E-12   48.6   2.4   33   84-116     1-33  (44)
 22 PHA00616 hypothetical protein   98.5 4.9E-08 1.1E-12   48.6   1.5   30  112-141     1-30  (44)
 23 PHA00732 hypothetical protein   98.5   9E-08 1.9E-12   54.7   2.5   43   85-133     2-45  (79)
 24 PF05605 zf-Di19:  Drought indu  98.5 3.4E-07 7.4E-12   48.6   4.1   50   84-136     2-53  (54)
 25 PF00096 zf-C2H2:  Zinc finger,  98.3 3.3E-07 7.1E-12   39.7   1.4   23  113-135     1-23  (23)
 26 PF05605 zf-Di19:  Drought indu  98.2 1.5E-06 3.3E-11   46.1   3.3   36   28-64      3-39  (54)
 27 PF13894 zf-C2H2_4:  C2H2-type   98.2 1.1E-06 2.5E-11   38.3   1.6   24  113-136     1-24  (24)
 28 PHA00732 hypothetical protein   98.1   1E-06 2.2E-11   50.4   1.5   17   30-46      4-20  (79)
 29 PF13912 zf-C2H2_6:  C2H2-type   98.0   2E-06 4.2E-11   38.8   0.8   26  112-137     1-26  (27)
 30 PF12756 zf-C2H2_2:  C2H2 type   97.9 5.1E-06 1.1E-10   49.9   1.8   24  112-135    50-73  (100)
 31 PF12756 zf-C2H2_2:  C2H2 type   97.9 8.6E-06 1.9E-10   48.9   2.3   24   84-107    50-73  (100)
 32 COG5189 SFP1 Putative transcri  97.9 3.5E-06 7.6E-11   59.5   0.5   53   81-133   346-419 (423)
 33 PF00096 zf-C2H2:  Zinc finger,  97.8 8.2E-06 1.8E-10   35.2   1.2   22   85-106     1-22  (23)
 34 COG5189 SFP1 Putative transcri  97.6 1.7E-05 3.7E-10   56.1   0.6   71   25-105   347-419 (423)
 35 PF13894 zf-C2H2_4:  C2H2-type   97.6 4.1E-05 8.9E-10   33.1   1.6   23   85-107     1-23  (24)
 36 smart00355 ZnF_C2H2 zinc finge  97.5 8.3E-05 1.8E-09   32.7   2.1   24  113-136     1-24  (26)
 37 PF13912 zf-C2H2_6:  C2H2-type   97.4 4.8E-05   1E-09   34.1   0.7   21   28-48      2-22  (27)
 38 PF13909 zf-H2C2_5:  C2H2-type   97.4 8.2E-05 1.8E-09   32.3   1.4   23  113-136     1-23  (24)
 39 KOG1146|consensus               97.4  0.0001 2.2E-09   61.3   2.8  102   30-134   439-540 (1406)
 40 PF09237 GAGA:  GAGA factor;  I  97.1 0.00016 3.5E-09   36.9   0.6   30  109-138    21-50  (54)
 41 PF12874 zf-met:  Zinc-finger o  97.1  0.0002 4.3E-09   31.4   0.9   23  113-135     1-23  (25)
 42 PF09237 GAGA:  GAGA factor;  I  97.0  0.0009 1.9E-08   34.3   2.6   20   58-77     26-45  (54)
 43 smart00355 ZnF_C2H2 zinc finge  97.0 0.00086 1.9E-08   29.2   2.3   23   85-107     1-23  (26)
 44 COG5236 Uncharacterized conser  97.0  0.0042 9.1E-08   44.9   6.7  125    5-140   159-309 (493)
 45 PRK04860 hypothetical protein;  96.9 0.00031 6.7E-09   45.8   0.8   40   83-126   118-157 (160)
 46 KOG2231|consensus               96.7  0.0067 1.5E-07   48.0   6.4   95    9-109   124-237 (669)
 47 KOG2231|consensus               96.6  0.0048   1E-07   48.8   5.0   99   30-136   118-236 (669)
 48 PF13909 zf-H2C2_5:  C2H2-type   96.5  0.0016 3.4E-08   28.2   1.3   23   85-108     1-23  (24)
 49 PF12171 zf-C2H2_jaz:  Zinc-fin  96.1  0.0011 2.3E-08   29.7  -0.5   22  113-134     2-23  (27)
 50 PF12171 zf-C2H2_jaz:  Zinc-fin  96.0  0.0017 3.7E-08   29.0   0.0   21   28-48      2-22  (27)
 51 PF13913 zf-C2HC_2:  zinc-finge  95.8  0.0072 1.6E-07   26.4   1.6   19  114-133     4-22  (25)
 52 COG5236 Uncharacterized conser  95.6  0.0059 1.3E-07   44.2   1.5  103   27-136   151-275 (493)
 53 PRK04860 hypothetical protein;  95.5  0.0064 1.4E-07   39.8   1.1   38   56-97    119-156 (160)
 54 COG5048 FOG: Zn-finger [Genera  95.1  0.0049 1.1E-07   46.5  -0.4  139    1-140   291-446 (467)
 55 COG4049 Uncharacterized protei  95.0  0.0098 2.1E-07   31.0   0.7   25   82-106    15-39  (65)
 56 KOG1146|consensus               94.8   0.014 2.9E-07   49.4   1.4  104   28-136  1229-1352(1406)
 57 cd00350 rubredoxin_like Rubred  94.6   0.012 2.5E-07   27.6   0.4   10  111-120    16-25  (33)
 58 PF12013 DUF3505:  Protein of u  94.3   0.069 1.5E-06   32.6   3.4   83   54-137     9-109 (109)
 59 smart00451 ZnF_U1 U1-like zinc  94.2   0.031 6.7E-07   26.3   1.3   22  112-133     3-24  (35)
 60 COG4049 Uncharacterized protei  94.2   0.027 5.9E-07   29.4   1.1   29  108-136    13-41  (65)
 61 KOG2482|consensus               94.1   0.067 1.5E-06   38.9   3.3  107   27-133   195-355 (423)
 62 smart00451 ZnF_U1 U1-like zinc  93.9   0.031 6.7E-07   26.3   1.0   22   27-48      3-24  (35)
 63 KOG4173|consensus               93.7   0.049 1.1E-06   36.7   1.9   47   28-78     80-128 (253)
 64 KOG4173|consensus               93.7    0.17 3.8E-06   34.2   4.4   79   54-135    77-170 (253)
 65 PF09538 FYDLN_acid:  Protein o  93.4   0.038 8.2E-07   33.7   1.0   30   28-69     10-39  (108)
 66 PF12013 DUF3505:  Protein of u  93.1    0.15 3.3E-06   31.1   3.4   83   26-109    10-109 (109)
 67 KOG2893|consensus               92.4   0.053 1.1E-06   37.4   0.7   41   30-75     13-53  (341)
 68 KOG2482|consensus               92.2     0.4 8.6E-06   35.1   4.8  110   27-136   144-303 (423)
 69 TIGR00622 ssl1 transcription f  91.7    0.15 3.3E-06   31.1   2.1   92   25-136    13-105 (112)
 70 TIGR00622 ssl1 transcription f  91.1     0.2 4.4E-06   30.6   2.1   18    1-18     17-34  (112)
 71 PF10571 UPF0547:  Uncharacteri  90.5    0.15 3.2E-06   22.5   0.9   10   29-38     16-25  (26)
 72 COG2888 Predicted Zn-ribbon RN  90.5    0.17 3.6E-06   26.9   1.2    9  111-119    49-57  (61)
 73 PRK14890 putative Zn-ribbon RN  90.2    0.16 3.5E-06   27.0   1.0    9  111-119    47-55  (59)
 74 PHA00626 hypothetical protein   89.8   0.075 1.6E-06   27.8  -0.4   15  110-124    21-35  (59)
 75 PRK00464 nrdR transcriptional   89.7   0.037 8.1E-07   35.9  -1.9   12  113-124    29-40  (154)
 76 cd00729 rubredoxin_SM Rubredox  89.6    0.11 2.5E-06   24.4   0.2    8  112-119    18-25  (34)
 77 KOG2893|consensus               89.1   0.085 1.8E-06   36.5  -0.7   35   59-97     13-47  (341)
 78 PF13719 zinc_ribbon_5:  zinc-r  88.8    0.16 3.4E-06   24.5   0.3    8  113-120    26-33  (37)
 79 COG5048 FOG: Zn-finger [Genera  88.7    0.13 2.8E-06   38.8  -0.0   58   83-140   288-351 (467)
 80 TIGR02300 FYDLN_acid conserved  88.4    0.24 5.2E-06   30.8   1.0   30   28-69     10-39  (129)
 81 KOG2186|consensus               86.9    0.39 8.4E-06   33.6   1.5   46   28-77      4-49  (276)
 82 PF13717 zinc_ribbon_4:  zinc-r  86.9    0.26 5.6E-06   23.6   0.4    6  114-119    27-32  (36)
 83 PF06524 NOA36:  NOA36 protein;  86.8    0.24 5.2E-06   34.7   0.4   80   54-135   140-232 (314)
 84 COG1592 Rubrerythrin [Energy p  86.7    0.32   7E-06   32.0   0.9   24   84-120   134-157 (166)
 85 smart00659 RPOLCX RNA polymera  86.4    0.26 5.7E-06   24.7   0.3   10   85-94      3-12  (44)
 86 PF09986 DUF2225:  Uncharacteri  86.2    0.13 2.8E-06   35.5  -1.2   40    1-40      7-61  (214)
 87 TIGR02098 MJ0042_CXXC MJ0042 f  86.2    0.49 1.1E-05   22.7   1.2   14   28-41      3-16  (38)
 88 KOG2785|consensus               85.9    0.66 1.4E-05   34.5   2.2   21   28-48      4-24  (390)
 89 PF09986 DUF2225:  Uncharacteri  85.8    0.24 5.3E-06   34.1   0.0   45   25-69      3-61  (214)
 90 TIGR00373 conserved hypothetic  85.5    0.69 1.5E-05   30.3   2.0   36   79-123   104-139 (158)
 91 smart00834 CxxC_CXXC_SSSS Puta  84.9    0.11 2.4E-06   25.4  -1.5   10   85-94      6-15  (41)
 92 smart00734 ZnF_Rad18 Rad18-lik  84.2       1 2.2E-05   19.8   1.6   18    2-20      4-21  (26)
 93 TIGR00373 conserved hypothetic  84.1     0.7 1.5E-05   30.3   1.6   16   56-71    109-124 (158)
 94 PF02892 zf-BED:  BED zinc fing  83.1    0.92   2E-05   22.6   1.5   25  110-134    14-42  (45)
 95 PF14353 CpXC:  CpXC protein     82.9    0.52 1.1E-05   29.6   0.6   47    1-48      3-59  (128)
 96 smart00531 TFIIE Transcription  82.5     1.2 2.7E-05   28.7   2.3   15   25-39     97-111 (147)
 97 TIGR02605 CxxC_CxxC_SSSS putat  81.9    0.19 4.1E-06   26.1  -1.4   11   85-95      6-16  (52)
 98 PF08274 PhnA_Zn_Ribbon:  PhnA   81.9    0.46   1E-05   21.7   0.1   24   86-120     4-27  (30)
 99 PRK06266 transcription initiat  81.6    0.89 1.9E-05   30.5   1.4   35   81-124   114-148 (178)
100 PRK06266 transcription initiat  80.7       1 2.2E-05   30.2   1.4   14   27-40    117-130 (178)
101 PRK00398 rpoP DNA-directed RNA  79.5    0.41 8.9E-06   24.2  -0.6   10   85-94      4-13  (46)
102 smart00614 ZnF_BED BED zinc fi  79.2     1.5 3.4E-05   22.5   1.5   22  113-134    19-45  (50)
103 PF04959 ARS2:  Arsenite-resist  78.0    0.94   2E-05   31.2   0.6   27  111-137    76-102 (214)
104 COG1997 RPL43A Ribosomal prote  77.5    0.82 1.8E-05   26.5   0.2   31   83-123    34-64  (89)
105 PF09723 Zn-ribbon_8:  Zinc rib  77.1     1.3 2.8E-05   21.9   0.8   13   28-40      6-18  (42)
106 PRK09678 DNA-binding transcrip  77.0    0.42 9.2E-06   26.8  -1.0   41   85-127     2-44  (72)
107 COG1996 RPC10 DNA-directed RNA  76.4    0.88 1.9E-05   23.4   0.1   10   85-94      7-16  (49)
108 PF05443 ROS_MUCR:  ROS/MUCR tr  75.8     1.5 3.2E-05   27.8   1.0   25  111-138    71-95  (132)
109 COG4530 Uncharacterized protei  75.5     1.4   3E-05   26.7   0.8   27   29-67     11-37  (129)
110 PF13878 zf-C2H2_3:  zinc-finge  74.7     3.5 7.6E-05   20.3   2.0   22    1-22     15-38  (41)
111 KOG2785|consensus               74.4       4 8.6E-05   30.6   3.0   51   84-134   166-242 (390)
112 PF03604 DNA_RNApol_7kD:  DNA d  73.6    0.95   2E-05   21.0  -0.2    6  114-119    19-24  (32)
113 PF12907 zf-met2:  Zinc-binding  72.8     1.7 3.6E-05   21.3   0.6   10   43-52     20-29  (40)
114 PF05191 ADK_lid:  Adenylate ki  71.9    0.75 1.6E-05   22.0  -0.8    8  113-120    22-29  (36)
115 COG3357 Predicted transcriptio  69.1     2.2 4.7E-05   24.9   0.6   14   83-96     57-70  (97)
116 PF01927 Mut7-C:  Mut7-C RNAse   66.7     2.9 6.3E-05   27.0   0.9   47   85-131    92-143 (147)
117 PF13453 zf-TFIIB:  Transcripti  66.5       2 4.4E-05   21.0   0.1   16   57-72     20-35  (41)
118 PF07754 DUF1610:  Domain of un  66.2     2.4 5.2E-05   18.2   0.3    8  112-119    16-23  (24)
119 KOG2807|consensus               65.0     9.1  0.0002   28.2   3.1   27  112-138   345-371 (378)
120 KOG2593|consensus               64.3       7 0.00015   29.9   2.6   39   80-121   124-162 (436)
121 PF12760 Zn_Tnp_IS1595:  Transp  64.3     7.8 0.00017   19.4   2.0   21   16-36      7-27  (46)
122 KOG2186|consensus               64.2     4.4 9.6E-05   28.6   1.4   48   56-106     3-50  (276)
123 PRK04023 DNA polymerase II lar  64.2       7 0.00015   33.4   2.7   49   27-123   626-674 (1121)
124 COG4957 Predicted transcriptio  63.8     4.3 9.3E-05   25.7   1.2   21    2-25     79-99  (148)
125 COG0068 HypF Hydrogenase matur  63.5     1.4 3.1E-05   35.7  -1.1   60   58-123   125-184 (750)
126 PF13240 zinc_ribbon_2:  zinc-r  63.3     3.2 6.9E-05   17.5   0.4    7    2-8       2-8   (23)
127 KOG1280|consensus               63.2     6.3 0.00014   29.2   2.1   27   27-53     79-105 (381)
128 KOG2907|consensus               62.5       4 8.7E-05   24.9   0.9   35   28-67     75-113 (116)
129 PF13824 zf-Mss51:  Zinc-finger  62.3     6.7 0.00015   20.7   1.6   15   24-38     11-25  (55)
130 TIGR01206 lysW lysine biosynth  61.8     1.8   4E-05   22.8  -0.6   31   85-123     3-33  (54)
131 PF00301 Rubredoxin:  Rubredoxi  61.3     4.6  0.0001   20.6   0.9   15   28-42      2-16  (47)
132 PF14446 Prok-RING_1:  Prokaryo  60.3     1.6 3.5E-05   22.9  -0.9    9    2-10      8-16  (54)
133 COG1656 Uncharacterized conser  59.6     9.3  0.0002   25.2   2.2   49   85-133    98-151 (165)
134 KOG2593|consensus               59.6     6.7 0.00014   30.0   1.8   42   22-67    123-164 (436)
135 PF15135 UPF0515:  Uncharacteri  59.3     8.7 0.00019   27.1   2.1   27   11-37     91-122 (278)
136 PRK03824 hypA hydrogenase nick  58.6     2.7 5.9E-05   26.8  -0.3   11   57-67     71-81  (135)
137 KOG4167|consensus               58.4     2.3   5E-05   34.6  -0.8   23    2-24    795-817 (907)
138 COG2331 Uncharacterized protei  58.3     5.8 0.00013   22.4   1.0   10   28-37     13-22  (82)
139 KOG3408|consensus               57.9     5.3 0.00012   24.8   0.9   23   26-48     56-78  (129)
140 TIGR00244 transcriptional regu  57.6     1.4 3.1E-05   28.3  -1.7   13  113-125    29-41  (147)
141 PF15269 zf-C2H2_7:  Zinc-finge  57.2     6.9 0.00015   19.6   1.0   22  113-134    21-42  (54)
142 COG5151 SSL1 RNA polymerase II  57.1      16 0.00034   26.8   3.2   80   26-107   321-411 (421)
143 PF13451 zf-trcl:  Probable zin  56.8      11 0.00024   19.4   1.8   14   56-69      4-17  (49)
144 PF08271 TF_Zn_Ribbon:  TFIIB z  56.3     2.4 5.2E-05   20.9  -0.7   12  110-121    17-28  (43)
145 COG1594 RPB9 DNA-directed RNA   56.1     2.8   6E-05   25.9  -0.6   39   28-67     73-111 (113)
146 PF07282 OrfB_Zn_ribbon:  Putat  55.7     8.4 0.00018   21.1   1.4   32   27-69     28-59  (69)
147 COG1327 Predicted transcriptio  55.3     2.1 4.6E-05   27.6  -1.2   11  114-124    30-40  (156)
148 COG1655 Uncharacterized protei  54.9       3 6.5E-05   29.0  -0.6   36    1-36     21-71  (267)
149 KOG4167|consensus               53.8     3.4 7.3E-05   33.7  -0.5   29  111-139   791-819 (907)
150 PF04780 DUF629:  Protein of un  53.6     6.7 0.00015   30.5   1.0   27   28-54     58-84  (466)
151 COG4896 Uncharacterized protei  53.5     7.8 0.00017   20.8   0.9    8   57-64     32-39  (68)
152 smart00440 ZnF_C2C2 C2C2 Zinc   52.1     1.6 3.4E-05   21.4  -1.7    9   57-65     29-37  (40)
153 KOG4124|consensus               52.0     2.4 5.2E-05   31.3  -1.5   50   82-131   347-417 (442)
154 PF04959 ARS2:  Arsenite-resist  51.8     8.5 0.00018   26.7   1.2   30   81-110    74-103 (214)
155 COG3091 SprT Zn-dependent meta  51.6     4.3 9.4E-05   26.3  -0.2   35   82-121   115-149 (156)
156 PF07503 zf-HYPF:  HypF finger;  51.4     2.6 5.6E-05   20.0  -1.0   12  112-123    21-32  (35)
157 smart00661 RPOL9 RNA polymeras  50.8      12 0.00025   19.1   1.4   14   27-40     20-33  (52)
158 KOG2807|consensus               50.3      17 0.00036   26.9   2.5   31   83-119   344-374 (378)
159 smart00154 ZnF_AN1 AN1-like Zi  49.2     9.2  0.0002   18.5   0.8   14   27-40     12-25  (39)
160 PF07975 C1_4:  TFIIH C1-like d  49.0     4.2 9.2E-05   21.1  -0.5   17   57-73     22-38  (51)
161 KOG1280|consensus               48.6      16 0.00034   27.2   2.1   36   84-119    79-116 (381)
162 PF14787 zf-CCHC_5:  GAG-polypr  48.4     9.1  0.0002   18.2   0.6   15  113-127     3-17  (36)
163 PF02176 zf-TRAF:  TRAF-type zi  48.3     8.2 0.00018   20.3   0.6   41   26-68      8-54  (60)
164 PTZ00255 60S ribosomal protein  48.2       4 8.6E-05   24.0  -0.7   31   83-123    35-65  (90)
165 PF01096 TFIIS_C:  Transcriptio  47.7    0.14   3E-06   25.0  -5.9   10  113-122    29-38  (39)
166 PHA02998 RNA polymerase subuni  47.2     1.8 3.8E-05   28.8  -2.5   41   84-124   143-183 (195)
167 PRK00432 30S ribosomal protein  47.2      12 0.00025   19.4   1.0   12   55-66     36-47  (50)
168 COG1998 RPS31 Ribosomal protei  47.2     8.8 0.00019   19.7   0.5   10  112-121    37-46  (51)
169 PF04780 DUF629:  Protein of un  47.1      14  0.0003   28.9   1.7   31  107-137    52-82  (466)
170 PRK12380 hydrogenase nickel in  46.1     6.5 0.00014   24.2  -0.1   10   85-94     71-80  (113)
171 COG2879 Uncharacterized small   44.3      25 0.00055   19.1   2.0   20  122-141    22-41  (65)
172 KOG1842|consensus               44.2      13 0.00028   28.6   1.2   25   84-108    15-39  (505)
173 COG1571 Predicted DNA-binding   43.5      13 0.00029   28.5   1.2   30   85-125   351-380 (421)
174 COG1675 TFA1 Transcription ini  43.3      26 0.00057   23.5   2.4   36   79-123   108-143 (176)
175 PRK14714 DNA polymerase II lar  42.7      18  0.0004   31.8   2.0    9   28-36    668-676 (1337)
176 PF07800 DUF1644:  Protein of u  42.7      32 0.00069   22.6   2.6   60   84-144    80-140 (162)
177 PLN02294 cytochrome c oxidase   42.6      11 0.00025   24.9   0.7   16  109-124   138-153 (174)
178 KOG2857|consensus               42.2      32 0.00069   22.1   2.5   20  113-132    18-37  (157)
179 PF01363 FYVE:  FYVE zinc finge  41.7      15 0.00032   20.0   1.0    9   29-37     11-19  (69)
180 TIGR00280 L37a ribosomal prote  41.4     4.3 9.4E-05   23.9  -1.3   31   83-123    34-64  (91)
181 PF09845 DUF2072:  Zn-ribbon co  41.2      14  0.0003   23.4   0.8   12  113-124     2-13  (131)
182 KOG1842|consensus               40.7      12 0.00026   28.8   0.6   28   27-54     15-42  (505)
183 PF04423 Rad50_zn_hook:  Rad50   40.6     8.7 0.00019   20.0  -0.1   12   86-97     22-33  (54)
184 COG5151 SSL1 RNA polymerase II  40.5      33 0.00071   25.3   2.7   27  111-137   387-413 (421)
185 TIGR00100 hypA hydrogenase nic  40.1      13 0.00028   23.0   0.6   27   26-65     69-95  (115)
186 PF09963 DUF2197:  Uncharacteri  39.5      15 0.00032   19.5   0.7   12   54-65     29-40  (56)
187 PRK12496 hypothetical protein;  39.5      13 0.00027   24.6   0.5   29   83-123   126-154 (164)
188 COG1198 PriA Primosomal protei  39.4     4.1 8.8E-05   33.6  -2.1   15  107-121   470-484 (730)
189 TIGR00686 phnA alkylphosphonat  39.3      18  0.0004   22.0   1.1   15   26-40     18-32  (109)
190 PF03811 Zn_Tnp_IS1:  InsA N-te  39.1     6.2 0.00013   18.8  -0.7   30   28-62      6-35  (36)
191 PRK10220 hypothetical protein;  38.9      23 0.00049   21.7   1.5   15   26-40     19-33  (111)
192 PRK05978 hypothetical protein;  38.1      11 0.00025   24.4   0.1   10   58-67     54-63  (148)
193 KOG2071|consensus               38.1      25 0.00053   28.3   1.9   27  109-135   415-441 (579)
194 COG4888 Uncharacterized Zn rib  37.8     6.2 0.00013   23.6  -1.0   38   25-67     20-57  (104)
195 cd00924 Cyt_c_Oxidase_Vb Cytoc  37.3      15 0.00033   22.0   0.6   14  110-123    77-90  (97)
196 PRK00564 hypA hydrogenase nick  37.1      10 0.00022   23.5  -0.2   10   85-94     72-81  (117)
197 PF14311 DUF4379:  Domain of un  37.1      21 0.00046   18.5   1.1   15   28-42     29-43  (55)
198 KOG0717|consensus               37.0      18 0.00039   28.1   1.0   21  113-133   293-313 (508)
199 cd00730 rubredoxin Rubredoxin;  36.3      15 0.00032   19.0   0.4   12  113-124     2-13  (50)
200 PF01428 zf-AN1:  AN1-like Zinc  36.2      13 0.00028   18.3   0.1   15   26-40     12-26  (43)
201 COG4640 Predicted membrane pro  36.2      23  0.0005   27.0   1.4   18  111-128    14-31  (465)
202 COG0068 HypF Hydrogenase matur  35.0      17 0.00037   29.9   0.7   58   29-94    125-183 (750)
203 TIGR00515 accD acetyl-CoA carb  34.9      20 0.00043   26.1   0.9   11  113-123    46-56  (285)
204 smart00064 FYVE Protein presen  34.7      26 0.00056   19.0   1.2   11   28-38     11-21  (68)
205 COG1198 PriA Primosomal protei  34.6      10 0.00023   31.4  -0.5   11   25-35    473-483 (730)
206 COG1773 Rubredoxin [Energy pro  34.6      14 0.00031   19.5   0.1   12  112-123     3-14  (55)
207 PRK00420 hypothetical protein;  34.5      24 0.00051   21.8   1.1   29   28-68     24-52  (112)
208 COG3364 Zn-ribbon containing p  34.3      22 0.00047   21.4   0.9   14  112-125     2-15  (112)
209 PF10276 zf-CHCC:  Zinc-finger   33.8      16 0.00034   17.9   0.2   12   26-37     28-39  (40)
210 cd00065 FYVE FYVE domain; Zinc  33.5      30 0.00066   17.8   1.3    8   30-37      5-12  (57)
211 PF12773 DZR:  Double zinc ribb  33.3      29 0.00063   17.4   1.2   10   29-38     14-23  (50)
212 PF05290 Baculo_IE-1:  Baculovi  33.2      22 0.00048   22.6   0.8   18   52-69     76-93  (140)
213 PF10013 DUF2256:  Uncharacteri  33.1      23 0.00049   17.6   0.7   13  114-126    10-22  (42)
214 PF11672 DUF3268:  Protein of u  33.0      12 0.00025   22.7  -0.4    7  113-119    32-38  (102)
215 KOG2636|consensus               32.8      42 0.00091   26.1   2.3   28  105-132   394-422 (497)
216 PF02891 zf-MIZ:  MIZ/SP-RING z  32.4      18  0.0004   18.5   0.3    7  113-119    42-48  (50)
217 PF06397 Desulfoferrod_N:  Desu  32.3      17 0.00036   17.4   0.1   12  111-122     5-16  (36)
218 PRK04351 hypothetical protein;  32.1      12 0.00025   24.4  -0.5   33   84-124   112-144 (149)
219 PF01155 HypA:  Hydrogenase exp  31.9      10 0.00022   23.3  -0.8   13   85-97     71-83  (113)
220 PF15616 TerY-C:  TerY-C metal   31.6     8.5 0.00018   24.4  -1.2   13   54-66    103-115 (131)
221 PF10263 SprT-like:  SprT-like   31.6     8.6 0.00019   24.9  -1.2   33   83-123   122-154 (157)
222 TIGR00310 ZPR1_znf ZPR1 zinc f  31.1     6.9 0.00015   26.6  -1.7   39    1-40      2-43  (192)
223 PF05495 zf-CHY:  CHY zinc fing  30.8     5.8 0.00013   22.1  -1.8    9  112-120    61-69  (71)
224 CHL00174 accD acetyl-CoA carbo  30.6      17 0.00037   26.6   0.1   11   57-67     58-68  (296)
225 PTZ00448 hypothetical protein;  30.5      36 0.00078   25.7   1.6   23  112-134   314-336 (373)
226 PF15176 LRR19-TM:  Leucine-ric  30.3      19  0.0004   21.6   0.2   12  114-125    39-50  (102)
227 COG4338 Uncharacterized protei  30.3      14  0.0003   18.8  -0.3    9    2-10     15-23  (54)
228 KOG0978|consensus               30.1      14  0.0003   30.4  -0.5   17  112-128   678-694 (698)
229 COG3677 Transposase and inacti  29.1      27 0.00058   22.1   0.7   35   85-124    31-65  (129)
230 PF14205 Cys_rich_KTR:  Cystein  28.6      15 0.00033   19.3  -0.3    8   27-34     28-35  (55)
231 PF08792 A2L_zn_ribbon:  A2L zi  28.4      24 0.00053   16.4   0.3   13  111-123    20-32  (33)
232 COG4391 Uncharacterized protei  28.3      34 0.00073   18.5   0.9   13   26-38     47-59  (62)
233 PF14803 Nudix_N_2:  Nudix N-te  28.2     8.8 0.00019   18.0  -1.2    8   57-64     23-30  (34)
234 PRK05654 acetyl-CoA carboxylas  28.2      20 0.00043   26.2   0.1   11   57-67     47-57  (292)
235 PF02318 FYVE_2:  FYVE-type zin  27.8      30 0.00065   21.4   0.8   14   26-39     53-66  (118)
236 TIGR00143 hypF [NiFe] hydrogen  27.5     7.8 0.00017   32.0  -2.3   60   57-122    91-150 (711)
237 PF14369 zf-RING_3:  zinc-finge  27.4      29 0.00063   16.3   0.5    8    2-9      24-31  (35)
238 KOG3214|consensus               26.1      14  0.0003   22.1  -0.8   14  111-124    46-59  (109)
239 KOG0717|consensus               25.8      45 0.00098   26.1   1.5   23  113-135   461-483 (508)
240 PF06220 zf-U1:  U1 zinc finger  25.7      40 0.00086   16.2   0.8   11   28-38      4-14  (38)
241 KOG0782|consensus               25.6      21 0.00045   28.7  -0.2   26   15-40    241-266 (1004)
242 PRK03681 hypA hydrogenase nick  25.3      23 0.00051   21.8  -0.0   28   26-65     69-96  (114)
243 PF04810 zf-Sec23_Sec24:  Sec23  25.3      46   0.001   16.0   1.1    9   56-64     24-32  (40)
244 PF08790 zf-LYAR:  LYAR-type C2  24.5      18 0.00039   16.2  -0.4    9   29-37      2-10  (28)
245 PTZ00043 cytochrome c oxidase   24.2      36 0.00078   23.8   0.7   16  109-124   178-193 (268)
246 PF09855 DUF2082:  Nucleic-acid  24.1      34 0.00073   18.7   0.5    9  113-121     1-9   (64)
247 COG5188 PRP9 Splicing factor 3  23.8      61  0.0013   24.4   1.8   28  105-132   367-395 (470)
248 KOG4118|consensus               23.6      58  0.0013   17.8   1.3   26   28-53     39-64  (74)
249 KOG4377|consensus               23.4      23 0.00051   27.1  -0.3   21  118-138   409-429 (480)
250 TIGR00595 priA primosomal prot  23.3     8.5 0.00018   30.4  -2.7   14  107-120   248-261 (505)
251 KOG4317|consensus               23.1      20 0.00043   26.3  -0.7   20   84-103    19-38  (383)
252 KOG4727|consensus               22.8      37  0.0008   22.6   0.5   23   26-48     74-96  (193)
253 PRK00762 hypA hydrogenase nick  22.7      21 0.00045   22.4  -0.6   11   85-96     71-81  (124)
254 PF07295 DUF1451:  Protein of u  22.5      15 0.00033   23.8  -1.3   29   83-121   111-139 (146)
255 TIGR01384 TFS_arch transcripti  22.5      12 0.00027   22.4  -1.6   39   27-67     62-101 (104)
256 PF04438 zf-HIT:  HIT zinc fing  22.1      30 0.00066   15.6   0.0   11  112-122    13-23  (30)
257 COG5112 UFD2 U1-like Zn-finger  21.5      35 0.00075   20.7   0.2   24   26-49     54-77  (126)
258 KOG2272|consensus               21.3      48   0.001   23.7   0.8   13  111-123   220-232 (332)
259 PF11781 RRN7:  RNA polymerase   21.2      38 0.00082   16.1   0.3    9   28-36      9-17  (36)
260 PF01215 COX5B:  Cytochrome c o  21.1      28  0.0006   22.3  -0.3   15  110-124   110-124 (136)
261 smart00731 SprT SprT homologue  20.8      27 0.00059   22.4  -0.4   32   84-122   112-143 (146)
262 PF02591 DUF164:  Putative zinc  20.2      82  0.0018   16.4   1.5   32   29-65     24-55  (56)

No 1  
>KOG2462|consensus
Probab=99.97  E-value=1.7e-32  Score=185.35  Aligned_cols=131  Identities=37%  Similarity=0.750  Sum_probs=124.3

Q ss_pred             CCCccccccCChhhHHHHHHHcCC---CCCeeCCccchhccCcccHHHhhhhcCCCCCcccccchhhhccChHHHHHHHh
Q psy12258          1 MCDTCGKSFFSSTALKVHNRVHLG---LKPYGCEVCGRHFRQWGDLKYHKASLHSDVKAFQCEYCGKDFARKYSLVVHRR   77 (171)
Q Consensus         1 ~C~~C~~~f~~~~~l~~H~~~h~~---~~~~~C~~C~~~f~~~~~l~~H~~~~h~~~~~~~C~~C~~~~~~~~~l~~h~~   77 (171)
                      +|++|++.+.+..+|.+|.+.|..   .+.+.|++|++.+.+...|..|++ +|.  -+.+|.+||+.|...|.|+.|++
T Consensus       132 ~c~eCgk~ysT~snLsrHkQ~H~~~~s~ka~~C~~C~K~YvSmpALkMHir-TH~--l~c~C~iCGKaFSRPWLLQGHiR  208 (279)
T KOG2462|consen  132 KCPECGKSYSTSSNLSRHKQTHRSLDSKKAFSCKYCGKVYVSMPALKMHIR-THT--LPCECGICGKAFSRPWLLQGHIR  208 (279)
T ss_pred             eccccccccccccccchhhcccccccccccccCCCCCceeeehHHHhhHhh-ccC--CCcccccccccccchHHhhcccc
Confidence            699999999999999999999876   467999999999999999999998 575  57899999999999999999999


Q ss_pred             hhcCCCCccCccchhhcCCHHHHHHHHHHhcCCCCccCcccccccCCchhHHHHHHH
Q psy12258         78 IHTGERNYQCEFCHKAFRASSYLQNHRRIHTGEKPHFCPVCNKMFRVRSDMKRHLNT  134 (171)
Q Consensus        78 ~~~~~~~~~C~~C~~~~~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~  134 (171)
                      .|+|+|||.|+.|+++|...+.|+.|+++|.+.++|.|..|+|.|...+.|.+|...
T Consensus       209 THTGEKPF~C~hC~kAFADRSNLRAHmQTHS~~K~~qC~~C~KsFsl~SyLnKH~ES  265 (279)
T KOG2462|consen  209 THTGEKPFSCPHCGKAFADRSNLRAHMQTHSDVKKHQCPRCGKSFALKSYLNKHSES  265 (279)
T ss_pred             cccCCCCccCCcccchhcchHHHHHHHHhhcCCccccCcchhhHHHHHHHHHHhhhh
Confidence            999999999999999999999999999999999999999999999999999999764


No 2  
>KOG2462|consensus
Probab=99.91  E-value=7.5e-25  Score=148.50  Aligned_cols=103  Identities=38%  Similarity=0.703  Sum_probs=99.2

Q ss_pred             CCCccccccCChhhHHHHHHHcCCCCCeeCCccchhccCcccHHHhhhhcCCCCCcccccchhhhccChHHHHHHHhhhc
Q psy12258          1 MCDTCGKSFFSSTALKVHNRVHLGLKPYGCEVCGRHFRQWGDLKYHKASLHSDVKAFQCEYCGKDFARKYSLVVHRRIHT   80 (171)
Q Consensus         1 ~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~~h~~~~~~~C~~C~~~~~~~~~l~~h~~~~~   80 (171)
                      +|+.|+++|.....|..|+++|.  -++.|.+||+.|+..+.|+.|++ .|+|++||.|+.|++.|-++++|..||.+|.
T Consensus       163 ~C~~C~K~YvSmpALkMHirTH~--l~c~C~iCGKaFSRPWLLQGHiR-THTGEKPF~C~hC~kAFADRSNLRAHmQTHS  239 (279)
T KOG2462|consen  163 SCKYCGKVYVSMPALKMHIRTHT--LPCECGICGKAFSRPWLLQGHIR-THTGEKPFSCPHCGKAFADRSNLRAHMQTHS  239 (279)
T ss_pred             cCCCCCceeeehHHHhhHhhccC--CCcccccccccccchHHhhcccc-cccCCCCccCCcccchhcchHHHHHHHHhhc
Confidence            59999999999999999999997  67999999999999999999999 7999999999999999999999999999999


Q ss_pred             CCCCccCccchhhcCCHHHHHHHHHH
Q psy12258         81 GERNYQCEFCHKAFRASSYLQNHRRI  106 (171)
Q Consensus        81 ~~~~~~C~~C~~~~~~~~~l~~H~~~  106 (171)
                      +.|+|.|+.|++.|...+.|.+|...
T Consensus       240 ~~K~~qC~~C~KsFsl~SyLnKH~ES  265 (279)
T KOG2462|consen  240 DVKKHQCPRCGKSFALKSYLNKHSES  265 (279)
T ss_pred             CCccccCcchhhHHHHHHHHHHhhhh
Confidence            99999999999999999999999764


No 3  
>KOG1074|consensus
Probab=99.85  E-value=1.5e-22  Score=154.47  Aligned_cols=87  Identities=29%  Similarity=0.591  Sum_probs=75.9

Q ss_pred             cccccchhhhccChHHHHHHHhhhcCCCCccCccchhhcCCHHHHHHHHHHhcCC----CCccCc---ccccccCCchhH
Q psy12258         56 AFQCEYCGKDFARKYSLVVHRRIHTGERNYQCEFCHKAFRASSYLQNHRRIHTGE----KPHFCP---VCNKMFRVRSDM  128 (171)
Q Consensus        56 ~~~C~~C~~~~~~~~~l~~h~~~~~~~~~~~C~~C~~~~~~~~~l~~H~~~h~~~----~~~~C~---~C~~~f~~~~~l  128 (171)
                      +.+|.+|.+...-.+.|+.|++.|+|++||+|.+||++|+.+..|+.|+.+|...    .++.|+   +|-+.|...-.|
T Consensus       605 PNqCiiC~rVlSC~saLqmHyrtHtGERPFkCKiCgRAFtTkGNLkaH~~vHka~p~~R~q~ScP~~~ic~~kftn~V~l  684 (958)
T KOG1074|consen  605 PNQCIICLRVLSCPSALQMHYRTHTGERPFKCKICGRAFTTKGNLKAHMSVHKAKPPARVQFSCPSTFICQKKFTNAVTL  684 (958)
T ss_pred             ccceeeeeecccchhhhhhhhhcccCcCccccccccchhccccchhhcccccccCccccccccCCchhhhcccccccccc
Confidence            3689999999999999999999999999999999999999999999999888543    457899   999999999999


Q ss_pred             HHHHHHhccCcccc
Q psy12258        129 KRHLNTHNVDARQY  142 (171)
Q Consensus       129 ~~H~~~h~~~~~~~  142 (171)
                      ..|+++|.++..+.
T Consensus       685 pQhIriH~~~~~s~  698 (958)
T KOG1074|consen  685 PQHIRIHLGGQISN  698 (958)
T ss_pred             cceEEeecCCCCCC
Confidence            99999998665543


No 4  
>KOG3608|consensus
Probab=99.84  E-value=5.5e-21  Score=133.63  Aligned_cols=133  Identities=30%  Similarity=0.511  Sum_probs=103.9

Q ss_pred             CCccccccCChhhHHHHHHHcCCCCCeeCCccchhccCcccHHHhhhhcC-CCCCcccccchhhhccChHHHHHHHhhhc
Q psy12258          2 CDTCGKSFFSSTALKVHNRVHLGLKPYGCEVCGRHFRQWGDLKYHKASLH-SDVKAFQCEYCGKDFARKYSLVVHRRIHT   80 (171)
Q Consensus         2 C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~~h-~~~~~~~C~~C~~~~~~~~~l~~h~~~~~   80 (171)
                      |..|-..+..+..|++|++.|.+++...|+.||..|.....|..|.+... ....+|.|..|.+.|-+...|..|+..|.
T Consensus       182 W~~Ct~~~~~k~~LreH~r~Hs~eKvvACp~Cg~~F~~~tkl~DH~rRqt~l~~n~fqC~~C~KrFaTeklL~~Hv~rHv  261 (467)
T KOG3608|consen  182 WAMCTKHMGNKYRLREHIRTHSNEKVVACPHCGELFRTKTKLFDHLRRQTELNTNSFQCAQCFKRFATEKLLKSHVVRHV  261 (467)
T ss_pred             chhhhhhhccHHHHHHHHHhcCCCeEEecchHHHHhccccHHHHHHHhhhhhcCCchHHHHHHHHHhHHHHHHHHHHHhh
Confidence            45688899999999999999999999999999999999999999987422 23456778888888877777777777763


Q ss_pred             CCCCccCccchhhcCCHHHHHHHHHH-hcCCCCccCcccccccCCchhHHHHHHHhc
Q psy12258         81 GERNYQCEFCHKAFRASSYLQNHRRI-HTGEKPHFCPVCNKMFRVRSDMKRHLNTHN  136 (171)
Q Consensus        81 ~~~~~~C~~C~~~~~~~~~l~~H~~~-h~~~~~~~C~~C~~~f~~~~~l~~H~~~h~  136 (171)
                        .-|+|+.|+......++|..|++. |...+||+|..|++.|...++|.+|+..|.
T Consensus       262 --n~ykCplCdmtc~~~ssL~~H~r~rHs~dkpfKCd~Cd~~c~~esdL~kH~~~HS  316 (467)
T KOG3608|consen  262 --NCYKCPLCDMTCSSASSLTTHIRYRHSKDKPFKCDECDTRCVRESDLAKHVQVHS  316 (467)
T ss_pred             --hcccccccccCCCChHHHHHHHHhhhccCCCccccchhhhhccHHHHHHHHHhcc
Confidence              456777777777777777777765 555677777777777777777777776665


No 5  
>KOG3576|consensus
Probab=99.77  E-value=7.5e-20  Score=119.05  Aligned_cols=115  Identities=34%  Similarity=0.618  Sum_probs=103.3

Q ss_pred             CCeeCCccchhccCcccHHHhhhhcCCCCCcccccchhhhccChHHHHHHHhhhcCCCCccCccchhhcCCHHHHHHHHH
Q psy12258         26 KPYGCEVCGRHFRQWGDLKYHKASLHSDVKAFQCEYCGKDFARKYSLVVHRRIHTGERNYQCEFCHKAFRASSYLQNHRR  105 (171)
Q Consensus        26 ~~~~C~~C~~~f~~~~~l~~H~~~~h~~~~~~~C~~C~~~~~~~~~l~~h~~~~~~~~~~~C~~C~~~~~~~~~l~~H~~  105 (171)
                      ..|.|.+|++.|.....|.+|++ -|...+.+.|..||+.|.+.-+|.+|++.|+|.+||+|..|+++|++.-+|..|.+
T Consensus       116 d~ftCrvCgK~F~lQRmlnrh~k-ch~~vkr~lct~cgkgfndtfdlkrh~rthtgvrpykc~~c~kaftqrcsleshl~  194 (267)
T KOG3576|consen  116 DSFTCRVCGKKFGLQRMLNRHLK-CHSDVKRHLCTFCGKGFNDTFDLKRHTRTHTGVRPYKCSLCEKAFTQRCSLESHLK  194 (267)
T ss_pred             CeeeeehhhhhhhHHHHHHHHhh-hccHHHHHHHhhccCcccchhhhhhhhccccCccccchhhhhHHHHhhccHHHHHH
Confidence            34899999999999999999998 69889999999999999999999999999999999999999999999999999988


Q ss_pred             HhcC-----------CCCccCcccccccCCchhHHHHHHHhccCccc
Q psy12258        106 IHTG-----------EKPHFCPVCNKMFRVRSDMKRHLNTHNVDARQ  141 (171)
Q Consensus       106 ~h~~-----------~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~  141 (171)
                      ..++           .+.|.|..||..-.....+..|+..||.....
T Consensus       195 kvhgv~~~yaykerr~kl~vcedcg~t~~~~e~~~~h~~~~hp~Spa  241 (267)
T KOG3576|consen  195 KVHGVQHQYAYKERRAKLYVCEDCGYTSERPEVYYLHLKLHHPFSPA  241 (267)
T ss_pred             HHcCchHHHHHHHhhhheeeecccCCCCCChhHHHHHHHhcCCCCHH
Confidence            7554           45699999999888888899999998876543


No 6  
>KOG1074|consensus
Probab=99.77  E-value=2.1e-19  Score=137.45  Aligned_cols=143  Identities=36%  Similarity=0.715  Sum_probs=120.7

Q ss_pred             CCCccccccCChhhHHHHHHHcCCCCCeeCCccchhccCcccHHHhhhhcCCCCC----ccccc---chhhhccChHHHH
Q psy12258          1 MCDTCGKSFFSSTALKVHNRVHLGLKPYGCEVCGRHFRQWGDLKYHKASLHSDVK----AFQCE---YCGKDFARKYSLV   73 (171)
Q Consensus         1 ~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~~h~~~~----~~~C~---~C~~~~~~~~~l~   73 (171)
                      +|-+|.++...+..|+.|.++|++++||+|.+||+.|....+|+.||. .|....    .+.|+   +|.+-|.+.-.|.
T Consensus       607 qCiiC~rVlSC~saLqmHyrtHtGERPFkCKiCgRAFtTkGNLkaH~~-vHka~p~~R~q~ScP~~~ic~~kftn~V~lp  685 (958)
T KOG1074|consen  607 QCIICLRVLSCPSALQMHYRTHTGERPFKCKICGRAFTTKGNLKAHMS-VHKAKPPARVQFSCPSTFICQKKFTNAVTLP  685 (958)
T ss_pred             ceeeeeecccchhhhhhhhhcccCcCccccccccchhccccchhhccc-ccccCccccccccCCchhhhccccccccccc
Confidence            588999999999999999999999999999999999999999999997 675433    35666   6776666666666


Q ss_pred             HHHhhhcCC-----------------------------------------------------------------------
Q psy12258         74 VHRRIHTGE-----------------------------------------------------------------------   82 (171)
Q Consensus        74 ~h~~~~~~~-----------------------------------------------------------------------   82 (171)
                      .|++.|.+.                                                                       
T Consensus       686 QhIriH~~~~~s~g~~a~e~~~~adq~~~~qk~~~~a~~f~~~~se~~~~~s~~~~~~~~~t~t~~~~~tp~~~e~~~~~  765 (958)
T KOG1074|consen  686 QHIRIHLGGQISNGGTAAEGILAADQCSSCQKTFSDARSFSQQISEQPSPESEPDEQMDERTETEELDVTPPPPENSCGR  765 (958)
T ss_pred             ceEEeecCCCCCCCcccccccchhcccchhhhcccccccchhhhhccCCcccCCcccccccccccccccCCCcccccccc
Confidence            666555410                                                                       


Q ss_pred             --------------------------------------------------------------------------------
Q psy12258         83 --------------------------------------------------------------------------------   82 (171)
Q Consensus        83 --------------------------------------------------------------------------------   82 (171)
                                                                                                      
T Consensus       766 ~~~~e~~i~~~g~te~asa~~~~vg~~s~~~~~~~~~~T~~k~~~~~~~~~~~~~~~v~~~pvl~~~~~~~l~eg~~t~~  845 (958)
T KOG1074|consen  766 ELEGEMAISVRGSTEEASANLDEVGTVSAAGEAGEEDDTSEKPTQASSFPGEILAPSVNMDPVLWNQETSMLNEGLATKT  845 (958)
T ss_pred             ccCcccccccccchhhhhcChhhhcCccccchhhhhcccCCCCcccccCCCcCCccccccCchhhccccccccccccccc
Confidence                                                                                            


Q ss_pred             --------------------------------CCccCccchhhcCCHHHHHHHHHHhcCCCCccCcccccccCCchhHHH
Q psy12258         83 --------------------------------RNYQCEFCHKAFRASSYLQNHRRIHTGEKPHFCPVCNKMFRVRSDMKR  130 (171)
Q Consensus        83 --------------------------------~~~~C~~C~~~~~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~  130 (171)
                                                      ....|..|++.|...+.|+.|+++|++++||.|.+|++.|..+.+|..
T Consensus       846 n~~t~~~~~~sv~qs~~~p~l~p~l~~~~pvnn~h~C~vCgk~FsSSsALqiH~rTHtg~KPF~C~fC~~aFttrgnLKv  925 (958)
T KOG1074|consen  846 NEITPEGPADSVIQSGGVPTLEPSLGRPGPVNNAHVCNVCGKQFSSSAALEIHMRTHTGPKPFFCHFCEEAFTTRGNLKV  925 (958)
T ss_pred             ccccCCCcchhhhhhccccccCCCCCCCCcccchhhhccchhcccchHHHHHhhhcCCCCCCccchhhhhhhhhhhhhhh
Confidence                                            005699999999999999999999999999999999999999999999


Q ss_pred             HHHHhccCcccccc
Q psy12258        131 HLNTHNVDARQYLT  144 (171)
Q Consensus       131 H~~~h~~~~~~~~~  144 (171)
                      ||..|+....+..-
T Consensus       926 HMgtH~w~q~~srr  939 (958)
T KOG1074|consen  926 HMGTHMWVQPPSRR  939 (958)
T ss_pred             hhccccccCCCccC
Confidence            99999877665444


No 7  
>KOG3608|consensus
Probab=99.75  E-value=1.9e-18  Score=121.07  Aligned_cols=132  Identities=28%  Similarity=0.543  Sum_probs=102.0

Q ss_pred             CCccccccCChhhHHHHHHHcCCCCCeeCCccchhccCcccHHHhhhhcCCCCCcccccchhhhccChHHHHHHHhhhcC
Q psy12258          2 CDTCGKSFFSSTALKVHNRVHLGLKPYGCEVCGRHFRQWGDLKYHKASLHSDVKAFQCEYCGKDFARKYSLVVHRRIHTG   81 (171)
Q Consensus         2 C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~~h~~~~~~~C~~C~~~~~~~~~l~~h~~~~~~   81 (171)
                      |..|.+.|.+...|..|+..|.  ..|+|+.|..+....++|..|++.-|+..+||+|..|+..+...+.|+.|...|. 
T Consensus       240 C~~C~KrFaTeklL~~Hv~rHv--n~ykCplCdmtc~~~ssL~~H~r~rHs~dkpfKCd~Cd~~c~~esdL~kH~~~HS-  316 (467)
T KOG3608|consen  240 CAQCFKRFATEKLLKSHVVRHV--NCYKCPLCDMTCSSASSLTTHIRYRHSKDKPFKCDECDTRCVRESDLAKHVQVHS-  316 (467)
T ss_pred             HHHHHHHHhHHHHHHHHHHHhh--hcccccccccCCCChHHHHHHHHhhhccCCCccccchhhhhccHHHHHHHHHhcc-
Confidence            5566666666666666666664  3478888888888888888888888888888888888888888888888888765 


Q ss_pred             CCCccCcc--chhhcCCHHHHHHHHHHhc-C--CCCccCcccccccCCchhHHHHHHHhc
Q psy12258         82 ERNYQCEF--CHKAFRASSYLQNHRRIHT-G--EKPHFCPVCNKMFRVRSDMKRHLNTHN  136 (171)
Q Consensus        82 ~~~~~C~~--C~~~~~~~~~l~~H~~~h~-~--~~~~~C~~C~~~f~~~~~l~~H~~~h~  136 (171)
                      +..|.|.-  |...+.+...+.+|...++ +  +-+|.|..|.+-|++-.+|..|++.-|
T Consensus       317 ~~~y~C~h~~C~~s~r~~~q~~~H~~evhEg~np~~Y~CH~Cdr~ft~G~~L~~HL~kkH  376 (467)
T KOG3608|consen  317 KTVYQCEHPDCHYSVRTYTQMRRHFLEVHEGNNPILYACHCCDRFFTSGKSLSAHLMKKH  376 (467)
T ss_pred             ccceecCCCCCcHHHHHHHHHHHHHHHhccCCCCCceeeecchhhhccchhHHHHHHHhh
Confidence            66788866  8888888888888887655 3  446889999999988888988875443


No 8  
>KOG3576|consensus
Probab=99.75  E-value=3.5e-19  Score=115.96  Aligned_cols=110  Identities=31%  Similarity=0.575  Sum_probs=101.8

Q ss_pred             CCccccccCChhhHHHHHHHcCCCCCeeCCccchhccCcccHHHhhhhcCCCCCcccccchhhhccChHHHHHHHhhhcC
Q psy12258          2 CDTCGKSFFSSTALKVHNRVHLGLKPYGCEVCGRHFRQWGDLKYHKASLHSDVKAFQCEYCGKDFARKYSLVVHRRIHTG   81 (171)
Q Consensus         2 C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~~h~~~~~~~C~~C~~~~~~~~~l~~h~~~~~~   81 (171)
                      |.+|++.|.-..-|.+|++-|..-+.+.|..||++|.+-.+|.+|++ +|++.+||+|..|++.|+....|..|++.-++
T Consensus       120 CrvCgK~F~lQRmlnrh~kch~~vkr~lct~cgkgfndtfdlkrh~r-thtgvrpykc~~c~kaftqrcsleshl~kvhg  198 (267)
T KOG3576|consen  120 CRVCGKKFGLQRMLNRHLKCHSDVKRHLCTFCGKGFNDTFDLKRHTR-THTGVRPYKCSLCEKAFTQRCSLESHLKKVHG  198 (267)
T ss_pred             eehhhhhhhHHHHHHHHhhhccHHHHHHHhhccCcccchhhhhhhhc-cccCccccchhhhhHHHHhhccHHHHHHHHcC
Confidence            88999999999999999999999999999999999999999999999 79999999999999999999999999887665


Q ss_pred             -----------CCCccCccchhhcCCHHHHHHHHHHhcCCCC
Q psy12258         82 -----------ERNYQCEFCHKAFRASSYLQNHRRIHTGEKP  112 (171)
Q Consensus        82 -----------~~~~~C~~C~~~~~~~~~l~~H~~~h~~~~~  112 (171)
                                 .+.|.|..||..-.....+..|+..|+...|
T Consensus       199 v~~~yaykerr~kl~vcedcg~t~~~~e~~~~h~~~~hp~Sp  240 (267)
T KOG3576|consen  199 VQHQYAYKERRAKLYVCEDCGYTSERPEVYYLHLKLHHPFSP  240 (267)
T ss_pred             chHHHHHHHhhhheeeecccCCCCCChhHHHHHHHhcCCCCH
Confidence                       4679999999999999999999998876543


No 9  
>KOG3623|consensus
Probab=99.68  E-value=1.1e-17  Score=126.59  Aligned_cols=106  Identities=34%  Similarity=0.674  Sum_probs=94.9

Q ss_pred             eeCCccchhccCcccHHHhhhhcCCC-CCcccccchhhhccChHHHHHHHhhhcC-------------CCCccCccchhh
Q psy12258         28 YGCEVCGRHFRQWGDLKYHKASLHSD-VKAFQCEYCGKDFARKYSLVVHRRIHTG-------------ERNYQCEFCHKA   93 (171)
Q Consensus        28 ~~C~~C~~~f~~~~~l~~H~~~~h~~-~~~~~C~~C~~~~~~~~~l~~h~~~~~~-------------~~~~~C~~C~~~   93 (171)
                      .+|++|.+++.+...|+.|++..|.. +..|.|..|..+|-+...|.+||..|..             .+.|+|++|+++
T Consensus       211 ltcpycdrgykrltslkeHikyrhekne~nfsC~lCsytFAyRtQLErhm~~hkpg~dqa~sltqsa~lRKFKCtECgKA  290 (1007)
T KOG3623|consen  211 LTCPYCDRGYKRLTSLKEHIKYRHEKNEPNFSCMLCSYTFAYRTQLERHMQLHKPGGDQAISLTQSALLRKFKCTECGKA  290 (1007)
T ss_pred             hcchhHHHHHHHHHHHHHHHHHHHhhCCCCCcchhhhhhhhhHHHHHHHHHhhcCCCcccccccchhhhccccccccchh
Confidence            67999999999999999998876653 4458899999999999999999988753             345999999999


Q ss_pred             cCCHHHHHHHHHHhcCCCCccCcccccccCCchhHHHHHH
Q psy12258         94 FRASSYLQNHRRIHTGEKPHFCPVCNKMFRVRSDMKRHLN  133 (171)
Q Consensus        94 ~~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~  133 (171)
                      |+.+..|..|+++|.|++||.|+-|+|.|...+.+..||-
T Consensus       291 FKfKHHLKEHlRIHSGEKPfeCpnCkKRFSHSGSySSHmS  330 (1007)
T KOG3623|consen  291 FKFKHHLKEHLRIHSGEKPFECPNCKKRFSHSGSYSSHMS  330 (1007)
T ss_pred             hhhHHHHHhhheeecCCCCcCCcccccccccCCccccccc
Confidence            9999999999999999999999999999999999999984


No 10 
>KOG3623|consensus
Probab=99.62  E-value=2.8e-16  Score=119.22  Aligned_cols=80  Identities=39%  Similarity=0.810  Sum_probs=77.0

Q ss_pred             CCcccccchhhhccChHHHHHHHhhhcCCCCccCccchhhcCCHHHHHHHHHHhcCCCCccCcccccccCCchhHHHHHH
Q psy12258         54 VKAFQCEYCGKDFARKYSLVVHRRIHTGERNYQCEFCHKAFRASSYLQNHRRIHTGEKPHFCPVCNKMFRVRSDMKRHLN  133 (171)
Q Consensus        54 ~~~~~C~~C~~~~~~~~~l~~h~~~~~~~~~~~C~~C~~~~~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~  133 (171)
                      ...|.|..|+++|--.+.|.+|...|+|.+||+|.+|.++|+.+..|..|.+.|.|++||.|.+|+|.|...+.+..||.
T Consensus       892 ~gmyaCDqCDK~FqKqSSLaRHKYEHsGqRPyqC~iCkKAFKHKHHLtEHkRLHSGEKPfQCdKClKRFSHSGSYSQHMN  971 (1007)
T KOG3623|consen  892 DGMYACDQCDKAFQKQSSLARHKYEHSGQRPYQCIICKKAFKHKHHLTEHKRLHSGEKPFQCDKCLKRFSHSGSYSQHMN  971 (1007)
T ss_pred             cccchHHHHHHHHHhhHHHHHhhhhhcCCCCcccchhhHhhhhhhhhhhhhhhccCCCcchhhhhhhhcccccchHhhhc
Confidence            35699999999999999999999999999999999999999999999999999999999999999999999999999985


No 11 
>PLN03086 PRLI-interacting factor K; Provisional
Probab=99.41  E-value=2.9e-13  Score=102.52  Aligned_cols=103  Identities=25%  Similarity=0.553  Sum_probs=81.6

Q ss_pred             CCeeCCccchhccCcccHHHhhhhcCCCCCcccccchhhhccChHHHHHHHhhhcCCCCccCccchhhcC----------
Q psy12258         26 KPYGCEVCGRHFRQWGDLKYHKASLHSDVKAFQCEYCGKDFARKYSLVVHRRIHTGERNYQCEFCHKAFR----------   95 (171)
Q Consensus        26 ~~~~C~~C~~~f~~~~~l~~H~~~~h~~~~~~~C~~C~~~~~~~~~l~~h~~~~~~~~~~~C~~C~~~~~----------   95 (171)
                      +.+.|+.|++.|. ...|..|+...|   .++.|+ |+..+ ....|..|+..+.+.+++.|+.|+..+.          
T Consensus       452 ~H~~C~~Cgk~f~-~s~LekH~~~~H---kpv~Cp-Cg~~~-~R~~L~~H~~thCp~Kpi~C~fC~~~v~~g~~~~d~~d  525 (567)
T PLN03086        452 NHVHCEKCGQAFQ-QGEMEKHMKVFH---EPLQCP-CGVVL-EKEQMVQHQASTCPLRLITCRFCGDMVQAGGSAMDVRD  525 (567)
T ss_pred             cCccCCCCCCccc-hHHHHHHHHhcC---CCccCC-CCCCc-chhHHHhhhhccCCCCceeCCCCCCccccCccccchhh
Confidence            3468999999986 577899988533   678999 99755 5678899999898999999999998884          


Q ss_pred             CHHHHHHHHHHhcCCCCccCcccccccCCchhHHHHHHHhc
Q psy12258         96 ASSYLQNHRRIHTGEKPHFCPVCNKMFRVRSDMKRHLNTHN  136 (171)
Q Consensus        96 ~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~h~  136 (171)
                      ....|..|.... +.+++.|..||+.+..+ .|..|+...|
T Consensus       526 ~~s~Lt~HE~~C-G~rt~~C~~Cgk~Vrlr-dm~~H~~~~h  564 (567)
T PLN03086        526 RLRGMSEHESIC-GSRTAPCDSCGRSVMLK-EMDIHQIAVH  564 (567)
T ss_pred             hhhhHHHHHHhc-CCcceEccccCCeeeeh-hHHHHHHHhh
Confidence            235788898874 88899999999888655 6778876544


No 12 
>PHA00733 hypothetical protein
Probab=99.26  E-value=6.1e-12  Score=78.79  Aligned_cols=82  Identities=23%  Similarity=0.332  Sum_probs=65.2

Q ss_pred             CCcccccchhhhccChHHHHHH--H---hhhcCCCCccCccchhhcCCHHHHHHHHHHhcCCCCccCcccccccCCchhH
Q psy12258         54 VKAFQCEYCGKDFARKYSLVVH--R---RIHTGERNYQCEFCHKAFRASSYLQNHRRIHTGEKPHFCPVCNKMFRVRSDM  128 (171)
Q Consensus        54 ~~~~~C~~C~~~~~~~~~l~~h--~---~~~~~~~~~~C~~C~~~~~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l  128 (171)
                      .+++.|.+|...|.....|..+  +   ..+++.++|.|+.|++.|.+...|..|++.+  ..+|.|+.|++.|...+.|
T Consensus        38 ~~~~~~~~~~~~~~~~~~l~~~~~l~~~~~~~~~kPy~C~~Cgk~Fss~s~L~~H~r~h--~~~~~C~~CgK~F~~~~sL  115 (128)
T PHA00733         38 QKRLIRAVVKTLIYNPQLLDESSYLYKLLTSKAVSPYVCPLCLMPFSSSVSLKQHIRYT--EHSKVCPVCGKEFRNTDST  115 (128)
T ss_pred             hhhHHHHHHhhhccChhhhcchHHHHhhcccCCCCCccCCCCCCcCCCHHHHHHHHhcC--CcCccCCCCCCccCCHHHH
Confidence            4567888888777776666554  1   2334578999999999999999999999876  4579999999999999999


Q ss_pred             HHHHHHhcc
Q psy12258        129 KRHLNTHNV  137 (171)
Q Consensus       129 ~~H~~~h~~  137 (171)
                      ..|+...|.
T Consensus       116 ~~H~~~~h~  124 (128)
T PHA00733        116 LDHVCKKHN  124 (128)
T ss_pred             HHHHHHhcC
Confidence            999876653


No 13 
>PHA00733 hypothetical protein
Probab=99.17  E-value=2.6e-11  Score=75.94  Aligned_cols=83  Identities=22%  Similarity=0.224  Sum_probs=68.8

Q ss_pred             CCCeeCCccchhccCcccHHHh--hh--hcCCCCCcccccchhhhccChHHHHHHHhhhcCCCCccCccchhhcCCHHHH
Q psy12258         25 LKPYGCEVCGRHFRQWGDLKYH--KA--SLHSDVKAFQCEYCGKDFARKYSLVVHRRIHTGERNYQCEFCHKAFRASSYL  100 (171)
Q Consensus        25 ~~~~~C~~C~~~f~~~~~l~~H--~~--~~h~~~~~~~C~~C~~~~~~~~~l~~h~~~~~~~~~~~C~~C~~~~~~~~~l  100 (171)
                      .+++.|.+|...|.....|..+  +.  ..+...++|.|..|++.|.....|..|+..+  ..++.|..|++.|.....|
T Consensus        38 ~~~~~~~~~~~~~~~~~~l~~~~~l~~~~~~~~~kPy~C~~Cgk~Fss~s~L~~H~r~h--~~~~~C~~CgK~F~~~~sL  115 (128)
T PHA00733         38 QKRLIRAVVKTLIYNPQLLDESSYLYKLLTSKAVSPYVCPLCLMPFSSSVSLKQHIRYT--EHSKVCPVCGKEFRNTDST  115 (128)
T ss_pred             hhhHHHHHHhhhccChhhhcchHHHHhhcccCCCCCccCCCCCCcCCCHHHHHHHHhcC--CcCccCCCCCCccCCHHHH
Confidence            5678999999988887666655  11  1234578999999999999999999999876  4579999999999999999


Q ss_pred             HHHHHHhcC
Q psy12258        101 QNHRRIHTG  109 (171)
Q Consensus       101 ~~H~~~h~~  109 (171)
                      ..|+...++
T Consensus       116 ~~H~~~~h~  124 (128)
T PHA00733        116 LDHVCKKHN  124 (128)
T ss_pred             HHHHHHhcC
Confidence            999988765


No 14 
>PHA02768 hypothetical protein; Provisional
Probab=99.12  E-value=3.2e-11  Score=62.94  Aligned_cols=44  Identities=16%  Similarity=0.371  Sum_probs=36.9

Q ss_pred             CccCccchhhcCCHHHHHHHHHHhcCCCCccCcccccccCCchhHH
Q psy12258         84 NYQCEFCHKAFRASSYLQNHRRIHTGEKPHFCPVCNKMFRVRSDMK  129 (171)
Q Consensus        84 ~~~C~~C~~~~~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~  129 (171)
                      .|.|+.||+.|...+.|..|+++|+  ++|+|..|++.|...+.|.
T Consensus         5 ~y~C~~CGK~Fs~~~~L~~H~r~H~--k~~kc~~C~k~f~~~s~l~   48 (55)
T PHA02768          5 GYECPICGEIYIKRKSMITHLRKHN--TNLKLSNCKRISLRTGEYI   48 (55)
T ss_pred             ccCcchhCCeeccHHHHHHHHHhcC--CcccCCcccceecccceeE
Confidence            4789999999999999999999887  6888999999888777653


No 15 
>PLN03086 PRLI-interacting factor K; Provisional
Probab=99.11  E-value=1.7e-10  Score=87.81  Aligned_cols=98  Identities=22%  Similarity=0.555  Sum_probs=80.9

Q ss_pred             CCCccccccCChhhHHHHHHHcCCCCCeeCCccchhccCcccHHHhhhhcCCCCCcccccchhhhccC----------hH
Q psy12258          1 MCDTCGKSFFSSTALKVHNRVHLGLKPYGCEVCGRHFRQWGDLKYHKASLHSDVKAFQCEYCGKDFAR----------KY   70 (171)
Q Consensus         1 ~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~~h~~~~~~~C~~C~~~~~~----------~~   70 (171)
                      .|+.|+..|. ...|..|+++++  +++.|+ |+..+ ....|..|+. .|...+++.|..|+..+..          ..
T Consensus       455 ~C~~Cgk~f~-~s~LekH~~~~H--kpv~Cp-Cg~~~-~R~~L~~H~~-thCp~Kpi~C~fC~~~v~~g~~~~d~~d~~s  528 (567)
T PLN03086        455 HCEKCGQAFQ-QGEMEKHMKVFH--EPLQCP-CGVVL-EKEQMVQHQA-STCPLRLITCRFCGDMVQAGGSAMDVRDRLR  528 (567)
T ss_pred             cCCCCCCccc-hHHHHHHHHhcC--CCccCC-CCCCc-chhHHHhhhh-ccCCCCceeCCCCCCccccCccccchhhhhh
Confidence            4899999985 678999999986  889999 99765 6689999987 6888999999999998852          34


Q ss_pred             HHHHHHhhhcCCCCccCccchhhcCCHHHHHHHHHH
Q psy12258         71 SLVVHRRIHTGERNYQCEFCHKAFRASSYLQNHRRI  106 (171)
Q Consensus        71 ~l~~h~~~~~~~~~~~C~~C~~~~~~~~~l~~H~~~  106 (171)
                      .|..|.... +.+++.|..||+.+... .|..|+..
T Consensus       529 ~Lt~HE~~C-G~rt~~C~~Cgk~Vrlr-dm~~H~~~  562 (567)
T PLN03086        529 GMSEHESIC-GSRTAPCDSCGRSVMLK-EMDIHQIA  562 (567)
T ss_pred             hHHHHHHhc-CCcceEccccCCeeeeh-hHHHHHHH
Confidence            788888875 88999999999888665 56667654


No 16 
>PHA02768 hypothetical protein; Provisional
Probab=98.92  E-value=7e-10  Score=57.96  Aligned_cols=39  Identities=21%  Similarity=0.507  Sum_probs=18.7

Q ss_pred             eeCCccchhccCcccHHHhhhhcCCCCCcccccchhhhccCh
Q psy12258         28 YGCEVCGRHFRQWGDLKYHKASLHSDVKAFQCEYCGKDFARK   69 (171)
Q Consensus        28 ~~C~~C~~~f~~~~~l~~H~~~~h~~~~~~~C~~C~~~~~~~   69 (171)
                      |.|+.||+.|....+|..|++. |.  ++++|..|++.|...
T Consensus         6 y~C~~CGK~Fs~~~~L~~H~r~-H~--k~~kc~~C~k~f~~~   44 (55)
T PHA02768          6 YECPICGEIYIKRKSMITHLRK-HN--TNLKLSNCKRISLRT   44 (55)
T ss_pred             cCcchhCCeeccHHHHHHHHHh-cC--CcccCCcccceeccc
Confidence            4455555555555555555542 33  344555555544433


No 17 
>KOG3993|consensus
Probab=98.85  E-value=4.1e-10  Score=81.46  Aligned_cols=49  Identities=22%  Similarity=0.446  Sum_probs=30.5

Q ss_pred             CCCccccccCChhhHHHHHHHcCCCCCeeCCccchhccCcccHHHhhhh
Q psy12258          1 MCDTCGKSFFSSTALKVHNRVHLGLKPYGCEVCGRHFRQWGDLKYHKAS   49 (171)
Q Consensus         1 ~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~   49 (171)
                      +|..|...|.+...|.+|.-.-.--.-|.|+.|+++|+-..+|..|+++
T Consensus       269 iCqLCK~kYeD~F~LAQHrC~RIV~vEYrCPEC~KVFsCPANLASHRRW  317 (500)
T KOG3993|consen  269 ICQLCKEKYEDAFALAQHRCPRIVHVEYRCPECDKVFSCPANLASHRRW  317 (500)
T ss_pred             HHHHHHHhhhhHHHHhhccCCeeEEeeecCCcccccccCchhhhhhhcc
Confidence            3566666666666666664433333346677777777777777777665


No 18 
>PF13465 zf-H2C2_2:  Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A ....
Probab=98.80  E-value=3.1e-09  Score=47.57  Aligned_cols=25  Identities=56%  Similarity=1.003  Sum_probs=19.5

Q ss_pred             HHHHHHHHhcCCCCccCcccccccC
Q psy12258         99 YLQNHRRIHTGEKPHFCPVCNKMFR  123 (171)
Q Consensus        99 ~l~~H~~~h~~~~~~~C~~C~~~f~  123 (171)
                      +|.+|+++|++++||.|+.|++.|.
T Consensus         1 ~l~~H~~~H~~~k~~~C~~C~k~F~   25 (26)
T PF13465_consen    1 NLRRHMRTHTGEKPYKCPYCGKSFS   25 (26)
T ss_dssp             HHHHHHHHHSSSSSEEESSSSEEES
T ss_pred             CHHHHhhhcCCCCCCCCCCCcCeeC
Confidence            4677888888888888888888775


No 19 
>PF13465 zf-H2C2_2:  Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A ....
Probab=98.78  E-value=4.4e-09  Score=47.08  Aligned_cols=25  Identities=48%  Similarity=1.015  Sum_probs=22.1

Q ss_pred             hHHHHHHHcCCCCCeeCCccchhcc
Q psy12258         14 ALKVHNRVHLGLKPYGCEVCGRHFR   38 (171)
Q Consensus        14 ~l~~H~~~h~~~~~~~C~~C~~~f~   38 (171)
                      +|..|+++|.+++||.|++|++.|.
T Consensus         1 ~l~~H~~~H~~~k~~~C~~C~k~F~   25 (26)
T PF13465_consen    1 NLRRHMRTHTGEKPYKCPYCGKSFS   25 (26)
T ss_dssp             HHHHHHHHHSSSSSEEESSSSEEES
T ss_pred             CHHHHhhhcCCCCCCCCCCCcCeeC
Confidence            4788999999999999999999885


No 20 
>KOG3993|consensus
Probab=98.69  E-value=2.7e-09  Score=77.32  Aligned_cols=110  Identities=23%  Similarity=0.384  Sum_probs=71.9

Q ss_pred             eeCCccchhccCcccHHHhhhhcCCCCCcccccchhhhccChHHHHHHHhhhcCCCCcc---CccchhhcCCHHHHHHHH
Q psy12258         28 YGCEVCGRHFRQWGDLKYHKASLHSDVKAFQCEYCGKDFARKYSLVVHRRIHTGERNYQ---CEFCHKAFRASSYLQNHR  104 (171)
Q Consensus        28 ~~C~~C~~~f~~~~~l~~H~~~~h~~~~~~~C~~C~~~~~~~~~l~~h~~~~~~~~~~~---C~~C~~~~~~~~~l~~H~  104 (171)
                      |.|+.|...|.+...|.+|.. .......|+|+.|++.|+-..+|..|++.|....--.   -+.=.+........+.-.
T Consensus       268 yiCqLCK~kYeD~F~LAQHrC-~RIV~vEYrCPEC~KVFsCPANLASHRRWHKPR~eaa~a~~~P~k~~~~~rae~~ea~  346 (500)
T KOG3993|consen  268 YICQLCKEKYEDAFALAQHRC-PRIVHVEYRCPECDKVFSCPANLASHRRWHKPRPEAAKAGSPPPKQAVETRAEVQEAE  346 (500)
T ss_pred             HHHHHHHHhhhhHHHHhhccC-CeeEEeeecCCcccccccCchhhhhhhcccCCchhhhhcCCCChhhhhhhhhhhhhcc
Confidence            899999999999999999976 4666677999999999999999999999884322100   000000000000000000


Q ss_pred             H--HhcCCCCccCcccccccCCchhHHHHHHHhccC
Q psy12258        105 R--IHTGEKPHFCPVCNKMFRVRSDMKRHLNTHNVD  138 (171)
Q Consensus       105 ~--~h~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~  138 (171)
                      +  ....+..|.|..|++.|.....|++|+-.|+..
T Consensus       347 rsg~dss~gi~~C~~C~KkFrRqAYLrKHqlthq~~  382 (500)
T KOG3993|consen  347 RSGDDSSSGIFSCHTCGKKFRRQAYLRKHQLTHQRA  382 (500)
T ss_pred             ccCCcccCceeecHHhhhhhHHHHHHHHhHHhhhcc
Confidence            0  012244688888888888888888887766543


No 21 
>PHA00616 hypothetical protein
Probab=98.57  E-value=4.8e-08  Score=48.64  Aligned_cols=33  Identities=21%  Similarity=0.242  Sum_probs=18.3

Q ss_pred             CccCccchhhcCCHHHHHHHHHHhcCCCCccCc
Q psy12258         84 NYQCEFCHKAFRASSYLQNHRRIHTGEKPHFCP  116 (171)
Q Consensus        84 ~~~C~~C~~~~~~~~~l~~H~~~h~~~~~~~C~  116 (171)
                      ||+|+.||+.|.....|..|++.|++++++.|+
T Consensus         1 pYqC~~CG~~F~~~s~l~~H~r~~hg~~~~~~~   33 (44)
T PHA00616          1 MYQCLRCGGIFRKKKEVIEHLLSVHKQNKLTLE   33 (44)
T ss_pred             CCccchhhHHHhhHHHHHHHHHHhcCCCcccee
Confidence            355555555555555555555555555555543


No 22 
>PHA00616 hypothetical protein
Probab=98.52  E-value=4.9e-08  Score=48.61  Aligned_cols=30  Identities=20%  Similarity=0.406  Sum_probs=27.7

Q ss_pred             CccCcccccccCCchhHHHHHHHhccCccc
Q psy12258        112 PHFCPVCNKMFRVRSDMKRHLNTHNVDARQ  141 (171)
Q Consensus       112 ~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~  141 (171)
                      ||.|+.||+.|..+++|.+|++.||+....
T Consensus         1 pYqC~~CG~~F~~~s~l~~H~r~~hg~~~~   30 (44)
T PHA00616          1 MYQCLRCGGIFRKKKEVIEHLLSVHKQNKL   30 (44)
T ss_pred             CCccchhhHHHhhHHHHHHHHHHhcCCCcc
Confidence            689999999999999999999999988654


No 23 
>PHA00732 hypothetical protein
Probab=98.49  E-value=9e-08  Score=54.70  Aligned_cols=43  Identities=35%  Similarity=0.718  Sum_probs=20.8

Q ss_pred             ccCccchhhcCCHHHHHHHHHH-hcCCCCccCcccccccCCchhHHHHHH
Q psy12258         85 YQCEFCHKAFRASSYLQNHRRI-HTGEKPHFCPVCNKMFRVRSDMKRHLN  133 (171)
Q Consensus        85 ~~C~~C~~~~~~~~~l~~H~~~-h~~~~~~~C~~C~~~f~~~~~l~~H~~  133 (171)
                      |.|..|++.|.+...|..|++. |.   ++.|+.||+.|.   .|..|++
T Consensus         2 y~C~~Cgk~F~s~s~Lk~H~r~~H~---~~~C~~CgKsF~---~l~~H~~   45 (79)
T PHA00732          2 FKCPICGFTTVTLFALKQHARRNHT---LTKCPVCNKSYR---RLNQHFY   45 (79)
T ss_pred             ccCCCCCCccCCHHHHHHHhhcccC---CCccCCCCCEeC---Chhhhhc
Confidence            4455555555555555555542 32   134555555554   3444443


No 24 
>PF05605 zf-Di19:  Drought induced 19 protein (Di19), zinc-binding;  InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins. Di19 has been found to be strongly expressed in both the roots and leaves of Arabidopsis thaliana during progressive drought [], whilst RING finger proteins are thought to play a role in spermatogenesis. The precise function is unknown.
Probab=98.47  E-value=3.4e-07  Score=48.63  Aligned_cols=50  Identities=28%  Similarity=0.606  Sum_probs=34.0

Q ss_pred             CccCccchhhcCCHHHHHHHHHHhcC--CCCccCcccccccCCchhHHHHHHHhc
Q psy12258         84 NYQCEFCHKAFRASSYLQNHRRIHTG--EKPHFCPVCNKMFRVRSDMKRHLNTHN  136 (171)
Q Consensus        84 ~~~C~~C~~~~~~~~~l~~H~~~h~~--~~~~~C~~C~~~f~~~~~l~~H~~~h~  136 (171)
                      .|.||.|++ ..+...|..|+...+.  .+.+.||+|...+.  .+|.+|+..+|
T Consensus         2 ~f~CP~C~~-~~~~~~L~~H~~~~H~~~~~~v~CPiC~~~~~--~~l~~Hl~~~H   53 (54)
T PF05605_consen    2 SFTCPYCGK-GFSESSLVEHCEDEHRSESKNVVCPICSSRVT--DNLIRHLNSQH   53 (54)
T ss_pred             CcCCCCCCC-ccCHHHHHHHHHhHCcCCCCCccCCCchhhhh--hHHHHHHHHhc
Confidence            367888888 4556677788766433  24578888887544  47888887765


No 25 
>PF00096 zf-C2H2:  Zinc finger, C2H2 type;  InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger: #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C], where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter []. This entry represents the classical C2H2 zinc finger domain.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0005622 intracellular; PDB: 2D9H_A 2EPC_A 1SP1_A 1VA3_A 2WBT_B 2ELR_A 2YTP_A 2YTT_A 1VA1_A 2ELO_A ....
Probab=98.31  E-value=3.3e-07  Score=39.73  Aligned_cols=23  Identities=43%  Similarity=0.998  Sum_probs=18.3

Q ss_pred             ccCcccccccCCchhHHHHHHHh
Q psy12258        113 HFCPVCNKMFRVRSDMKRHLNTH  135 (171)
Q Consensus       113 ~~C~~C~~~f~~~~~l~~H~~~h  135 (171)
                      |.|+.|++.|.+...|.+|++.|
T Consensus         1 y~C~~C~~~f~~~~~l~~H~~~H   23 (23)
T PF00096_consen    1 YKCPICGKSFSSKSNLKRHMRRH   23 (23)
T ss_dssp             EEETTTTEEESSHHHHHHHHHHH
T ss_pred             CCCCCCCCccCCHHHHHHHHhHC
Confidence            57888888888888888888764


No 26 
>PF05605 zf-Di19:  Drought induced 19 protein (Di19), zinc-binding;  InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins. Di19 has been found to be strongly expressed in both the roots and leaves of Arabidopsis thaliana during progressive drought [], whilst RING finger proteins are thought to play a role in spermatogenesis. The precise function is unknown.
Probab=98.23  E-value=1.5e-06  Score=46.09  Aligned_cols=36  Identities=25%  Similarity=0.516  Sum_probs=16.4

Q ss_pred             eeCCccchhccCcccHHHhhhhcCCCC-Ccccccchhh
Q psy12258         28 YGCEVCGRHFRQWGDLKYHKASLHSDV-KAFQCEYCGK   64 (171)
Q Consensus        28 ~~C~~C~~~f~~~~~l~~H~~~~h~~~-~~~~C~~C~~   64 (171)
                      |.|++|++. .+...|..|....|..+ +.+.|++|..
T Consensus         3 f~CP~C~~~-~~~~~L~~H~~~~H~~~~~~v~CPiC~~   39 (54)
T PF05605_consen    3 FTCPYCGKG-FSESSLVEHCEDEHRSESKNVVCPICSS   39 (54)
T ss_pred             cCCCCCCCc-cCHHHHHHHHHhHCcCCCCCccCCCchh
Confidence            455555552 23344555554444432 2344555544


No 27 
>PF13894 zf-C2H2_4:  C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A ....
Probab=98.17  E-value=1.1e-06  Score=38.25  Aligned_cols=24  Identities=42%  Similarity=1.072  Sum_probs=17.5

Q ss_pred             ccCcccccccCCchhHHHHHHHhc
Q psy12258        113 HFCPVCNKMFRVRSDMKRHLNTHN  136 (171)
Q Consensus       113 ~~C~~C~~~f~~~~~l~~H~~~h~  136 (171)
                      |.|++|++.|.+...|..|++.||
T Consensus         1 ~~C~~C~~~~~~~~~l~~H~~~~H   24 (24)
T PF13894_consen    1 FQCPICGKSFRSKSELRQHMRTHH   24 (24)
T ss_dssp             EE-SSTS-EESSHHHHHHHHHHHS
T ss_pred             CCCcCCCCcCCcHHHHHHHHHhhC
Confidence            578888888888888888887765


No 28 
>PHA00732 hypothetical protein
Probab=98.15  E-value=1e-06  Score=50.39  Aligned_cols=17  Identities=35%  Similarity=0.585  Sum_probs=6.2

Q ss_pred             CCccchhccCcccHHHh
Q psy12258         30 CEVCGRHFRQWGDLKYH   46 (171)
Q Consensus        30 C~~C~~~f~~~~~l~~H   46 (171)
                      |+.|++.|.+...|..|
T Consensus         4 C~~Cgk~F~s~s~Lk~H   20 (79)
T PHA00732          4 CPICGFTTVTLFALKQH   20 (79)
T ss_pred             CCCCCCccCCHHHHHHH
Confidence            33333333333333333


No 29 
>PF13912 zf-C2H2_6:  C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B.
Probab=98.02  E-value=2e-06  Score=38.79  Aligned_cols=26  Identities=31%  Similarity=0.607  Sum_probs=21.2

Q ss_pred             CccCcccccccCCchhHHHHHHHhcc
Q psy12258        112 PHFCPVCNKMFRVRSDMKRHLNTHNV  137 (171)
Q Consensus       112 ~~~C~~C~~~f~~~~~l~~H~~~h~~  137 (171)
                      ||.|..|++.|.+...|..|++.|+.
T Consensus         1 ~~~C~~C~~~F~~~~~l~~H~~~h~~   26 (27)
T PF13912_consen    1 PFECDECGKTFSSLSALREHKRSHCS   26 (27)
T ss_dssp             SEEETTTTEEESSHHHHHHHHCTTTT
T ss_pred             CCCCCccCCccCChhHHHHHhHHhcC
Confidence            57888888888888888888877753


No 30 
>PF12756 zf-C2H2_2:  C2H2 type zinc-finger (2 copies); PDB: 2DMI_A.
Probab=97.93  E-value=5.1e-06  Score=49.86  Aligned_cols=24  Identities=38%  Similarity=0.891  Sum_probs=15.9

Q ss_pred             CccCcccccccCCchhHHHHHHHh
Q psy12258        112 PHFCPVCNKMFRVRSDMKRHLNTH  135 (171)
Q Consensus       112 ~~~C~~C~~~f~~~~~l~~H~~~h  135 (171)
                      .+.|..|++.|.+...|..|++.+
T Consensus        50 ~~~C~~C~~~f~s~~~l~~Hm~~~   73 (100)
T PF12756_consen   50 SFRCPYCNKTFRSREALQEHMRSK   73 (100)
T ss_dssp             SEEBSSSS-EESSHHHHHHHHHHT
T ss_pred             CCCCCccCCCCcCHHHHHHHHcCc
Confidence            467777777777777777777653


No 31 
>PF12756 zf-C2H2_2:  C2H2 type zinc-finger (2 copies); PDB: 2DMI_A.
Probab=97.89  E-value=8.6e-06  Score=48.87  Aligned_cols=24  Identities=38%  Similarity=0.917  Sum_probs=14.4

Q ss_pred             CccCccchhhcCCHHHHHHHHHHh
Q psy12258         84 NYQCEFCHKAFRASSYLQNHRRIH  107 (171)
Q Consensus        84 ~~~C~~C~~~~~~~~~l~~H~~~h  107 (171)
                      .+.|..|+..|.+...|..|++.+
T Consensus        50 ~~~C~~C~~~f~s~~~l~~Hm~~~   73 (100)
T PF12756_consen   50 SFRCPYCNKTFRSREALQEHMRSK   73 (100)
T ss_dssp             SEEBSSSS-EESSHHHHHHHHHHT
T ss_pred             CCCCCccCCCCcCHHHHHHHHcCc
Confidence            456666666666666666666653


No 32 
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning]
Probab=97.88  E-value=3.5e-06  Score=59.48  Aligned_cols=53  Identities=26%  Similarity=0.590  Sum_probs=44.0

Q ss_pred             CCCCccCcc--chhhcCCHHHHHHHHHHhc-------------------CCCCccCcccccccCCchhHHHHHH
Q psy12258         81 GERNYQCEF--CHKAFRASSYLQNHRRIHT-------------------GEKPHFCPVCNKMFRVRSDMKRHLN  133 (171)
Q Consensus        81 ~~~~~~C~~--C~~~~~~~~~l~~H~~~h~-------------------~~~~~~C~~C~~~f~~~~~l~~H~~  133 (171)
                      +++||+|++  |.+.|+..-.|..|+..-+                   ..+||+|++|+|.++....|.-|..
T Consensus       346 d~KpykCpV~gC~K~YknqnGLKYH~lhGH~~~~~~~~p~p~~~~~F~~~~KPYrCevC~KRYKNlNGLKYHr~  419 (423)
T COG5189         346 DGKPYKCPVEGCNKKYKNQNGLKYHMLHGHQNQKLHENPSPEKMNIFSAKDKPYRCEVCDKRYKNLNGLKYHRK  419 (423)
T ss_pred             cCceecCCCCCchhhhccccchhhhhhccccCcccCCCCCccccccccccCCceeccccchhhccCccceeccc
Confidence            358999987  9999999999999976422                   2479999999999999999988753


No 33 
>PF00096 zf-C2H2:  Zinc finger, C2H2 type;  InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger: #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C], where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter []. This entry represents the classical C2H2 zinc finger domain.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0005622 intracellular; PDB: 2D9H_A 2EPC_A 1SP1_A 1VA3_A 2WBT_B 2ELR_A 2YTP_A 2YTT_A 1VA1_A 2ELO_A ....
Probab=97.84  E-value=8.2e-06  Score=35.18  Aligned_cols=22  Identities=41%  Similarity=0.862  Sum_probs=13.3

Q ss_pred             ccCccchhhcCCHHHHHHHHHH
Q psy12258         85 YQCEFCHKAFRASSYLQNHRRI  106 (171)
Q Consensus        85 ~~C~~C~~~~~~~~~l~~H~~~  106 (171)
                      |.|+.|++.|.....|..|++.
T Consensus         1 y~C~~C~~~f~~~~~l~~H~~~   22 (23)
T PF00096_consen    1 YKCPICGKSFSSKSNLKRHMRR   22 (23)
T ss_dssp             EEETTTTEEESSHHHHHHHHHH
T ss_pred             CCCCCCCCccCCHHHHHHHHhH
Confidence            3566666666666666666554


No 34 
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning]
Probab=97.61  E-value=1.7e-05  Score=56.10  Aligned_cols=71  Identities=30%  Similarity=0.599  Sum_probs=48.4

Q ss_pred             CCCeeCCc--cchhccCcccHHHhhhhcCCCCCcccccchhhhccChHHHHHHHhhhcCCCCccCccchhhcCCHHHHHH
Q psy12258         25 LKPYGCEV--CGRHFRQWGDLKYHKASLHSDVKAFQCEYCGKDFARKYSLVVHRRIHTGERNYQCEFCHKAFRASSYLQN  102 (171)
Q Consensus        25 ~~~~~C~~--C~~~f~~~~~l~~H~~~~h~~~~~~~C~~C~~~~~~~~~l~~h~~~~~~~~~~~C~~C~~~~~~~~~l~~  102 (171)
                      ++||+|++  |.+.+.+...|+.|+..-|-..+...-+          ....+.......|||+|.+|++.|+....|..
T Consensus       347 ~KpykCpV~gC~K~YknqnGLKYH~lhGH~~~~~~~~p----------~p~~~~~F~~~~KPYrCevC~KRYKNlNGLKY  416 (423)
T COG5189         347 GKPYKCPVEGCNKKYKNQNGLKYHMLHGHQNQKLHENP----------SPEKMNIFSAKDKPYRCEVCDKRYKNLNGLKY  416 (423)
T ss_pred             CceecCCCCCchhhhccccchhhhhhccccCcccCCCC----------CccccccccccCCceeccccchhhccCcccee
Confidence            58999987  9999999999999986433211111000          11122233445689999999999999988888


Q ss_pred             HHH
Q psy12258        103 HRR  105 (171)
Q Consensus       103 H~~  105 (171)
                      |..
T Consensus       417 Hr~  419 (423)
T COG5189         417 HRK  419 (423)
T ss_pred             ccc
Confidence            753


No 35 
>PF13894 zf-C2H2_4:  C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A ....
Probab=97.60  E-value=4.1e-05  Score=33.09  Aligned_cols=23  Identities=48%  Similarity=0.973  Sum_probs=12.2

Q ss_pred             ccCccchhhcCCHHHHHHHHHHh
Q psy12258         85 YQCEFCHKAFRASSYLQNHRRIH  107 (171)
Q Consensus        85 ~~C~~C~~~~~~~~~l~~H~~~h  107 (171)
                      |.|+.|+..|.+...|..|+..+
T Consensus         1 ~~C~~C~~~~~~~~~l~~H~~~~   23 (24)
T PF13894_consen    1 FQCPICGKSFRSKSELRQHMRTH   23 (24)
T ss_dssp             EE-SSTS-EESSHHHHHHHHHHH
T ss_pred             CCCcCCCCcCCcHHHHHHHHHhh
Confidence            34566666666666666665544


No 36 
>smart00355 ZnF_C2H2 zinc finger.
Probab=97.53  E-value=8.3e-05  Score=32.66  Aligned_cols=24  Identities=42%  Similarity=0.909  Sum_probs=16.4

Q ss_pred             ccCcccccccCCchhHHHHHHHhc
Q psy12258        113 HFCPVCNKMFRVRSDMKRHLNTHN  136 (171)
Q Consensus       113 ~~C~~C~~~f~~~~~l~~H~~~h~  136 (171)
                      |.|+.|++.|.....|..|++.|.
T Consensus         1 ~~C~~C~~~f~~~~~l~~H~~~H~   24 (26)
T smart00355        1 YRCPECGKVFKSKSALKEHMRTHX   24 (26)
T ss_pred             CCCCCCcchhCCHHHHHHHHHHhc
Confidence            467777777777777777776543


No 37 
>PF13912 zf-C2H2_6:  C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B.
Probab=97.44  E-value=4.8e-05  Score=34.09  Aligned_cols=21  Identities=33%  Similarity=0.890  Sum_probs=12.0

Q ss_pred             eeCCccchhccCcccHHHhhh
Q psy12258         28 YGCEVCGRHFRQWGDLKYHKA   48 (171)
Q Consensus        28 ~~C~~C~~~f~~~~~l~~H~~   48 (171)
                      |.|..|++.|.+...|..|++
T Consensus         2 ~~C~~C~~~F~~~~~l~~H~~   22 (27)
T PF13912_consen    2 FECDECGKTFSSLSALREHKR   22 (27)
T ss_dssp             EEETTTTEEESSHHHHHHHHC
T ss_pred             CCCCccCCccCChhHHHHHhH
Confidence            455555555555555555554


No 38 
>PF13909 zf-H2C2_5:  C2H2-type zinc-finger domain; PDB: 1X5W_A.
Probab=97.44  E-value=8.2e-05  Score=32.34  Aligned_cols=23  Identities=39%  Similarity=0.778  Sum_probs=16.1

Q ss_pred             ccCcccccccCCchhHHHHHHHhc
Q psy12258        113 HFCPVCNKMFRVRSDMKRHLNTHN  136 (171)
Q Consensus       113 ~~C~~C~~~f~~~~~l~~H~~~h~  136 (171)
                      |+|+.|+.... ...|.+|++.+|
T Consensus         1 y~C~~C~y~t~-~~~l~~H~~~~H   23 (24)
T PF13909_consen    1 YKCPHCSYSTS-KSNLKRHLKRHH   23 (24)
T ss_dssp             EE-SSSS-EES-HHHHHHHHHHHH
T ss_pred             CCCCCCCCcCC-HHHHHHHHHhhC
Confidence            57888887777 778888887765


No 39 
>KOG1146|consensus
Probab=97.43  E-value=0.0001  Score=61.29  Aligned_cols=102  Identities=22%  Similarity=0.306  Sum_probs=68.9

Q ss_pred             CCccchhccCcccHHHhhhhcCCCCCcccccchhhhccChHHHHHHHhhhcCCCCccCccchhhcCCHHHHHHHHHHhcC
Q psy12258         30 CEVCGRHFRQWGDLKYHKASLHSDVKAFQCEYCGKDFARKYSLVVHRRIHTGERNYQCEFCHKAFRASSYLQNHRRIHTG  109 (171)
Q Consensus        30 C~~C~~~f~~~~~l~~H~~~~h~~~~~~~C~~C~~~~~~~~~l~~h~~~~~~~~~~~C~~C~~~~~~~~~l~~H~~~h~~  109 (171)
                      |.-|+..+.+...+..|+...+...+.++|+.|++.+.....|..||+..+.+-.-  .+|. .+.....+.+-.....+
T Consensus       439 ~~~~e~~~~s~r~~~~~t~~L~S~~kt~~cpkc~~~yk~a~~L~vhmRskhp~~~~--~~c~-~gq~~~~~arg~~~~~~  515 (1406)
T KOG1146|consen  439 LTKAEPLLESKRSLEGQTVVLHSFFKTLKCPKCNWHYKLAQTLGVHMRSKHPESQS--AYCK-AGQNHPRLARGEVYRCP  515 (1406)
T ss_pred             ccchhhhhhhhcccccceeeeecccccccCCccchhhhhHHHhhhcccccccccch--hHhH-hccccccccccccccCC
Confidence            44556666666666666666777778899999999999999999999875433221  3332 22222222222222345


Q ss_pred             CCCccCcccccccCCchhHHHHHHH
Q psy12258        110 EKPHFCPVCNKMFRVRSDMKRHLNT  134 (171)
Q Consensus       110 ~~~~~C~~C~~~f~~~~~l~~H~~~  134 (171)
                      .++|.|..|..++.....|.+|+..
T Consensus       516 ~~p~~C~~C~~stttng~LsihlqS  540 (1406)
T KOG1146|consen  516 GKPYPCRACNYSTTTNGNLSIHLQS  540 (1406)
T ss_pred             CCcccceeeeeeeecchHHHHHHHH
Confidence            6789999999999999999999864


No 40 
>PF09237 GAGA:  GAGA factor;  InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  Members of this entry bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 1YUI_A 1YUJ_A.
Probab=97.13  E-value=0.00016  Score=36.92  Aligned_cols=30  Identities=30%  Similarity=0.825  Sum_probs=16.4

Q ss_pred             CCCCccCcccccccCCchhHHHHHHHhccC
Q psy12258        109 GEKPHFCPVCNKMFRVRSDMKRHLNTHNVD  138 (171)
Q Consensus       109 ~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~  138 (171)
                      .+.|..|++|+..+.+.-+|++|+.+.|..
T Consensus        21 S~~PatCP~C~a~~~~srnLrRHle~~H~~   50 (54)
T PF09237_consen   21 SEQPATCPICGAVIRQSRNLRRHLEIRHFK   50 (54)
T ss_dssp             TS--EE-TTT--EESSHHHHHHHHHHHTTT
T ss_pred             cCCCCCCCcchhhccchhhHHHHHHHHhcc
Confidence            355666777777777777777777666543


No 41 
>PF12874 zf-met:  Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A.
Probab=97.13  E-value=0.0002  Score=31.38  Aligned_cols=23  Identities=30%  Similarity=0.912  Sum_probs=17.5

Q ss_pred             ccCcccccccCCchhHHHHHHHh
Q psy12258        113 HFCPVCNKMFRVRSDMKRHLNTH  135 (171)
Q Consensus       113 ~~C~~C~~~f~~~~~l~~H~~~h  135 (171)
                      |.|.+|++.|.+...|..|++.+
T Consensus         1 ~~C~~C~~~f~s~~~~~~H~~s~   23 (25)
T PF12874_consen    1 FYCDICNKSFSSENSLRQHLRSK   23 (25)
T ss_dssp             EEETTTTEEESSHHHHHHHHTTH
T ss_pred             CCCCCCCCCcCCHHHHHHHHCcC
Confidence            56788888888888888887643


No 42 
>PF09237 GAGA:  GAGA factor;  InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  Members of this entry bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 1YUI_A 1YUJ_A.
Probab=97.00  E-value=0.0009  Score=34.26  Aligned_cols=20  Identities=25%  Similarity=0.507  Sum_probs=6.4

Q ss_pred             cccchhhhccChHHHHHHHh
Q psy12258         58 QCEYCGKDFARKYSLVVHRR   77 (171)
Q Consensus        58 ~C~~C~~~~~~~~~l~~h~~   77 (171)
                      .|++|+..+....+|.+|+.
T Consensus        26 tCP~C~a~~~~srnLrRHle   45 (54)
T PF09237_consen   26 TCPICGAVIRQSRNLRRHLE   45 (54)
T ss_dssp             E-TTT--EESSHHHHHHHHH
T ss_pred             CCCcchhhccchhhHHHHHH
Confidence            33333333333333333333


No 43 
>smart00355 ZnF_C2H2 zinc finger.
Probab=96.97  E-value=0.00086  Score=29.20  Aligned_cols=23  Identities=43%  Similarity=0.891  Sum_probs=15.7

Q ss_pred             ccCccchhhcCCHHHHHHHHHHh
Q psy12258         85 YQCEFCHKAFRASSYLQNHRRIH  107 (171)
Q Consensus        85 ~~C~~C~~~~~~~~~l~~H~~~h  107 (171)
                      |.|..|++.|.....|..|+..|
T Consensus         1 ~~C~~C~~~f~~~~~l~~H~~~H   23 (26)
T smart00355        1 YRCPECGKVFKSKSALKEHMRTH   23 (26)
T ss_pred             CCCCCCcchhCCHHHHHHHHHHh
Confidence            45677777777777777776654


No 44 
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only]
Probab=96.96  E-value=0.0042  Score=44.95  Aligned_cols=125  Identities=23%  Similarity=0.417  Sum_probs=79.6

Q ss_pred             cccccCChhhHHHHHHHcCCCCCeeCCccch---hccC------cccHHHhhhhcCCCCCc----ccccchhhhccChHH
Q psy12258          5 CGKSFFSSTALKVHNRVHLGLKPYGCEVCGR---HFRQ------WGDLKYHKASLHSDVKA----FQCEYCGKDFARKYS   71 (171)
Q Consensus         5 C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~---~f~~------~~~l~~H~~~~h~~~~~----~~C~~C~~~~~~~~~   71 (171)
                      |..+...-..|..|.++.++.  +.|.+|-.   .|..      ...|..|... ...+..    -.|..|...|-+...
T Consensus       159 c~~~C~~~k~lk~H~K~~H~~--~~C~~C~~nKk~F~~E~~lF~~~~Lr~H~~~-G~~e~GFKGHP~C~FC~~~FYdDDE  235 (493)
T COG5236         159 CHRRCGSLKELKKHYKAQHGF--VLCSECIGNKKDFWNEIRLFRSSTLRDHKNG-GLEEEGFKGHPLCIFCKIYFYDDDE  235 (493)
T ss_pred             hhhhhhhHHHHHHHHHhhcCc--EEhHhhhcCcccCccceeeeecccccccccC-CccccCcCCCchhhhccceecChHH
Confidence            445555567788888876543  56777633   3332      3445555442 111112    259999999999999


Q ss_pred             HHHHHhhhcCCCCccCccchhh-------cCCHHHHHHHHHHhcCCCCccCcc--cc----cccCCchhHHHHHHHhccC
Q psy12258         72 LVVHRRIHTGERNYQCEFCHKA-------FRASSYLQNHRRIHTGEKPHFCPV--CN----KMFRVRSDMKRHLNTHNVD  138 (171)
Q Consensus        72 l~~h~~~~~~~~~~~C~~C~~~-------~~~~~~l~~H~~~h~~~~~~~C~~--C~----~~f~~~~~l~~H~~~h~~~  138 (171)
                      |..|++..+.    +|.+|+++       |.+..+|..|...    .-|.|.+  |.    ..|.+...|..|+-..|+.
T Consensus       236 L~~HcR~~HE----~ChICD~v~p~~~QYFK~Y~~Le~HF~~----~hy~ct~qtc~~~k~~vf~~~~el~~h~~~~h~~  307 (493)
T COG5236         236 LRRHCRLRHE----ACHICDMVGPIRYQYFKSYEDLEAHFRN----AHYCCTFQTCRVGKCYVFPYHTELLEHLTRFHKV  307 (493)
T ss_pred             HHHHHHhhhh----hhhhhhccCccchhhhhCHHHHHHHhhc----CceEEEEEEEecCcEEEeccHHHHHHHHHHHhhc
Confidence            9999987653    56666653       6777778777653    3356643  22    4688889999998665544


Q ss_pred             cc
Q psy12258        139 AR  140 (171)
Q Consensus       139 ~~  140 (171)
                      ..
T Consensus       308 ~~  309 (493)
T COG5236         308 NA  309 (493)
T ss_pred             cc
Confidence            33


No 45 
>PRK04860 hypothetical protein; Provisional
Probab=96.94  E-value=0.00031  Score=45.84  Aligned_cols=40  Identities=23%  Similarity=0.580  Sum_probs=33.7

Q ss_pred             CCccCccchhhcCCHHHHHHHHHHhcCCCCccCcccccccCCch
Q psy12258         83 RNYQCEFCHKAFRASSYLQNHRRIHTGEKPHFCPVCNKMFRVRS  126 (171)
Q Consensus        83 ~~~~C~~C~~~~~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~  126 (171)
                      -+|.|. |+.   ....+.+|.+++.++++|+|..|+..|....
T Consensus       118 ~~Y~C~-C~~---~~~~~rrH~ri~~g~~~YrC~~C~~~l~~~~  157 (160)
T PRK04860        118 FPYRCK-CQE---HQLTVRRHNRVVRGEAVYRCRRCGETLVFKG  157 (160)
T ss_pred             EEEEcC-CCC---eeCHHHHHHHHhcCCccEECCCCCceeEEec
Confidence            368998 986   6778889999999999999999999887543


No 46 
>KOG2231|consensus
Probab=96.67  E-value=0.0067  Score=47.99  Aligned_cols=95  Identities=25%  Similarity=0.364  Sum_probs=61.7

Q ss_pred             cCChhhHHHHHHHcCCCCCeeCCccch---hc------cCcccHHHhhhhcCCCCC----cccccchhhhccChHHHHHH
Q psy12258          9 FFSSTALKVHNRVHLGLKPYGCEVCGR---HF------RQWGDLKYHKASLHSDVK----AFQCEYCGKDFARKYSLVVH   75 (171)
Q Consensus         9 f~~~~~l~~H~~~h~~~~~~~C~~C~~---~f------~~~~~l~~H~~~~h~~~~----~~~C~~C~~~~~~~~~l~~h   75 (171)
                      |.....|+.|+...+.  .+.|.+|-.   .|      -....|..|++.--.+++    .-.|..|...|.....|..|
T Consensus       124 ~~s~~~Lk~H~~~~H~--~~~c~lC~~~~kif~~e~k~Yt~~el~~h~~~gd~d~~s~rGhp~C~~C~~~fld~~el~rH  201 (669)
T KOG2231|consen  124 FKSVENLKNHMRDQHK--LHLCSLCLQNLKIFINERKLYTRAELNLHLMFGDPDDESCRGHPLCKFCHERFLDDDELYRH  201 (669)
T ss_pred             hhHHHHHHHHHHHhhh--hhccccccccceeeeeeeehehHHHHHHHHhcCCCccccccCCccchhhhhhhccHHHHHHh
Confidence            3367789999865443  345555432   22      234556677664222222    24689999999999999999


Q ss_pred             HhhhcCCCCccCccc------hhhcCCHHHHHHHHHHhcC
Q psy12258         76 RRIHTGERNYQCEFC------HKAFRASSYLQNHRRIHTG  109 (171)
Q Consensus        76 ~~~~~~~~~~~C~~C------~~~~~~~~~l~~H~~~h~~  109 (171)
                      ++..+    |.|..|      +..|.....|..|.+..|-
T Consensus       202 ~~~~h----~~chfC~~~~~~neyy~~~~dLe~HfR~~Hf  237 (669)
T KOG2231|consen  202 LRFDH----EFCHFCDYKTGQNEYYNDYDDLEEHFRKGHF  237 (669)
T ss_pred             hccce----eheeecCcccccchhcccchHHHHHhhhcCc
Confidence            98765    445555      4567888999999886543


No 47 
>KOG2231|consensus
Probab=96.57  E-value=0.0048  Score=48.78  Aligned_cols=99  Identities=26%  Similarity=0.567  Sum_probs=59.7

Q ss_pred             CCccchhccCcccHHHhhhhcCCCCCcccccchh---hhcc------ChHHHHHHHhhhcC-CC----CccCccchhhcC
Q psy12258         30 CEVCGRHFRQWGDLKYHKASLHSDVKAFQCEYCG---KDFA------RKYSLVVHRRIHTG-ER----NYQCEFCHKAFR   95 (171)
Q Consensus        30 C~~C~~~f~~~~~l~~H~~~~h~~~~~~~C~~C~---~~~~------~~~~l~~h~~~~~~-~~----~~~C~~C~~~~~   95 (171)
                      |..| ..|.....|..|+...|..   +.|..|-   +.|.      +...|..|+..--. ..    .-.|..|...|.
T Consensus       118 ~~~c-~~~~s~~~Lk~H~~~~H~~---~~c~lC~~~~kif~~e~k~Yt~~el~~h~~~gd~d~~s~rGhp~C~~C~~~fl  193 (669)
T KOG2231|consen  118 CLHC-TEFKSVENLKNHMRDQHKL---HLCSLCLQNLKIFINERKLYTRAELNLHLMFGDPDDESCRGHPLCKFCHERFL  193 (669)
T ss_pred             Cccc-cchhHHHHHHHHHHHhhhh---hccccccccceeeeeeeehehHHHHHHHHhcCCCccccccCCccchhhhhhhc
Confidence            4444 3444778899999877754   3333332   2222      33456666554321 11    346889999999


Q ss_pred             CHHHHHHHHHHhcCCCCccCcccc------cccCCchhHHHHHHHhc
Q psy12258         96 ASSYLQNHRRIHTGEKPHFCPVCN------KMFRVRSDMKRHLNTHN  136 (171)
Q Consensus        96 ~~~~l~~H~~~h~~~~~~~C~~C~------~~f~~~~~l~~H~~~h~  136 (171)
                      ....|.+|++.++    |.|..|.      .-|.....|..|.|.+|
T Consensus       194 d~~el~rH~~~~h----~~chfC~~~~~~neyy~~~~dLe~HfR~~H  236 (669)
T KOG2231|consen  194 DDDELYRHLRFDH----EFCHFCDYKTGQNEYYNDYDDLEEHFRKGH  236 (669)
T ss_pred             cHHHHHHhhccce----eheeecCcccccchhcccchHHHHHhhhcC
Confidence            9999999987543    3455552      33556667777776655


No 48 
>PF13909 zf-H2C2_5:  C2H2-type zinc-finger domain; PDB: 1X5W_A.
Probab=96.53  E-value=0.0016  Score=28.16  Aligned_cols=23  Identities=30%  Similarity=0.647  Sum_probs=12.1

Q ss_pred             ccCccchhhcCCHHHHHHHHHHhc
Q psy12258         85 YQCEFCHKAFRASSYLQNHRRIHT  108 (171)
Q Consensus        85 ~~C~~C~~~~~~~~~l~~H~~~h~  108 (171)
                      |+|+.|+.... ...|..|++.++
T Consensus         1 y~C~~C~y~t~-~~~l~~H~~~~H   23 (24)
T PF13909_consen    1 YKCPHCSYSTS-KSNLKRHLKRHH   23 (24)
T ss_dssp             EE-SSSS-EES-HHHHHHHHHHHH
T ss_pred             CCCCCCCCcCC-HHHHHHHHHhhC
Confidence            45666666555 556666665543


No 49 
>PF12171 zf-C2H2_jaz:  Zinc-finger double-stranded RNA-binding;  InterPro: IPR022755  This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length. The mammalian members of this group occur multiple times along the protein, joined by flexible linkers, and are referred to as JAZ - dsRNA-binding ZF protein - zinc-fingers. The JAZ proteins are expressed in all tissues tested and localise in the nucleus, particularly the nucleolus []. JAZ preferentially binds to double-stranded (ds) RNA or RNA/DNA hybrids rather than DNA. In addition to binding double-stranded RNA, these zinc-fingers are required for nucleolar localisation.   This entry represents the multiple-adjacent-C2H2 zinc finger, JAZ. ; PDB: 4DGW_A 1ZR9_A.
Probab=96.11  E-value=0.0011  Score=29.66  Aligned_cols=22  Identities=27%  Similarity=0.896  Sum_probs=15.7

Q ss_pred             ccCcccccccCCchhHHHHHHH
Q psy12258        113 HFCPVCNKMFRVRSDMKRHLNT  134 (171)
Q Consensus       113 ~~C~~C~~~f~~~~~l~~H~~~  134 (171)
                      |.|..|++.|.+...|..|++.
T Consensus         2 ~~C~~C~k~f~~~~~~~~H~~s   23 (27)
T PF12171_consen    2 FYCDACDKYFSSENQLKQHMKS   23 (27)
T ss_dssp             CBBTTTTBBBSSHHHHHCCTTS
T ss_pred             CCcccCCCCcCCHHHHHHHHcc
Confidence            5677777777777777777643


No 50 
>PF12171 zf-C2H2_jaz:  Zinc-finger double-stranded RNA-binding;  InterPro: IPR022755  This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length. The mammalian members of this group occur multiple times along the protein, joined by flexible linkers, and are referred to as JAZ - dsRNA-binding ZF protein - zinc-fingers. The JAZ proteins are expressed in all tissues tested and localise in the nucleus, particularly the nucleolus []. JAZ preferentially binds to double-stranded (ds) RNA or RNA/DNA hybrids rather than DNA. In addition to binding double-stranded RNA, these zinc-fingers are required for nucleolar localisation.   This entry represents the multiple-adjacent-C2H2 zinc finger, JAZ. ; PDB: 4DGW_A 1ZR9_A.
Probab=96.03  E-value=0.0017  Score=28.98  Aligned_cols=21  Identities=29%  Similarity=0.654  Sum_probs=13.0

Q ss_pred             eeCCccchhccCcccHHHhhh
Q psy12258         28 YGCEVCGRHFRQWGDLKYHKA   48 (171)
Q Consensus        28 ~~C~~C~~~f~~~~~l~~H~~   48 (171)
                      |.|..|++.|.+...+..|++
T Consensus         2 ~~C~~C~k~f~~~~~~~~H~~   22 (27)
T PF12171_consen    2 FYCDACDKYFSSENQLKQHMK   22 (27)
T ss_dssp             CBBTTTTBBBSSHHHHHCCTT
T ss_pred             CCcccCCCCcCCHHHHHHHHc
Confidence            456666666666666666654


No 51 
>PF13913 zf-C2HC_2:  zinc-finger of a C2HC-type
Probab=95.84  E-value=0.0072  Score=26.42  Aligned_cols=19  Identities=26%  Similarity=0.814  Sum_probs=11.1

Q ss_pred             cCcccccccCCchhHHHHHH
Q psy12258        114 FCPVCNKMFRVRSDMKRHLN  133 (171)
Q Consensus       114 ~C~~C~~~f~~~~~l~~H~~  133 (171)
                      .|+.||+.| ..+.|.+|+.
T Consensus         4 ~C~~CgR~F-~~~~l~~H~~   22 (25)
T PF13913_consen    4 PCPICGRKF-NPDRLEKHEK   22 (25)
T ss_pred             cCCCCCCEE-CHHHHHHHHH
Confidence            466666666 4555666654


No 52 
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only]
Probab=95.65  E-value=0.0059  Score=44.21  Aligned_cols=103  Identities=27%  Similarity=0.521  Sum_probs=70.9

Q ss_pred             CeeCCc--cchhccCcccHHHhhhhcCCCCCcccccchh---hhcc------ChHHHHHHHhhhcCC----CCccCccch
Q psy12258         27 PYGCEV--CGRHFRQWGDLKYHKASLHSDVKAFQCEYCG---KDFA------RKYSLVVHRRIHTGE----RNYQCEFCH   91 (171)
Q Consensus        27 ~~~C~~--C~~~f~~~~~l~~H~~~~h~~~~~~~C~~C~---~~~~------~~~~l~~h~~~~~~~----~~~~C~~C~   91 (171)
                      .|.|+.  |..+......|..|.+..|..   +.|..|-   +.|.      ....|..|...-..+    ..-.|..|.
T Consensus       151 ~F~CP~skc~~~C~~~k~lk~H~K~~H~~---~~C~~C~~nKk~F~~E~~lF~~~~Lr~H~~~G~~e~GFKGHP~C~FC~  227 (493)
T COG5236         151 SFKCPKSKCHRRCGSLKELKKHYKAQHGF---VLCSECIGNKKDFWNEIRLFRSSTLRDHKNGGLEEEGFKGHPLCIFCK  227 (493)
T ss_pred             HhcCCchhhhhhhhhHHHHHHHHHhhcCc---EEhHhhhcCcccCccceeeeecccccccccCCccccCcCCCchhhhcc
Confidence            478875  777777778899999876654   4565554   3333      234455565433222    123689999


Q ss_pred             hhcCCHHHHHHHHHHhcCCCCccCcccccc-------cCCchhHHHHHHHhc
Q psy12258         92 KAFRASSYLQNHRRIHTGEKPHFCPVCNKM-------FRVRSDMKRHLNTHN  136 (171)
Q Consensus        92 ~~~~~~~~l~~H~~~h~~~~~~~C~~C~~~-------f~~~~~l~~H~~~h~  136 (171)
                      .-|-....|..|.+..+.    +|-+|+++       |.++.+|..|.+..|
T Consensus       228 ~~FYdDDEL~~HcR~~HE----~ChICD~v~p~~~QYFK~Y~~Le~HF~~~h  275 (493)
T COG5236         228 IYFYDDDELRRHCRLRHE----ACHICDMVGPIRYQYFKSYEDLEAHFRNAH  275 (493)
T ss_pred             ceecChHHHHHHHHhhhh----hhhhhhccCccchhhhhCHHHHHHHhhcCc
Confidence            999999999999886433    67777755       778899999987544


No 53 
>PRK04860 hypothetical protein; Provisional
Probab=95.50  E-value=0.0064  Score=39.75  Aligned_cols=38  Identities=24%  Similarity=0.699  Sum_probs=31.6

Q ss_pred             cccccchhhhccChHHHHHHHhhhcCCCCccCccchhhcCCH
Q psy12258         56 AFQCEYCGKDFARKYSLVVHRRIHTGERNYQCEFCHKAFRAS   97 (171)
Q Consensus        56 ~~~C~~C~~~~~~~~~l~~h~~~~~~~~~~~C~~C~~~~~~~   97 (171)
                      +|.|. |+.   ....+..|.+.+.++++|.|..|+..|...
T Consensus       119 ~Y~C~-C~~---~~~~~rrH~ri~~g~~~YrC~~C~~~l~~~  156 (160)
T PRK04860        119 PYRCK-CQE---HQLTVRRHNRVVRGEAVYRCRRCGETLVFK  156 (160)
T ss_pred             EEEcC-CCC---eeCHHHHHHHHhcCCccEECCCCCceeEEe
Confidence            58898 887   456788999999999999999999887644


No 54 
>COG5048 FOG: Zn-finger [General function prediction only]
Probab=95.09  E-value=0.0049  Score=46.53  Aligned_cols=139  Identities=24%  Similarity=0.401  Sum_probs=80.4

Q ss_pred             CCCccccccCChhhHHHHHH--HcCCC--CCeeCC--ccchhccCcccHHHhhhhcCCCCCcccccc--hhhhccChHH-
Q psy12258          1 MCDTCGKSFFSSTALKVHNR--VHLGL--KPYGCE--VCGRHFRQWGDLKYHKASLHSDVKAFQCEY--CGKDFARKYS-   71 (171)
Q Consensus         1 ~C~~C~~~f~~~~~l~~H~~--~h~~~--~~~~C~--~C~~~f~~~~~l~~H~~~~h~~~~~~~C~~--C~~~~~~~~~-   71 (171)
                      +|..|...|.+...|..|.+  .|.++  +++.|+  .|++.|.....+..|.. .|....+..+..  +...+..... 
T Consensus       291 ~~~~~~~~~s~~~~l~~~~~~~~h~~~~~~~~~~p~~~~~~~~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~  369 (467)
T COG5048         291 KSKQCNISFSRSSPLTRHLRSVNHSGESLKPFSCPYSLCGKLFSRNDALKRHIL-LHTSISPAKEKLLNSSSKFSPLLNN  369 (467)
T ss_pred             CCccccCCccccccccccccccccccccCCceeeeccCCCccccccccccCCcc-cccCCCccccccccCccccccccCC
Confidence            35677788888888888888  78888  888888  68888888888888876 566655544433  2222111111 


Q ss_pred             ----HHHHHhhhcCCCCccCc--cchhhcCCHHHHHHHHHHhcCCC--CccCcccccccCCchhHHHHHHHhccCcc
Q psy12258         72 ----LVVHRRIHTGERNYQCE--FCHKAFRASSYLQNHRRIHTGEK--PHFCPVCNKMFRVRSDMKRHLNTHNVDAR  140 (171)
Q Consensus        72 ----l~~h~~~~~~~~~~~C~--~C~~~~~~~~~l~~H~~~h~~~~--~~~C~~C~~~f~~~~~l~~H~~~h~~~~~  140 (171)
                          ...............+.  .|...+.....+..|...+....  .+.+..|.+.+.....+..|++.|.....
T Consensus       370 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  446 (467)
T COG5048         370 EPPQSLQQYKDLKNDKKSETLSNSCIRNFKRDSNLSLHIITHLSFRPYNCKNPPCSKSFNRHYNLIPHKKIHTNHAP  446 (467)
T ss_pred             CCccchhhccCccCCccccccccchhhhhccccccccccccccccCCcCCCCCcchhhccCcccccccccccccCCc
Confidence                00000111111222222  24444444444455544444433  45677788888888888777776654443


No 55 
>COG4049 Uncharacterized protein containing archaeal-type C2H2 Zn-finger [General function prediction only]
Probab=95.03  E-value=0.0098  Score=31.00  Aligned_cols=25  Identities=24%  Similarity=0.372  Sum_probs=12.4

Q ss_pred             CCCccCccchhhcCCHHHHHHHHHH
Q psy12258         82 ERNYQCEFCHKAFRASSYLQNHRRI  106 (171)
Q Consensus        82 ~~~~~C~~C~~~~~~~~~l~~H~~~  106 (171)
                      +.-++||.|+..|...-++.+|+..
T Consensus        15 E~~lrCPRC~~~FR~~K~Y~RHVNK   39 (65)
T COG4049          15 EEFLRCPRCGMVFRRRKDYIRHVNK   39 (65)
T ss_pred             ceeeeCCchhHHHHHhHHHHHHhhH
Confidence            3344555555555555555555444


No 56 
>KOG1146|consensus
Probab=94.85  E-value=0.014  Score=49.40  Aligned_cols=104  Identities=15%  Similarity=0.271  Sum_probs=58.0

Q ss_pred             eeCCccchhccCcccHHHhhhhcC---CCCCcccccchhhhccChHHHHHHHhhhcCCCCccCccchhhcCCHHHHHHHH
Q psy12258         28 YGCEVCGRHFRQWGDLKYHKASLH---SDVKAFQCEYCGKDFARKYSLVVHRRIHTGERNYQCEFCHKAFRASSYLQNHR  104 (171)
Q Consensus        28 ~~C~~C~~~f~~~~~l~~H~~~~h---~~~~~~~C~~C~~~~~~~~~l~~h~~~~~~~~~~~C~~C~~~~~~~~~l~~H~  104 (171)
                      ..|+.|...|........+-...-   .....+.|..|++.+...-.+. ++-.   ...|.|..|...|.....|..|.
T Consensus      1229 l~~~~~e~~f~~~~~~~~~a~~~~~~~~~sGe~~c~~~~~~~~~~~~~~-~l~~---~~~~~~~~~~~~~~~~~~l~~~~ 1304 (1406)
T KOG1146|consen 1229 LLPNALEQPFPQEPEPTATAPPKPPELPASGEGECGAVDELLTPSFGIS-TLDV---THRYLCRQCKMAFDGEAPLTAHQ 1304 (1406)
T ss_pred             ccHHhhhcCccCcccccccCCCCCCcCcCCCcchhhhccccccCcccee-eccc---chhHHHHHHHhhhcchhHHHHHH
Confidence            345555666655555443322110   0112245555555555443333 2222   23455666666666666665554


Q ss_pred             HH-----------------hcCCCCccCcccccccCCchhHHHHHHHhc
Q psy12258        105 RI-----------------HTGEKPHFCPVCNKMFRVRSDMKRHLNTHN  136 (171)
Q Consensus       105 ~~-----------------h~~~~~~~C~~C~~~f~~~~~l~~H~~~h~  136 (171)
                      +.                 +....+| |..|...|.....|..|+++.+
T Consensus      1305 ~k~~~~~~~~~~~~~~~l~~~d~~~~-c~~c~~~~~~~~alqihm~~~~ 1352 (1406)
T KOG1146|consen 1305 RKFCFAGRGSGGSMPPPLRVPDCTYH-CLACEVLLSGREALQIHMRSSA 1352 (1406)
T ss_pred             HHHHhccCccccCCCCcccCcccccc-chHHHhhcchhHHHHHHHHHhh
Confidence            32                 2233456 9999999999999999998743


No 57 
>cd00350 rubredoxin_like Rubredoxin_like; nonheme iron binding domain containing a [Fe(SCys)4] center. The family includes rubredoxins, a small electron transfer protein, and a slightly smaller modular rubredoxin domain present in rubrerythrin and nigerythrin and detected either N- or C-terminal to such proteins as flavin reductase, NAD(P)H-nitrite reductase, and ferredoxin-thioredoxin reductase. In rubredoxin, the iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), but iron can also be replaced by cobalt, nickel or zinc and believed to be involved in electron transfer.  Rubrerythrins and nigerythrins are small homodimeric proteins, generally consisting of 2 domains: a rubredoxin domain C-terminal to a non-sulfur, oxo-bridged diiron site in the N-terminal rubrerythrin domain.  Rubrerythrins and nigerythrins have putative peroxide activity.
Probab=94.64  E-value=0.012  Score=27.64  Aligned_cols=10  Identities=50%  Similarity=1.348  Sum_probs=5.5

Q ss_pred             CCccCccccc
Q psy12258        111 KPHFCPVCNK  120 (171)
Q Consensus       111 ~~~~C~~C~~  120 (171)
                      .++.|++||.
T Consensus        16 ~~~~CP~Cg~   25 (33)
T cd00350          16 APWVCPVCGA   25 (33)
T ss_pred             CCCcCcCCCC
Confidence            4456666653


No 58 
>PF12013 DUF3505:  Protein of unknown function (DUF3505);  InterPro: IPR022698  This family of proteins is functionally uncharacterised. This protein is found in eukaryotes. Proteins in this family are typically between 247 to 1018 amino acids in length. This region contains two segments that are likely to be C2H2 zinc binding domains. 
Probab=94.33  E-value=0.069  Score=32.59  Aligned_cols=83  Identities=16%  Similarity=0.227  Sum_probs=47.0

Q ss_pred             CCcccccchhhhccChHHHHHHHhhhcCCC-CccCccchhhcCCHHHHHHH-HHHh---cC---------CCCccC----
Q psy12258         54 VKAFQCEYCGKDFARKYSLVVHRRIHTGER-NYQCEFCHKAFRASSYLQNH-RRIH---TG---------EKPHFC----  115 (171)
Q Consensus        54 ~~~~~C~~C~~~~~~~~~l~~h~~~~~~~~-~~~C~~C~~~~~~~~~l~~H-~~~h---~~---------~~~~~C----  115 (171)
                      .+.+.|..|...... +.+..|++..+... ...-..=...+.....+... ...-   ..         ..-|.|    
T Consensus         9 ~~vlIC~~C~~av~~-~~v~~HL~~~H~~~~~~~~~~i~~~~~~~~~l~~~~~~~~~p~~~~~Pi~gLp~~~G~~C~~~~   87 (109)
T PF12013_consen    9 YRVLICRQCQYAVQP-SEVESHLRKRHHILKSQERQRIVEAIRQWPDLLPDPDDLQIPPDPSPPIPGLPVYDGYRCQCDP   87 (109)
T ss_pred             CCEEEeCCCCcccCc-hHHHHHHHHhcccccHHHHHHHHHHHHhhhhcccCccccCCCCCCCCcCCCCCCCCCeeeecCC
Confidence            455789999988776 78889988554322 11110000011000000000 0000   00         123899    


Q ss_pred             cccccccCCchhHHHHHHHhcc
Q psy12258        116 PVCNKMFRVRSDMKRHLNTHNV  137 (171)
Q Consensus       116 ~~C~~~f~~~~~l~~H~~~h~~  137 (171)
                      ..|+..+.+...+++|++.+|+
T Consensus        88 ~~C~y~~~~~~~m~~H~~~~Hg  109 (109)
T PF12013_consen   88 PHCGYITRSKKTMRKHWRKEHG  109 (109)
T ss_pred             CCCCcEeccHHHHHHHHHHhcC
Confidence            9999999999999999998874


No 59 
>smart00451 ZnF_U1 U1-like zinc finger. Family of C2H2-type zinc fingers, present in matrin, U1 small nuclear ribonucleoprotein C and other RNA-binding proteins.
Probab=94.21  E-value=0.031  Score=26.34  Aligned_cols=22  Identities=27%  Similarity=0.683  Sum_probs=18.4

Q ss_pred             CccCcccccccCCchhHHHHHH
Q psy12258        112 PHFCPVCNKMFRVRSDMKRHLN  133 (171)
Q Consensus       112 ~~~C~~C~~~f~~~~~l~~H~~  133 (171)
                      +|.|..|++.|.+...+..|++
T Consensus         3 ~~~C~~C~~~~~~~~~~~~H~~   24 (35)
T smart00451        3 GFYCKLCNVTFTDEISVEAHLK   24 (35)
T ss_pred             CeEccccCCccCCHHHHHHHHC
Confidence            5789999999998888888874


No 60 
>COG4049 Uncharacterized protein containing archaeal-type C2H2 Zn-finger [General function prediction only]
Probab=94.18  E-value=0.027  Score=29.37  Aligned_cols=29  Identities=41%  Similarity=0.752  Sum_probs=22.5

Q ss_pred             cCCCCccCcccccccCCchhHHHHHHHhc
Q psy12258        108 TGEKPHFCPVCNKMFRVRSDMKRHLNTHN  136 (171)
Q Consensus       108 ~~~~~~~C~~C~~~f~~~~~l~~H~~~h~  136 (171)
                      -++..++|+.||..|....++.+|....|
T Consensus        13 DGE~~lrCPRC~~~FR~~K~Y~RHVNKaH   41 (65)
T COG4049          13 DGEEFLRCPRCGMVFRRRKDYIRHVNKAH   41 (65)
T ss_pred             CCceeeeCCchhHHHHHhHHHHHHhhHHh
Confidence            46677888888888888888888876544


No 61 
>KOG2482|consensus
Probab=94.08  E-value=0.067  Score=38.89  Aligned_cols=107  Identities=21%  Similarity=0.362  Sum_probs=64.7

Q ss_pred             CeeCCccchhccCcccHHHhhhhc-CCCCCc----c-cccchhhhccChHHHHHHH----hhh--c-------------C
Q psy12258         27 PYGCEVCGRHFRQWGDLKYHKASL-HSDVKA----F-QCEYCGKDFARKYSLVVHR----RIH--T-------------G   81 (171)
Q Consensus        27 ~~~C~~C~~~f~~~~~l~~H~~~~-h~~~~~----~-~C~~C~~~~~~~~~l~~h~----~~~--~-------------~   81 (171)
                      .+.|-+|.+.|.+...|+.||+.. |.+..|    | +--.-+..-..++....|.    ..-  .             +
T Consensus       195 r~~CLyCekifrdkntLkeHMrkK~HrrinPknreYDkfyiINY~ev~ks~t~~~~e~dret~~d~~E~D~~wsDw~ed~  274 (423)
T KOG2482|consen  195 RLRCLYCEKIFRDKNTLKEHMRKKRHRRINPKNREYDKFYIINYLEVGKSWTIVHSEDDRETNEDINETDDTWSDWNEDD  274 (423)
T ss_pred             hheeeeeccccCCcHHHHHHHHhccCcccCCCccccceEEEEeHhhcCCccchhhhhhhhhhhccccccccchhhhhcCC
Confidence            378999999999999999999863 332222    1 0000111001111111111    110  0             1


Q ss_pred             CCC--ccCccchhhcCCHHHHHHHHHHhcC---------------------------CCCccCcccccccCCchhHHHHH
Q psy12258         82 ERN--YQCEFCHKAFRASSYLQNHRRIHTG---------------------------EKPHFCPVCNKMFRVRSDMKRHL  132 (171)
Q Consensus        82 ~~~--~~C~~C~~~~~~~~~l~~H~~~h~~---------------------------~~~~~C~~C~~~f~~~~~l~~H~  132 (171)
                      ..+  .+|-.|...+.....|..|+...+.                           .....|-.|...|.....|..||
T Consensus       275 a~a~~v~CLfC~~~~en~~~l~eHmk~vHe~Dl~Ki~sd~~Ln~YqrvrviNyiRkq~~~~~c~~cd~~F~~e~~l~~hm  354 (423)
T KOG2482|consen  275 AEALSVVCLFCTNFYENPVFLFEHMKIVHEFDLLKIQSDYSLNFYQRVRVINYIRKQKKKSRCAECDLSFWKEPGLLIHM  354 (423)
T ss_pred             CCccceEEEeeccchhhHHHHHHHHHHHHHhhHHhhccccccchhhhhhHHHHHHHHhhccccccccccccCcchhhhhc
Confidence            112  5788898888888888888876442                           11246888999999999999998


Q ss_pred             H
Q psy12258        133 N  133 (171)
Q Consensus       133 ~  133 (171)
                      -
T Consensus       355 ~  355 (423)
T KOG2482|consen  355 V  355 (423)
T ss_pred             c
Confidence            4


No 62 
>smart00451 ZnF_U1 U1-like zinc finger. Family of C2H2-type zinc fingers, present in matrin, U1 small nuclear ribonucleoprotein C and other RNA-binding proteins.
Probab=93.88  E-value=0.031  Score=26.34  Aligned_cols=22  Identities=18%  Similarity=0.415  Sum_probs=13.9

Q ss_pred             CeeCCccchhccCcccHHHhhh
Q psy12258         27 PYGCEVCGRHFRQWGDLKYHKA   48 (171)
Q Consensus        27 ~~~C~~C~~~f~~~~~l~~H~~   48 (171)
                      +|.|++|+..|.+...+..|+.
T Consensus         3 ~~~C~~C~~~~~~~~~~~~H~~   24 (35)
T smart00451        3 GFYCKLCNVTFTDEISVEAHLK   24 (35)
T ss_pred             CeEccccCCccCCHHHHHHHHC
Confidence            4566666666666666666654


No 63 
>KOG4173|consensus
Probab=93.69  E-value=0.049  Score=36.69  Aligned_cols=47  Identities=28%  Similarity=0.634  Sum_probs=33.3

Q ss_pred             eeCCc--cchhccCcccHHHhhhhcCCCCCcccccchhhhccChHHHHHHHhh
Q psy12258         28 YGCEV--CGRHFRQWGDLKYHKASLHSDVKAFQCEYCGKDFARKYSLVVHRRI   78 (171)
Q Consensus        28 ~~C~~--C~~~f~~~~~l~~H~~~~h~~~~~~~C~~C~~~~~~~~~l~~h~~~   78 (171)
                      +.|++  |...|.+......|....|..    .|.+|.+.|++...|..|+..
T Consensus        80 ~~cqvagc~~~~d~lD~~E~hY~~~h~~----sCs~C~r~~Pt~hLLd~HI~E  128 (253)
T KOG4173|consen   80 FACQVAGCCQVFDALDDYEHHYHTLHGN----SCSFCKRAFPTGHLLDAHILE  128 (253)
T ss_pred             ccccccchHHHHhhhhhHHHhhhhcccc----hhHHHHHhCCchhhhhHHHHH
Confidence            66765  777777777777776655543    688888888887777777654


No 64 
>KOG4173|consensus
Probab=93.67  E-value=0.17  Score=34.15  Aligned_cols=79  Identities=29%  Similarity=0.559  Sum_probs=59.9

Q ss_pred             CCcccccc--hhhhccChHHHHHHHhhhcCCCCccCccchhhcCCHHHHHHHHHHhc----------CCCCccC--cccc
Q psy12258         54 VKAFQCEY--CGKDFARKYSLVVHRRIHTGERNYQCEFCHKAFRASSYLQNHRRIHT----------GEKPHFC--PVCN  119 (171)
Q Consensus        54 ~~~~~C~~--C~~~~~~~~~l~~h~~~~~~~~~~~C~~C~~~~~~~~~l~~H~~~h~----------~~~~~~C--~~C~  119 (171)
                      .+.+.|.+  |-..|.+...+..|...-++.   .|..|.+.|.....|..|+.-.+          |..-|.|  ..|+
T Consensus        77 ~~~~~cqvagc~~~~d~lD~~E~hY~~~h~~---sCs~C~r~~Pt~hLLd~HI~E~HDs~Fqa~veRG~dMy~ClvEgCt  153 (253)
T KOG4173|consen   77 VPAFACQVAGCCQVFDALDDYEHHYHTLHGN---SCSFCKRAFPTGHLLDAHILEWHDSLFQALVERGQDMYQCLVEGCT  153 (253)
T ss_pred             cccccccccchHHHHhhhhhHHHhhhhcccc---hhHHHHHhCCchhhhhHHHHHHHHHHHHHHHHcCccHHHHHHHhhh
Confidence            34467876  777888877777777655442   69999999999999999976433          3455888  5599


Q ss_pred             cccCCchhHHHHHH-Hh
Q psy12258        120 KMFRVRSDMKRHLN-TH  135 (171)
Q Consensus       120 ~~f~~~~~l~~H~~-~h  135 (171)
                      ..|.+...-..|+- +|
T Consensus       154 ~KFkT~r~RkdH~I~~H  170 (253)
T KOG4173|consen  154 EKFKTSRDRKDHMIRMH  170 (253)
T ss_pred             hhhhhhhhhhhHHHHhc
Confidence            99999999889974 44


No 65 
>PF09538 FYDLN_acid:  Protein of unknown function (FYDLN_acid);  InterPro: IPR012644 Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues. The function of members of this family is unknown.
Probab=93.43  E-value=0.038  Score=33.65  Aligned_cols=30  Identities=33%  Similarity=0.843  Sum_probs=17.1

Q ss_pred             eeCCccchhccCcccHHHhhhhcCCCCCcccccchhhhccCh
Q psy12258         28 YGCEVCGRHFRQWGDLKYHKASLHSDVKAFQCEYCGKDFARK   69 (171)
Q Consensus        28 ~~C~~C~~~f~~~~~l~~H~~~~h~~~~~~~C~~C~~~~~~~   69 (171)
                      ..|+.||..|.   .|.         ..|..|+.||..|...
T Consensus        10 R~Cp~CG~kFY---DLn---------k~PivCP~CG~~~~~~   39 (108)
T PF09538_consen   10 RTCPSCGAKFY---DLN---------KDPIVCPKCGTEFPPE   39 (108)
T ss_pred             ccCCCCcchhc---cCC---------CCCccCCCCCCccCcc
Confidence            35777777662   211         2456677777666654


No 66 
>PF12013 DUF3505:  Protein of unknown function (DUF3505);  InterPro: IPR022698  This family of proteins is functionally uncharacterised. This protein is found in eukaryotes. Proteins in this family are typically between 247 to 1018 amino acids in length. This region contains two segments that are likely to be C2H2 zinc binding domains. 
Probab=93.10  E-value=0.15  Score=31.07  Aligned_cols=83  Identities=17%  Similarity=0.274  Sum_probs=48.2

Q ss_pred             CCeeCCccchhccCcccHHHhhhhcCCCCCcccccchhhhccChHHHHH-H--Hhhhc-C---------CCCccC----c
Q psy12258         26 KPYGCEVCGRHFRQWGDLKYHKASLHSDVKAFQCEYCGKDFARKYSLVV-H--RRIHT-G---------ERNYQC----E   88 (171)
Q Consensus        26 ~~~~C~~C~~~f~~~~~l~~H~~~~h~~~~~~~C~~C~~~~~~~~~l~~-h--~~~~~-~---------~~~~~C----~   88 (171)
                      +-..|..|+..... ..+..|++..|..........-...+.....|.. .  +.... .         -.-|.|    .
T Consensus        10 ~vlIC~~C~~av~~-~~v~~HL~~~H~~~~~~~~~~i~~~~~~~~~l~~~~~~~~~p~~~~~Pi~gLp~~~G~~C~~~~~   88 (109)
T PF12013_consen   10 RVLICRQCQYAVQP-SEVESHLRKRHHILKSQERQRIVEAIRQWPDLLPDPDDLQIPPDPSPPIPGLPVYDGYRCQCDPP   88 (109)
T ss_pred             CEEEeCCCCcccCc-hHHHHHHHHhcccccHHHHHHHHHHHHhhhhcccCccccCCCCCCCCcCCCCCCCCCeeeecCCC
Confidence            45789999988766 8899999865643322111111111111110100 0  00000 0         123889    9


Q ss_pred             cchhhcCCHHHHHHHHHHhcC
Q psy12258         89 FCHKAFRASSYLQNHRRIHTG  109 (171)
Q Consensus        89 ~C~~~~~~~~~l~~H~~~h~~  109 (171)
                      .|+....+...+..|++.+++
T Consensus        89 ~C~y~~~~~~~m~~H~~~~Hg  109 (109)
T PF12013_consen   89 HCGYITRSKKTMRKHWRKEHG  109 (109)
T ss_pred             CCCcEeccHHHHHHHHHHhcC
Confidence            999999999999999998764


No 67 
>KOG2893|consensus
Probab=92.43  E-value=0.053  Score=37.41  Aligned_cols=41  Identities=32%  Similarity=0.599  Sum_probs=19.8

Q ss_pred             CCccchhccCcccHHHhhhhcCCCCCcccccchhhhccChHHHHHH
Q psy12258         30 CEVCGRHFRQWGDLKYHKASLHSDVKAFQCEYCGKDFARKYSLVVH   75 (171)
Q Consensus        30 C~~C~~~f~~~~~l~~H~~~~h~~~~~~~C~~C~~~~~~~~~l~~h   75 (171)
                      |=+|.+-|.++.-|++|++.     +.|+|.+|.+-+.+--.|..|
T Consensus        13 cwycnrefddekiliqhqka-----khfkchichkkl~sgpglsih   53 (341)
T KOG2893|consen   13 CWYCNREFDDEKILIQHQKA-----KHFKCHICHKKLFSGPGLSIH   53 (341)
T ss_pred             eeecccccchhhhhhhhhhh-----ccceeeeehhhhccCCCceee
Confidence            44555555555555555542     235555555443333334443


No 68 
>KOG2482|consensus
Probab=92.16  E-value=0.4  Score=35.09  Aligned_cols=110  Identities=18%  Similarity=0.271  Sum_probs=61.1

Q ss_pred             CeeCCccchhc-cCcccHHHhhhhcCCCC---------------------CcccccchhhhccChHHHHHHHhhhc-CCC
Q psy12258         27 PYGCEVCGRHF-RQWGDLKYHKASLHSDV---------------------KAFQCEYCGKDFARKYSLVVHRRIHT-GER   83 (171)
Q Consensus        27 ~~~C~~C~~~f-~~~~~l~~H~~~~h~~~---------------------~~~~C~~C~~~~~~~~~l~~h~~~~~-~~~   83 (171)
                      +..|-.|...+ .+++....|+-..|.-.                     ..+.|-.|.+.|.++..|..||+... .+-
T Consensus       144 slqClFCn~e~lgnRs~~l~Hlf~~H~lniGlpDniVyvnelLehLkekL~r~~CLyCekifrdkntLkeHMrkK~Hrri  223 (423)
T KOG2482|consen  144 SLQCLFCNNEGLGNRSEILEHLFHVHGLNIGLPDNIVYVNELLEHLKEKLERLRCLYCEKIFRDKNTLKEHMRKKRHRRI  223 (423)
T ss_pred             eeEEEEecchhcccHHHHHHHHHHHhhhccCCCcceeeHHHHHHHHHHHHhhheeeeeccccCCcHHHHHHHHhccCccc
Confidence            45677775543 34566677766555321                     23688899999999999999987532 111


Q ss_pred             CccCccchh------hcCCHHHHHHHHHH----h--c-------------CCCC--ccCcccccccCCchhHHHHHHHhc
Q psy12258         84 NYQCEFCHK------AFRASSYLQNHRRI----H--T-------------GEKP--HFCPVCNKMFRVRSDMKRHLNTHN  136 (171)
Q Consensus        84 ~~~C~~C~~------~~~~~~~l~~H~~~----h--~-------------~~~~--~~C~~C~~~f~~~~~l~~H~~~h~  136 (171)
                      .-+-.+-++      .-..++....|...    .  .             +..+  .+|-.|.........|..||+..|
T Consensus       224 nPknreYDkfyiINY~ev~ks~t~~~~e~dret~~d~~E~D~~wsDw~ed~a~a~~v~CLfC~~~~en~~~l~eHmk~vH  303 (423)
T KOG2482|consen  224 NPKNREYDKFYIINYLEVGKSWTIVHSEDDRETNEDINETDDTWSDWNEDDAEALSVVCLFCTNFYENPVFLFEHMKIVH  303 (423)
T ss_pred             CCCccccceEEEEeHhhcCCccchhhhhhhhhhhccccccccchhhhhcCCCCccceEEEeeccchhhHHHHHHHHHHHH
Confidence            111111111      00011111111111    0  0             1112  589999999888999999997644


No 69 
>TIGR00622 ssl1 transcription factor ssl1. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=91.73  E-value=0.15  Score=31.09  Aligned_cols=92  Identities=23%  Similarity=0.306  Sum_probs=47.1

Q ss_pred             CCCeeCCccchhccCcccHHHhhhhcCC-CCCcccccchhhhccChHHHHHHHhhhcCCCCccCccchhhcCCHHHHHHH
Q psy12258         25 LKPYGCEVCGRHFRQWGDLKYHKASLHS-DVKAFQCEYCGKDFARKYSLVVHRRIHTGERNYQCEFCHKAFRASSYLQNH  103 (171)
Q Consensus        25 ~~~~~C~~C~~~f~~~~~l~~H~~~~h~-~~~~~~C~~C~~~~~~~~~l~~h~~~~~~~~~~~C~~C~~~~~~~~~l~~H  103 (171)
                      +-|..|+.|+-+.-+...|.+...  |- ..++|.=.      .  +        ........|..|...|........ 
T Consensus        13 ~LP~~CpiCgLtLVss~HLARSyH--HLfPl~~f~ev------~--~--------~~~~~~~~C~~C~~~f~~~~~~~~-   73 (112)
T TIGR00622        13 ELPVECPICGLTLILSTHLARSYH--HLFPLKAFQEI------P--L--------EEYNGSRFCFGCQGPFPKPPVSPF-   73 (112)
T ss_pred             CCCCcCCcCCCEEeccchHHHhhh--ccCCCcccccc------c--c--------cccCCCCcccCcCCCCCCcccccc-
Confidence            346677777777777777776542  21 11222100      0  0        000111237777776654321100 


Q ss_pred             HHHhcCCCCccCcccccccCCchhHHHHHHHhc
Q psy12258        104 RRIHTGEKPHFCPVCNKMFRVRSDMKRHLNTHN  136 (171)
Q Consensus       104 ~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~h~  136 (171)
                       ..-.....|+|+.|...|-..-++..|...|+
T Consensus        74 -~~~~~~~~y~C~~C~~~FC~dCD~fiHe~Lh~  105 (112)
T TIGR00622        74 -DELKDSHRYVCAVCKNVFCVDCDVFVHESLHC  105 (112)
T ss_pred             -cccccccceeCCCCCCccccccchhhhhhccC
Confidence             00122345778888888877777777766665


No 70 
>TIGR00622 ssl1 transcription factor ssl1. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=91.06  E-value=0.2  Score=30.57  Aligned_cols=18  Identities=33%  Similarity=0.591  Sum_probs=12.4

Q ss_pred             CCCccccccCChhhHHHH
Q psy12258          1 MCDTCGKSFFSSTALKVH   18 (171)
Q Consensus         1 ~C~~C~~~f~~~~~l~~H   18 (171)
                      .|++|+...-....|.+-
T Consensus        17 ~CpiCgLtLVss~HLARS   34 (112)
T TIGR00622        17 ECPICGLTLILSTHLARS   34 (112)
T ss_pred             cCCcCCCEEeccchHHHh
Confidence            478888877666666553


No 71 
>PF10571 UPF0547:  Uncharacterised protein family UPF0547;  InterPro: IPR018886  This domain may well be a type of zinc-finger as it carries two pairs of highly conserved cysteine residues though with no accompanying histidines. Several members are annotated as putative helicases. 
Probab=90.51  E-value=0.15  Score=22.45  Aligned_cols=10  Identities=40%  Similarity=0.929  Sum_probs=7.1

Q ss_pred             eCCccchhcc
Q psy12258         29 GCEVCGRHFR   38 (171)
Q Consensus        29 ~C~~C~~~f~   38 (171)
                      .|+.||..|.
T Consensus        16 ~Cp~CG~~F~   25 (26)
T PF10571_consen   16 FCPHCGYDFE   25 (26)
T ss_pred             cCCCCCCCCc
Confidence            5777877764


No 72 
>COG2888 Predicted Zn-ribbon RNA-binding protein with a function in translation [Translation, ribosomal structure and biogenesis]
Probab=90.49  E-value=0.17  Score=26.93  Aligned_cols=9  Identities=44%  Similarity=1.195  Sum_probs=5.1

Q ss_pred             CCccCcccc
Q psy12258        111 KPHFCPVCN  119 (171)
Q Consensus       111 ~~~~C~~C~  119 (171)
                      .+|+|+.||
T Consensus        49 ~~Y~Cp~CG   57 (61)
T COG2888          49 NPYRCPKCG   57 (61)
T ss_pred             CceECCCcC
Confidence            455666555


No 73 
>PRK14890 putative Zn-ribbon RNA-binding protein; Provisional
Probab=90.16  E-value=0.16  Score=27.04  Aligned_cols=9  Identities=44%  Similarity=1.231  Sum_probs=5.5

Q ss_pred             CCccCcccc
Q psy12258        111 KPHFCPVCN  119 (171)
Q Consensus       111 ~~~~C~~C~  119 (171)
                      .+|+|+.||
T Consensus        47 ~~Y~CP~CG   55 (59)
T PRK14890         47 NPYTCPKCG   55 (59)
T ss_pred             CceECCCCC
Confidence            456666666


No 74 
>PHA00626 hypothetical protein
Probab=89.82  E-value=0.075  Score=27.84  Aligned_cols=15  Identities=13%  Similarity=0.104  Sum_probs=10.8

Q ss_pred             CCCccCcccccccCC
Q psy12258        110 EKPHFCPVCNKMFRV  124 (171)
Q Consensus       110 ~~~~~C~~C~~~f~~  124 (171)
                      ...|+|+.||..|+.
T Consensus        21 snrYkCkdCGY~ft~   35 (59)
T PHA00626         21 SDDYVCCDCGYNDSK   35 (59)
T ss_pred             CcceEcCCCCCeech
Confidence            356888888877753


No 75 
>PRK00464 nrdR transcriptional regulator NrdR; Validated
Probab=89.73  E-value=0.037  Score=35.94  Aligned_cols=12  Identities=33%  Similarity=0.728  Sum_probs=6.1

Q ss_pred             ccCcccccccCC
Q psy12258        113 HFCPVCNKMFRV  124 (171)
Q Consensus       113 ~~C~~C~~~f~~  124 (171)
                      ++|+.||+.|..
T Consensus        29 ~~c~~c~~~f~~   40 (154)
T PRK00464         29 RECLACGKRFTT   40 (154)
T ss_pred             eeccccCCcceE
Confidence            455555555543


No 76 
>cd00729 rubredoxin_SM Rubredoxin, Small Modular nonheme iron binding domain containing a [Fe(SCys)4] center, present in rubrerythrin and nigerythrin and detected either N- or C-terminal to such proteins as flavin reductase, NAD(P)H-nitrite reductase, and ferredoxin-thioredoxin reductase. In rubredoxin, the iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), and  believed to be involved in electron transfer. Rubrerythrins and nigerythrins are small homodimeric proteins, generally consisting of 2 domains: a rubredoxin domain C-terminal to a non-sulfur, oxo-bridged diiron site in the N-terminal rubrerythrin domain. Rubrerythrins and nigerythrins have putative peroxide activity.
Probab=89.65  E-value=0.11  Score=24.44  Aligned_cols=8  Identities=50%  Similarity=1.613  Sum_probs=4.1

Q ss_pred             CccCcccc
Q psy12258        112 PHFCPVCN  119 (171)
Q Consensus       112 ~~~C~~C~  119 (171)
                      |..|++||
T Consensus        18 p~~CP~Cg   25 (34)
T cd00729          18 PEKCPICG   25 (34)
T ss_pred             CCcCcCCC
Confidence            34555555


No 77 
>KOG2893|consensus
Probab=89.11  E-value=0.085  Score=36.45  Aligned_cols=35  Identities=29%  Similarity=0.904  Sum_probs=16.6

Q ss_pred             ccchhhhccChHHHHHHHhhhcCCCCccCccchhhcCCH
Q psy12258         59 CEYCGKDFARKYSLVVHRRIHTGERNYQCEFCHKAFRAS   97 (171)
Q Consensus        59 C~~C~~~~~~~~~l~~h~~~~~~~~~~~C~~C~~~~~~~   97 (171)
                      |=+|++.|.+..-|..|++.    +.|+|.+|.+.+-+-
T Consensus        13 cwycnrefddekiliqhqka----khfkchichkkl~sg   47 (341)
T KOG2893|consen   13 CWYCNREFDDEKILIQHQKA----KHFKCHICHKKLFSG   47 (341)
T ss_pred             eeecccccchhhhhhhhhhh----ccceeeeehhhhccC
Confidence            44455555555555544443    234555555444333


No 78 
>PF13719 zinc_ribbon_5:  zinc-ribbon domain
Probab=88.82  E-value=0.16  Score=24.47  Aligned_cols=8  Identities=38%  Similarity=1.028  Sum_probs=3.1

Q ss_pred             ccCccccc
Q psy12258        113 HFCPVCNK  120 (171)
Q Consensus       113 ~~C~~C~~  120 (171)
                      .+|+.|+.
T Consensus        26 vrC~~C~~   33 (37)
T PF13719_consen   26 VRCPKCGH   33 (37)
T ss_pred             EECCCCCc
Confidence            33444433


No 79 
>COG5048 FOG: Zn-finger [General function prediction only]
Probab=88.73  E-value=0.13  Score=38.84  Aligned_cols=58  Identities=36%  Similarity=0.646  Sum_probs=48.6

Q ss_pred             CCccCccchhhcCCHHHHHHHHH--HhcCC--CCccCc--ccccccCCchhHHHHHHHhccCcc
Q psy12258         83 RNYQCEFCHKAFRASSYLQNHRR--IHTGE--KPHFCP--VCNKMFRVRSDMKRHLNTHNVDAR  140 (171)
Q Consensus        83 ~~~~C~~C~~~~~~~~~l~~H~~--~h~~~--~~~~C~--~C~~~f~~~~~l~~H~~~h~~~~~  140 (171)
                      .++.|..|...|.....+..|.+  .|.++  +++.|+  .|++.|.+...+..|...|.....
T Consensus       288 ~~~~~~~~~~~~s~~~~l~~~~~~~~h~~~~~~~~~~p~~~~~~~~~~~~~~~~~~~~~~~~~~  351 (467)
T COG5048         288 LPIKSKQCNISFSRSSPLTRHLRSVNHSGESLKPFSCPYSLCGKLFSRNDALKRHILLHTSISP  351 (467)
T ss_pred             cCCCCccccCCccccccccccccccccccccCCceeeeccCCCccccccccccCCcccccCCCc
Confidence            35788889999999999999998  78888  899998  799999999988888887765543


No 80 
>TIGR02300 FYDLN_acid conserved hypothetical protein TIGR02300. Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues. The function of members of this family is unknown.
Probab=88.39  E-value=0.24  Score=30.84  Aligned_cols=30  Identities=23%  Similarity=0.464  Sum_probs=19.8

Q ss_pred             eeCCccchhccCcccHHHhhhhcCCCCCcccccchhhhccCh
Q psy12258         28 YGCEVCGRHFRQWGDLKYHKASLHSDVKAFQCEYCGKDFARK   69 (171)
Q Consensus        28 ~~C~~C~~~f~~~~~l~~H~~~~h~~~~~~~C~~C~~~~~~~   69 (171)
                      ..|+.||..|..   |         +..|..|+.|+..+...
T Consensus        10 r~Cp~cg~kFYD---L---------nk~p~vcP~cg~~~~~~   39 (129)
T TIGR02300        10 RICPNTGSKFYD---L---------NRRPAVSPYTGEQFPPE   39 (129)
T ss_pred             ccCCCcCccccc---c---------CCCCccCCCcCCccCcc
Confidence            468888888722   2         13467788888876654


No 81 
>KOG2186|consensus
Probab=86.94  E-value=0.39  Score=33.60  Aligned_cols=46  Identities=30%  Similarity=0.673  Sum_probs=26.6

Q ss_pred             eeCCccchhccCcccHHHhhhhcCCCCCcccccchhhhccChHHHHHHHh
Q psy12258         28 YGCEVCGRHFRQWGDLKYHKASLHSDVKAFQCEYCGKDFARKYSLVVHRR   77 (171)
Q Consensus        28 ~~C~~C~~~f~~~~~l~~H~~~~h~~~~~~~C~~C~~~~~~~~~l~~h~~   77 (171)
                      |.|+.||....-.. +-.|+.. .++ .-|.|..|+..|.. ..+..|..
T Consensus         4 FtCnvCgEsvKKp~-vekH~sr-Crn-~~fSCIDC~k~F~~-~sYknH~k   49 (276)
T KOG2186|consen    4 FTCNVCGESVKKPQ-VEKHMSR-CRN-AYFSCIDCGKTFER-VSYKNHTK   49 (276)
T ss_pred             Eehhhhhhhccccc-hHHHHHh-ccC-CeeEEeeccccccc-chhhhhhh
Confidence            66777777655443 4446652 332 55677777777776 34455543


No 82 
>PF13717 zinc_ribbon_4:  zinc-ribbon domain
Probab=86.89  E-value=0.26  Score=23.55  Aligned_cols=6  Identities=33%  Similarity=1.049  Sum_probs=2.2

Q ss_pred             cCcccc
Q psy12258        114 FCPVCN  119 (171)
Q Consensus       114 ~C~~C~  119 (171)
                      +|+.|+
T Consensus        27 ~C~~C~   32 (36)
T PF13717_consen   27 RCSKCG   32 (36)
T ss_pred             ECCCCC
Confidence            333333


No 83 
>PF06524 NOA36:  NOA36 protein;  InterPro: IPR010531 This family consists of several NOA36 proteins which contain 29 highly conserved cysteine residues. The function of this protein is unknown.; GO: 0008270 zinc ion binding, 0005634 nucleus
Probab=86.80  E-value=0.24  Score=34.74  Aligned_cols=80  Identities=21%  Similarity=0.464  Sum_probs=47.0

Q ss_pred             CCcccccchhhhccChHHHHHHHhhh--cCCCCccCccchhhcCCHHHH-------HHHHHH----hcCCCCccCccccc
Q psy12258         54 VKAFQCEYCGKDFARKYSLVVHRRIH--TGERNYQCEFCHKAFRASSYL-------QNHRRI----HTGEKPHFCPVCNK  120 (171)
Q Consensus        54 ~~~~~C~~C~~~~~~~~~l~~h~~~~--~~~~~~~C~~C~~~~~~~~~l-------~~H~~~----h~~~~~~~C~~C~~  120 (171)
                      -+.|.|..|+..+-....+. |+..-  .....|+|..|++.-.+. -|       ..|++.    ....+++.||+||.
T Consensus       140 Grif~CsfC~~flCEDDQFE-HQAsCQvLe~E~~KC~SCNrlGq~s-CLRCK~cfCddHvrrKg~ky~k~k~~PCPKCg~  217 (314)
T PF06524_consen  140 GRIFKCSFCDNFLCEDDQFE-HQASCQVLESETFKCQSCNRLGQYS-CLRCKICFCDDHVRRKGFKYEKGKPIPCPKCGY  217 (314)
T ss_pred             CeEEEeecCCCeeeccchhh-hhhhhhhhhcccccccccccccchh-hhheeeeehhhhhhhcccccccCCCCCCCCCCC
Confidence            45688888887555444433 33221  223467777776543222 11       134332    23468899999999


Q ss_pred             ccCCchhHHHHHHHh
Q psy12258        121 MFRVRSDMKRHLNTH  135 (171)
Q Consensus       121 ~f~~~~~l~~H~~~h  135 (171)
                      .......|..-.|.|
T Consensus       218 et~eTkdLSmStR~h  232 (314)
T PF06524_consen  218 ETQETKDLSMSTRSH  232 (314)
T ss_pred             cccccccceeeeecc
Confidence            888777776666655


No 84 
>COG1592 Rubrerythrin [Energy production and conversion]
Probab=86.66  E-value=0.32  Score=31.99  Aligned_cols=24  Identities=38%  Similarity=1.077  Sum_probs=18.2

Q ss_pred             CccCccchhhcCCHHHHHHHHHHhcCCCCccCccccc
Q psy12258         84 NYQCEFCHKAFRASSYLQNHRRIHTGEKPHFCPVCNK  120 (171)
Q Consensus        84 ~~~C~~C~~~~~~~~~l~~H~~~h~~~~~~~C~~C~~  120 (171)
                      -|.|++||..             +.++-|-+||+||.
T Consensus       134 ~~vC~vCGy~-------------~~ge~P~~CPiCga  157 (166)
T COG1592         134 VWVCPVCGYT-------------HEGEAPEVCPICGA  157 (166)
T ss_pred             EEEcCCCCCc-------------ccCCCCCcCCCCCC
Confidence            5899999854             34577889999983


No 85 
>smart00659 RPOLCX RNA polymerase subunit CX. present in RNA polymerase I, II and III
Probab=86.41  E-value=0.26  Score=24.72  Aligned_cols=10  Identities=30%  Similarity=0.747  Sum_probs=5.1

Q ss_pred             ccCccchhhc
Q psy12258         85 YQCEFCHKAF   94 (171)
Q Consensus        85 ~~C~~C~~~~   94 (171)
                      |.|..||..|
T Consensus         3 Y~C~~Cg~~~   12 (44)
T smart00659        3 YICGECGREN   12 (44)
T ss_pred             EECCCCCCEe
Confidence            4455555544


No 86 
>PF09986 DUF2225:  Uncharacterized protein conserved in bacteria (DUF2225);  InterPro: IPR018708 This conserved bacterial family has no known function.
Probab=86.21  E-value=0.13  Score=35.53  Aligned_cols=40  Identities=30%  Similarity=0.561  Sum_probs=23.4

Q ss_pred             CCCccccccCChhhHHHHHHHcC----------CCCC-----eeCCccchhccCc
Q psy12258          1 MCDTCGKSFFSSTALKVHNRVHL----------GLKP-----YGCEVCGRHFRQW   40 (171)
Q Consensus         1 ~C~~C~~~f~~~~~l~~H~~~h~----------~~~~-----~~C~~C~~~f~~~   40 (171)
                      .||+|+..|.+..-.....+.-.          +..|     ..|+.||..+...
T Consensus         7 ~CPvC~~~F~~~~vrs~~~r~~~~d~D~~~~Y~~vnP~~Y~V~vCP~CgyA~~~~   61 (214)
T PF09986_consen    7 TCPVCGKEFKTKKVRSGKIRVIRRDSDFCPRYKGVNPLFYEVWVCPHCGYAAFEE   61 (214)
T ss_pred             ECCCCCCeeeeeEEEcCCceEeeecCCCccccCCCCCeeeeEEECCCCCCccccc
Confidence            48999998887765444433211          1111     5678887766544


No 87 
>TIGR02098 MJ0042_CXXC MJ0042 family finger-like domain. This domain contains a CXXCX(19)CXXC motif suggestive of both zinc fingers and thioredoxin, usually found at the N-terminus of prokaryotic proteins. One partially characterized gene, agmX, is among a large set in Myxococcus whose interruption affects adventurous gliding motility.
Probab=86.17  E-value=0.49  Score=22.69  Aligned_cols=14  Identities=29%  Similarity=0.591  Sum_probs=7.3

Q ss_pred             eeCCccchhccCcc
Q psy12258         28 YGCEVCGRHFRQWG   41 (171)
Q Consensus        28 ~~C~~C~~~f~~~~   41 (171)
                      +.|+.|+..|.-..
T Consensus         3 ~~CP~C~~~~~v~~   16 (38)
T TIGR02098         3 IQCPNCKTSFRVVD   16 (38)
T ss_pred             EECCCCCCEEEeCH
Confidence            34666666554443


No 88 
>KOG2785|consensus
Probab=85.87  E-value=0.66  Score=34.47  Aligned_cols=21  Identities=19%  Similarity=0.570  Sum_probs=13.2

Q ss_pred             eeCCccchhccCcccHHHhhh
Q psy12258         28 YGCEVCGRHFRQWGDLKYHKA   48 (171)
Q Consensus        28 ~~C~~C~~~f~~~~~l~~H~~   48 (171)
                      |+|.-|...|........|++
T Consensus         4 ftC~tC~v~F~~ad~Qr~HyK   24 (390)
T KOG2785|consen    4 FTCNTCNVEFDDADEQRAHYK   24 (390)
T ss_pred             ceeeceeeeeccHHHHHHHhh
Confidence            566666666666665555654


No 89 
>PF09986 DUF2225:  Uncharacterized protein conserved in bacteria (DUF2225);  InterPro: IPR018708 This conserved bacterial family has no known function.
Probab=85.79  E-value=0.24  Score=34.15  Aligned_cols=45  Identities=22%  Similarity=0.424  Sum_probs=28.1

Q ss_pred             CCCeeCCccchhccCcccHHHhhhhcC---------CCCCc-----ccccchhhhccCh
Q psy12258         25 LKPYGCEVCGRHFRQWGDLKYHKASLH---------SDVKA-----FQCEYCGKDFARK   69 (171)
Q Consensus        25 ~~~~~C~~C~~~f~~~~~l~~H~~~~h---------~~~~~-----~~C~~C~~~~~~~   69 (171)
                      ++...||+|+..|....-.....+...         .+..|     +.|+.||.++...
T Consensus         3 ~k~~~CPvC~~~F~~~~vrs~~~r~~~~d~D~~~~Y~~vnP~~Y~V~vCP~CgyA~~~~   61 (214)
T PF09986_consen    3 DKKITCPVCGKEFKTKKVRSGKIRVIRRDSDFCPRYKGVNPLFYEVWVCPHCGYAAFEE   61 (214)
T ss_pred             CCceECCCCCCeeeeeEEEcCCceEeeecCCCccccCCCCCeeeeEEECCCCCCccccc
Confidence            456899999999987754443333211         12223     5789998776643


No 90 
>TIGR00373 conserved hypothetical protein TIGR00373. This family of proteins is, so far, restricted to archaeal genomes. The family appears to be distantly related to the N-terminal region of the eukaryotic transcription initiation factor IIE alpha chain.
Probab=85.50  E-value=0.69  Score=30.32  Aligned_cols=36  Identities=19%  Similarity=0.401  Sum_probs=26.4

Q ss_pred             hcCCCCccCccchhhcCCHHHHHHHHHHhcCCCCccCcccccccC
Q psy12258         79 HTGERNYQCEFCHKAFRASSYLQNHRRIHTGEKPHFCPVCNKMFR  123 (171)
Q Consensus        79 ~~~~~~~~C~~C~~~~~~~~~l~~H~~~h~~~~~~~C~~C~~~f~  123 (171)
                      .....-|.|+.|+..|+....+.         ..|.|+.||....
T Consensus       104 e~~~~~Y~Cp~c~~r~tf~eA~~---------~~F~Cp~Cg~~L~  139 (158)
T TIGR00373       104 ETNNMFFICPNMCVRFTFNEAME---------LNFTCPRCGAMLD  139 (158)
T ss_pred             ccCCCeEECCCCCcEeeHHHHHH---------cCCcCCCCCCEee
Confidence            34456688988988888777774         2588999987654


No 91 
>smart00834 CxxC_CXXC_SSSS Putative regulatory protein. CxxC_CXXC_SSSS represents a region of about 41 amino acids found in a number of small proteins in a wide range of bacteria. The region usually begins with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One protein in this entry has been noted as a putative regulatory protein, designated FmdB. Most proteins in this entry have a C-terminal region containing highly degenerate sequence.
Probab=84.88  E-value=0.11  Score=25.36  Aligned_cols=10  Identities=50%  Similarity=1.271  Sum_probs=4.9

Q ss_pred             ccCccchhhc
Q psy12258         85 YQCEFCHKAF   94 (171)
Q Consensus        85 ~~C~~C~~~~   94 (171)
                      |+|+.||..|
T Consensus         6 y~C~~Cg~~f   15 (41)
T smart00834        6 YRCEDCGHTF   15 (41)
T ss_pred             EEcCCCCCEE
Confidence            4455555444


No 92 
>smart00734 ZnF_Rad18 Rad18-like CCHC zinc finger. Yeast Rad18p functions with Rad5p in error-free post-replicative DNA repair. This zinc finger is likely to bind nucleic-acids.
Probab=84.18  E-value=1  Score=19.76  Aligned_cols=18  Identities=17%  Similarity=0.469  Sum_probs=9.6

Q ss_pred             CCccccccCChhhHHHHHH
Q psy12258          2 CDTCGKSFFSSTALKVHNR   20 (171)
Q Consensus         2 C~~C~~~f~~~~~l~~H~~   20 (171)
                      ||+|+..+ ....+..|+.
T Consensus         4 CPiC~~~v-~~~~in~HLD   21 (26)
T smart00734        4 CPVCFREV-PENLINSHLD   21 (26)
T ss_pred             CCCCcCcc-cHHHHHHHHH
Confidence            66666655 3444555543


No 93 
>TIGR00373 conserved hypothetical protein TIGR00373. This family of proteins is, so far, restricted to archaeal genomes. The family appears to be distantly related to the N-terminal region of the eukaryotic transcription initiation factor IIE alpha chain.
Probab=84.13  E-value=0.7  Score=30.30  Aligned_cols=16  Identities=19%  Similarity=0.233  Sum_probs=7.1

Q ss_pred             cccccchhhhccChHH
Q psy12258         56 AFQCEYCGKDFARKYS   71 (171)
Q Consensus        56 ~~~C~~C~~~~~~~~~   71 (171)
                      -|.|+.|+..|+...+
T Consensus       109 ~Y~Cp~c~~r~tf~eA  124 (158)
T TIGR00373       109 FFICPNMCVRFTFNEA  124 (158)
T ss_pred             eEECCCCCcEeeHHHH
Confidence            3444444444444333


No 94 
>PF02892 zf-BED:  BED zinc finger;  InterPro: IPR003656 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents predicted BED-type zinc finger domains. The BED finger which was named after the Drosophila proteins BEAF and DREF, is found in one or more copies in cellular regulatory factors and transposases from plants, animals and fungi. The BED finger is an about 50 to 60 amino acid residues domain that contains a characteristic motif with two highly conserved aromatic positions, as well as a shared pattern of cysteines and histidines that is predicted to form a zinc finger. As diverse BED fingers are able to bind DNA, it has been suggested that DNA-binding is the general function of this domain []. Some proteins known to contain a BED domain include animal, plant and fungi AC1 and Hobo-like transposases; Caenorhabditis elegans Dpy-20 protein, a predicted cuticular gene transcriptional regulator; Drosophila BEAF (boundary element-associated factor), thought to be involved in chromatin insulation; Drosophila DREF, a transcriptional regulator for S-phase genes; and tobacco 3AF1 and tomato E4/E8-BP1, light- and ethylene-regulated DNA binding proteins that contain two BED fingers. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003677 DNA binding; PDB: 2DJR_A 2CT5_A.
Probab=83.09  E-value=0.92  Score=22.57  Aligned_cols=25  Identities=36%  Similarity=0.728  Sum_probs=14.5

Q ss_pred             CCCccCcccccccCC----chhHHHHHHH
Q psy12258        110 EKPHFCPVCNKMFRV----RSDMKRHLNT  134 (171)
Q Consensus       110 ~~~~~C~~C~~~f~~----~~~l~~H~~~  134 (171)
                      ....+|..|++.+..    .+.|.+|++.
T Consensus        14 ~~~a~C~~C~~~~~~~~~~ts~l~~HL~~   42 (45)
T PF02892_consen   14 KKKAKCKYCGKVIKYSSGGTSNLKRHLKK   42 (45)
T ss_dssp             SS-EEETTTTEE-----SSTHHHHHHHHH
T ss_pred             cCeEEeCCCCeEEeeCCCcHHHHHHhhhh
Confidence            445678888877765    3678888743


No 95 
>PF14353 CpXC:  CpXC protein
Probab=82.90  E-value=0.52  Score=29.60  Aligned_cols=47  Identities=32%  Similarity=0.533  Sum_probs=29.9

Q ss_pred             CCCccccccCChhh----------HHHHHHHcCCCCCeeCCccchhccCcccHHHhhh
Q psy12258          1 MCDTCGKSFFSSTA----------LKVHNRVHLGLKPYGCEVCGRHFRQWGDLKYHKA   48 (171)
Q Consensus         1 ~C~~C~~~f~~~~~----------l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~   48 (171)
                      .||.|+..|...-.          |+.-+. --.-..+.|+.||..|.-...+..|..
T Consensus         3 tCP~C~~~~~~~v~~~I~~~~~p~l~e~il-~g~l~~~~CP~Cg~~~~~~~p~lY~D~   59 (128)
T PF14353_consen    3 TCPHCGHEFEFEVWTSINADEDPELKEKIL-DGSLFSFTCPSCGHKFRLEYPLLYHDP   59 (128)
T ss_pred             CCCCCCCeeEEEEEeEEcCcCCHHHHHHHH-cCCcCEEECCCCCCceecCCCEEEEcC
Confidence            48889887654432          222222 111235889999999988888777765


No 96 
>smart00531 TFIIE Transcription initiation factor IIE.
Probab=82.51  E-value=1.2  Score=28.73  Aligned_cols=15  Identities=20%  Similarity=0.494  Sum_probs=8.8

Q ss_pred             CCCeeCCccchhccC
Q psy12258         25 LKPYGCEVCGRHFRQ   39 (171)
Q Consensus        25 ~~~~~C~~C~~~f~~   39 (171)
                      ...|.|+.|+..|..
T Consensus        97 ~~~Y~Cp~C~~~y~~  111 (147)
T smart00531       97 NAYYKCPNCQSKYTF  111 (147)
T ss_pred             CcEEECcCCCCEeeH
Confidence            345666666666654


No 97 
>TIGR02605 CxxC_CxxC_SSSS putative regulatory protein, FmdB family. This model represents a region of about 50 amino acids found in a number of small proteins in a wide range of bacteria. The region begins usually with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One member of this family is has been noted as a putative regulatory protein, designated FmdB (PubMed:8841393). Most members of this family have a C-terminal region containing highly degenerate sequence, such as SSTSESTKSSGSSGSSGSSESKASGSTEKSTSSTTAAAAV in Mycobacterium tuberculosis and VAVGGSAPAPSPAPRAGGGGGGCCGGGCCG in Streptomyces avermitilis. These low complexity regions, which are not included in the model, resemble low-complexity C-terminal regions of some heterocycle-containing bacteriocin precursors.
Probab=81.86  E-value=0.19  Score=26.08  Aligned_cols=11  Identities=36%  Similarity=1.086  Sum_probs=5.5

Q ss_pred             ccCccchhhcC
Q psy12258         85 YQCEFCHKAFR   95 (171)
Q Consensus        85 ~~C~~C~~~~~   95 (171)
                      |+|..|+..|.
T Consensus         6 y~C~~Cg~~fe   16 (52)
T TIGR02605         6 YRCTACGHRFE   16 (52)
T ss_pred             EEeCCCCCEeE
Confidence            44555555443


No 98 
>PF08274 PhnA_Zn_Ribbon:  PhnA Zinc-Ribbon ;  InterPro: IPR013987 The PhnA protein family includes the uncharacterised Escherichia coli protein PhnA and its homologues. The E. coli phnA gene is part of a large operon associated with alkylphosphonate uptake and carbon-phosphorus bond cleavage []. The protein is not related to the characterised phosphonoacetate hydrolase designated PhnA []. This entry represents the N-terminal domain of PhnA, which is predicted to form a zinc-ribbon.; PDB: 2AKL_A.
Probab=81.85  E-value=0.46  Score=21.67  Aligned_cols=24  Identities=21%  Similarity=0.742  Sum_probs=9.4

Q ss_pred             cCccchhhcCCHHHHHHHHHHhcCCCCccCccccc
Q psy12258         86 QCEFCHKAFRASSYLQNHRRIHTGEKPHFCPVCNK  120 (171)
Q Consensus        86 ~C~~C~~~~~~~~~l~~H~~~h~~~~~~~C~~C~~  120 (171)
                      +|+.|+..+..           .....+.|+.|+.
T Consensus         4 ~Cp~C~se~~y-----------~D~~~~vCp~C~~   27 (30)
T PF08274_consen    4 KCPLCGSEYTY-----------EDGELLVCPECGH   27 (30)
T ss_dssp             --TTT-----E-----------E-SSSEEETTTTE
T ss_pred             CCCCCCCccee-----------ccCCEEeCCcccc
Confidence            46666655544           3345566666664


No 99 
>PRK06266 transcription initiation factor E subunit alpha; Validated
Probab=81.60  E-value=0.89  Score=30.46  Aligned_cols=35  Identities=23%  Similarity=0.550  Sum_probs=25.8

Q ss_pred             CCCCccCccchhhcCCHHHHHHHHHHhcCCCCccCcccccccCC
Q psy12258         81 GERNYQCEFCHKAFRASSYLQNHRRIHTGEKPHFCPVCNKMFRV  124 (171)
Q Consensus        81 ~~~~~~C~~C~~~~~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~  124 (171)
                      ...-|.|+.|+..|+....+.         ..|.|+.||-....
T Consensus       114 ~~~~Y~Cp~C~~rytf~eA~~---------~~F~Cp~Cg~~L~~  148 (178)
T PRK06266        114 NNMFFFCPNCHIRFTFDEAME---------YGFRCPQCGEMLEE  148 (178)
T ss_pred             CCCEEECCCCCcEEeHHHHhh---------cCCcCCCCCCCCee
Confidence            345688999998887777653         35899999976553


No 100
>PRK06266 transcription initiation factor E subunit alpha; Validated
Probab=80.65  E-value=1  Score=30.17  Aligned_cols=14  Identities=21%  Similarity=0.292  Sum_probs=6.5

Q ss_pred             CeeCCccchhccCc
Q psy12258         27 PYGCEVCGRHFRQW   40 (171)
Q Consensus        27 ~~~C~~C~~~f~~~   40 (171)
                      -|.|+.|+..|+..
T Consensus       117 ~Y~Cp~C~~rytf~  130 (178)
T PRK06266        117 FFFCPNCHIRFTFD  130 (178)
T ss_pred             EEECCCCCcEEeHH
Confidence            34455555444433


No 101
>PRK00398 rpoP DNA-directed RNA polymerase subunit P; Provisional
Probab=79.54  E-value=0.41  Score=24.18  Aligned_cols=10  Identities=30%  Similarity=1.016  Sum_probs=5.3

Q ss_pred             ccCccchhhc
Q psy12258         85 YQCEFCHKAF   94 (171)
Q Consensus        85 ~~C~~C~~~~   94 (171)
                      |+|+.||..+
T Consensus         4 y~C~~CG~~~   13 (46)
T PRK00398          4 YKCARCGREV   13 (46)
T ss_pred             EECCCCCCEE
Confidence            4555555544


No 102
>smart00614 ZnF_BED BED zinc finger. DNA-binding domain in chromatin-boundary-element-binding proteins and transposases
Probab=79.18  E-value=1.5  Score=22.46  Aligned_cols=22  Identities=32%  Similarity=0.662  Sum_probs=14.6

Q ss_pred             ccCcccccccCCc-----hhHHHHHHH
Q psy12258        113 HFCPVCNKMFRVR-----SDMKRHLNT  134 (171)
Q Consensus       113 ~~C~~C~~~f~~~-----~~l~~H~~~  134 (171)
                      ..|..|++.+...     +.|.+|++.
T Consensus        19 a~C~~C~~~l~~~~~~gTs~L~rHl~~   45 (50)
T smart00614       19 AKCKYCGKKLSRSSKGGTSNLRRHLRR   45 (50)
T ss_pred             EEecCCCCEeeeCCCCCcHHHHHHHHh
Confidence            4677777776544     578888763


No 103
>PF04959 ARS2:  Arsenite-resistance protein 2;  InterPro: IPR007042 This entry represents Arsenite-resistance protein 2 (also known as Serrate RNA effector molecule homolog) which is thought to play a role in arsenite resistance [], although does not directly confer arsenite resistance but rather modulates arsenic sensitivity []. Arsenite is a carcinogenic compound which can act as a comutagen by inhibiting DNA repair. It is also involved in cell cycle progression at S phase. ; PDB: 3AX1_A.
Probab=77.95  E-value=0.94  Score=31.24  Aligned_cols=27  Identities=22%  Similarity=0.607  Sum_probs=17.1

Q ss_pred             CCccCcccccccCCchhHHHHHHHhcc
Q psy12258        111 KPHFCPVCNKMFRVRSDMKRHLNTHNV  137 (171)
Q Consensus       111 ~~~~C~~C~~~f~~~~~l~~H~~~h~~  137 (171)
                      ..|.|+.|+|.|.-..-.++|+..-|.
T Consensus        76 ~K~~C~lc~KlFkg~eFV~KHI~nKH~  102 (214)
T PF04959_consen   76 DKWRCPLCGKLFKGPEFVRKHIFNKHP  102 (214)
T ss_dssp             EEEEE-SSS-EESSHHHHHHHHHHH-H
T ss_pred             CEECCCCCCcccCChHHHHHHHhhcCH
Confidence            347788888888777777777765443


No 104
>COG1997 RPL43A Ribosomal protein L37AE/L43A [Translation, ribosomal structure and biogenesis]
Probab=77.47  E-value=0.82  Score=26.46  Aligned_cols=31  Identities=19%  Similarity=0.478  Sum_probs=20.3

Q ss_pred             CCccCccchhhcCCHHHHHHHHHHhcCCCCccCcccccccC
Q psy12258         83 RNYQCEFCHKAFRASSYLQNHRRIHTGEKPHFCPVCNKMFR  123 (171)
Q Consensus        83 ~~~~C~~C~~~~~~~~~l~~H~~~h~~~~~~~C~~C~~~f~  123 (171)
                      ..+.||.|++.-        +.  -.+...+.|..||..|.
T Consensus        34 ~~~~Cp~C~~~~--------Vk--R~a~GIW~C~kCg~~fA   64 (89)
T COG1997          34 AKHVCPFCGRTT--------VK--RIATGIWKCRKCGAKFA   64 (89)
T ss_pred             cCCcCCCCCCcc--------ee--eeccCeEEcCCCCCeec
Confidence            357888887541        11  12346688989988875


No 105
>PF09723 Zn-ribbon_8:  Zinc ribbon domain;  InterPro: IPR013429  This entry represents a region of about 41 amino acids found in a number of small proteins in a wide range of bacteria. The region usually begins with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One protein in this entry has been noted as a putative regulatory protein, designated FmdB []. Most proteins in this entry have a C-terminal region containing highly degenerate sequence.
Probab=77.11  E-value=1.3  Score=21.90  Aligned_cols=13  Identities=46%  Similarity=1.135  Sum_probs=7.2

Q ss_pred             eeCCccchhccCc
Q psy12258         28 YGCEVCGRHFRQW   40 (171)
Q Consensus        28 ~~C~~C~~~f~~~   40 (171)
                      |.|+.||..|...
T Consensus         6 y~C~~Cg~~fe~~   18 (42)
T PF09723_consen    6 YRCEECGHEFEVL   18 (42)
T ss_pred             EEeCCCCCEEEEE
Confidence            5566666665433


No 106
>PRK09678 DNA-binding transcriptional regulator; Provisional
Probab=77.03  E-value=0.42  Score=26.78  Aligned_cols=41  Identities=24%  Similarity=0.484  Sum_probs=24.8

Q ss_pred             ccCccchhhcCCHHHHHHHHHHhcCCCCccCc--ccccccCCchh
Q psy12258         85 YQCEFCHKAFRASSYLQNHRRIHTGEKPHFCP--VCNKMFRVRSD  127 (171)
Q Consensus        85 ~~C~~C~~~~~~~~~l~~H~~~h~~~~~~~C~--~C~~~f~~~~~  127 (171)
                      +.|+.||.......+-....  ...+.-+.|.  .||..|...-.
T Consensus         2 m~CP~Cg~~a~irtSr~~s~--~~~~~Y~qC~N~eCg~tF~t~es   44 (72)
T PRK09678          2 FHCPLCQHAAHARTSRYITD--TTKERYHQCQNVNCSATFITYES   44 (72)
T ss_pred             ccCCCCCCccEEEEChhcCh--hhheeeeecCCCCCCCEEEEEEE
Confidence            57888887653333322221  1445668897  89999875533


No 107
>COG1996 RPC10 DNA-directed RNA polymerase, subunit RPC10 (contains C4-type Zn-finger) [Transcription]
Probab=76.45  E-value=0.88  Score=23.37  Aligned_cols=10  Identities=30%  Similarity=1.016  Sum_probs=5.3

Q ss_pred             ccCccchhhc
Q psy12258         85 YQCEFCHKAF   94 (171)
Q Consensus        85 ~~C~~C~~~~   94 (171)
                      |+|..||+.|
T Consensus         7 Y~C~~Cg~~~   16 (49)
T COG1996           7 YKCARCGREV   16 (49)
T ss_pred             EEhhhcCCee
Confidence            4555555554


No 108
>PF05443 ROS_MUCR:  ROS/MUCR transcriptional regulator protein;  InterPro: IPR008807 This family consists of several ROS/MUCR transcriptional regulator proteins. The ros chromosomal gene is present in octopine and nopaline strains of Agrobacterium tumefaciens as well as in Rhizobium meliloti (Sinorhizobium meliloti). This gene encodes a 15.5 kDa protein that specifically represses the virC and virD operons in the virulence region of the Ti plasmid [] and is necessary for succinoglycan production []. S. meliloti can produce two types of acidic exopolysaccharides, succinoglycan and galactoglucan, that are interchangeable for infection of Medicago sativa (Alfalfa) nodules. MucR from S. meliloti acts as a transcriptional repressor that blocks the expression of the exp genes responsible for galactoglucan production therefore allowing the exclusive production of succinoglycan [].; GO: 0003677 DNA binding, 0008270 zinc ion binding, 0006355 regulation of transcription, DNA-dependent; PDB: 2JSP_A.
Probab=75.80  E-value=1.5  Score=27.83  Aligned_cols=25  Identities=40%  Similarity=0.671  Sum_probs=15.6

Q ss_pred             CCccCcccccccCCchhHHHHHHHhccC
Q psy12258        111 KPHFCPVCNKMFRVRSDMKRHLNTHNVD  138 (171)
Q Consensus       111 ~~~~C~~C~~~f~~~~~l~~H~~~h~~~  138 (171)
                      .-..|-+||+.|+.   |.+|++.||+-
T Consensus        71 d~i~clecGk~~k~---LkrHL~~~~gl   95 (132)
T PF05443_consen   71 DYIICLECGKKFKT---LKRHLRTHHGL   95 (132)
T ss_dssp             S-EE-TBT--EESB---HHHHHHHTT-S
T ss_pred             CeeEEccCCcccch---HHHHHHHccCC
Confidence            34679999998874   58999998543


No 109
>COG4530 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=75.54  E-value=1.4  Score=26.68  Aligned_cols=27  Identities=22%  Similarity=0.402  Sum_probs=15.9

Q ss_pred             eCCccchhccCcccHHHhhhhcCCCCCcccccchhhhcc
Q psy12258         29 GCEVCGRHFRQWGDLKYHKASLHSDVKAFQCEYCGKDFA   67 (171)
Q Consensus        29 ~C~~C~~~f~~~~~l~~H~~~~h~~~~~~~C~~C~~~~~   67 (171)
                      +|+.|++.|-.   |         ...|..|++|+++|+
T Consensus        11 idPetg~KFYD---L---------NrdPiVsPytG~s~P   37 (129)
T COG4530          11 IDPETGKKFYD---L---------NRDPIVSPYTGKSYP   37 (129)
T ss_pred             cCccccchhhc---c---------CCCccccCcccccch
Confidence            56677766622   1         134567777777764


No 110
>PF13878 zf-C2H2_3:  zinc-finger of acetyl-transferase ESCO
Probab=74.67  E-value=3.5  Score=20.26  Aligned_cols=22  Identities=36%  Similarity=0.733  Sum_probs=13.3

Q ss_pred             CCCccccccC--ChhhHHHHHHHc
Q psy12258          1 MCDTCGKSFF--SSTALKVHNRVH   22 (171)
Q Consensus         1 ~C~~C~~~f~--~~~~l~~H~~~h   22 (171)
                      +|+.|+..|.  ...+-..|.+.|
T Consensus        15 ~C~~CgM~Y~~~~~eD~~~H~~yH   38 (41)
T PF13878_consen   15 TCPTCGMLYSPGSPEDEKLHKKYH   38 (41)
T ss_pred             CCCCCCCEECCCCHHHHHHHHHHH
Confidence            4777776653  455566666554


No 111
>KOG2785|consensus
Probab=74.36  E-value=4  Score=30.59  Aligned_cols=51  Identities=22%  Similarity=0.402  Sum_probs=33.5

Q ss_pred             CccCccchhhcCCHHHHHHHHHHhcCC-----------------------CCccCcccc---cccCCchhHHHHHHH
Q psy12258         84 NYQCEFCHKAFRASSYLQNHRRIHTGE-----------------------KPHFCPVCN---KMFRVRSDMKRHLNT  134 (171)
Q Consensus        84 ~~~C~~C~~~~~~~~~l~~H~~~h~~~-----------------------~~~~C~~C~---~~f~~~~~l~~H~~~  134 (171)
                      |-.|-.|+..+........|+..+|+-                       .-+.|-.|+   +.|.+....++||+.
T Consensus       166 Pt~CLfC~~~~k~~e~~~~HM~~~HgffIPdreYL~D~~GLl~YLgeKV~~~~~CL~CN~~~~~f~sleavr~HM~~  242 (390)
T KOG2785|consen  166 PTDCLFCDKKSKSLEENLKHMFKEHGFFIPDREYLTDEKGLLKYLGEKVGIGFICLFCNELGRPFSSLEAVRAHMRD  242 (390)
T ss_pred             CcceeecCCCcccHHHHHHHHhhccCCcCCchHhhhchhHHHHHHHHHhccCceEEEeccccCcccccHHHHHHHhh
Confidence            345556666666665555665555441                       236788888   888888899999853


No 112
>PF03604 DNA_RNApol_7kD:  DNA directed RNA polymerase, 7 kDa subunit;  InterPro: IPR006591 DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Each class of RNA polymerase is assembled from 9 to 15 different polypeptides. Rbp10 (RNA polymerase CX) is a domain found in RNA polymerase subunit 10; present in RNA polymerase I, II and III.; GO: 0003677 DNA binding, 0003899 DNA-directed RNA polymerase activity, 0006351 transcription, DNA-dependent; PDB: 2PMZ_Z 3HKZ_X 2NVX_L 3S1Q_L 2JA6_L 3S17_L 3HOW_L 3HOV_L 3PO2_L 3HOZ_L ....
Probab=73.59  E-value=0.95  Score=21.00  Aligned_cols=6  Identities=50%  Similarity=1.436  Sum_probs=2.2

Q ss_pred             cCcccc
Q psy12258        114 FCPVCN  119 (171)
Q Consensus       114 ~C~~C~  119 (171)
                      +|+.||
T Consensus        19 rC~~CG   24 (32)
T PF03604_consen   19 RCPECG   24 (32)
T ss_dssp             SBSSSS
T ss_pred             ECCcCC
Confidence            333333


No 113
>PF12907 zf-met2:  Zinc-binding
Probab=72.80  E-value=1.7  Score=21.32  Aligned_cols=10  Identities=40%  Similarity=0.511  Sum_probs=4.3

Q ss_pred             HHHhhhhcCC
Q psy12258         43 LKYHKASLHS   52 (171)
Q Consensus        43 l~~H~~~~h~   52 (171)
                      |..|...-|+
T Consensus        20 L~eH~enKHp   29 (40)
T PF12907_consen   20 LKEHAENKHP   29 (40)
T ss_pred             HHHHHHccCC
Confidence            4444443343


No 114
>PF05191 ADK_lid:  Adenylate kinase, active site lid;  InterPro: IPR007862 Adenylate kinases (ADK; 2.7.4.3 from EC) are phosphotransferases that catalyse the Mg-dependent reversible conversion of ATP and AMP to two molecules of ADP, an essential reaction for many processes in living cells. In large variants of adenylate kinase, the AMP and ATP substrates are buried in a domain that undergoes conformational changes from an open to a closed state when bound to substrate; the ligand is then contained within a highly specific environment required for catalysis. Adenylate kinase is a 3-domain protein consisting of a large central CORE domain flanked by a LID domain on one side and the AMP-binding NMPbind domain on the other []. The LID domain binds ATP and covers the phosphates at the active site. The substrates first bind the CORE domain, followed by closure of the active site by the LID and NMPbind domains. Comparisons of adenylate kinases have revealed a particular divergence in the active site lid. In some organisms, particularly the Gram-positive bacteria, residues in the lid domain have been mutated to cysteines and these cysteine residues (two CX(n)C motifs) are responsible for the binding of a zinc ion. The bound zinc ion in the lid domain is clearly structurally homologous to Zinc-finger domains. However, it is unclear whether the adenylate kinase lid is a novel zinc-finger DNA/RNA binding domain, or that the lid bound zinc serves a purely structural function [].; GO: 0004017 adenylate kinase activity; PDB: 3BE4_A 2OSB_B 2ORI_A 2EU8_A 3DL0_A 1P3J_A 2QAJ_A 2OO7_A 2P3S_A 3DKV_A ....
Probab=71.94  E-value=0.75  Score=21.96  Aligned_cols=8  Identities=25%  Similarity=0.754  Sum_probs=3.5

Q ss_pred             ccCccccc
Q psy12258        113 HFCPVCNK  120 (171)
Q Consensus       113 ~~C~~C~~  120 (171)
                      -.|..||-
T Consensus        22 ~~Cd~cg~   29 (36)
T PF05191_consen   22 GVCDNCGG   29 (36)
T ss_dssp             TBCTTTTE
T ss_pred             CccCCCCC
Confidence            34444443


No 115
>COG3357 Predicted transcriptional regulator containing an HTH domain fused to a Zn-ribbon [Transcription]
Probab=69.06  E-value=2.2  Score=24.95  Aligned_cols=14  Identities=36%  Similarity=0.731  Sum_probs=7.9

Q ss_pred             CCccCccchhhcCC
Q psy12258         83 RNYQCEFCHKAFRA   96 (171)
Q Consensus        83 ~~~~C~~C~~~~~~   96 (171)
                      .|-+|..||+.|..
T Consensus        57 ~Pa~CkkCGfef~~   70 (97)
T COG3357          57 RPARCKKCGFEFRD   70 (97)
T ss_pred             cChhhcccCccccc
Confidence            34556666666644


No 116
>PF01927 Mut7-C:  Mut7-C RNAse domain;  InterPro: IPR002782 This prokaryotic family of proteins have no known function. The proteins contain four conserved cysteines that may be involved in metal binding or disulphide bridges.
Probab=66.70  E-value=2.9  Score=27.01  Aligned_cols=47  Identities=23%  Similarity=0.396  Sum_probs=27.2

Q ss_pred             ccCccchhhcCCHHHHHH--HHH---HhcCCCCccCcccccccCCchhHHHH
Q psy12258         85 YQCEFCHKAFRASSYLQN--HRR---IHTGEKPHFCPVCNKMFRVRSDMKRH  131 (171)
Q Consensus        85 ~~C~~C~~~~~~~~~l~~--H~~---~h~~~~~~~C~~C~~~f~~~~~l~~H  131 (171)
                      -+|+.|+..+...+.-..  -+.   .......+.|+.||+.|-.-+...+-
T Consensus        92 sRC~~CN~~L~~v~~~~v~~~vp~~v~~~~~~f~~C~~C~kiyW~GsH~~~~  143 (147)
T PF01927_consen   92 SRCPKCNGPLRPVSKEEVKDRVPPYVYETYDEFWRCPGCGKIYWEGSHWRRM  143 (147)
T ss_pred             CccCCCCcEeeechhhccccccCccccccCCeEEECCCCCCEecccccHHHH
Confidence            589999876644322111  010   01224468999999999766555443


No 117
>PF13453 zf-TFIIB:  Transcription factor zinc-finger
Probab=66.48  E-value=2  Score=20.98  Aligned_cols=16  Identities=25%  Similarity=0.357  Sum_probs=7.2

Q ss_pred             ccccchhhhccChHHH
Q psy12258         57 FQCEYCGKDFARKYSL   72 (171)
Q Consensus        57 ~~C~~C~~~~~~~~~l   72 (171)
                      ..|+.|+-.+.+...|
T Consensus        20 d~C~~C~G~W~d~~el   35 (41)
T PF13453_consen   20 DVCPSCGGIWFDAGEL   35 (41)
T ss_pred             EECCCCCeEEccHHHH
Confidence            3444444444444433


No 118
>PF07754 DUF1610:  Domain of unknown function (DUF1610);  InterPro: IPR011668 This domain is found in archaeal species. It is likely to bind zinc via its four well-conserved cysteine residues.
Probab=66.24  E-value=2.4  Score=18.22  Aligned_cols=8  Identities=50%  Similarity=1.352  Sum_probs=4.4

Q ss_pred             CccCcccc
Q psy12258        112 PHFCPVCN  119 (171)
Q Consensus       112 ~~~C~~C~  119 (171)
                      +|.|+.||
T Consensus        16 ~f~CPnCG   23 (24)
T PF07754_consen   16 PFPCPNCG   23 (24)
T ss_pred             eEeCCCCC
Confidence            45555555


No 119
>KOG2807|consensus
Probab=65.00  E-value=9.1  Score=28.20  Aligned_cols=27  Identities=26%  Similarity=0.461  Sum_probs=21.1

Q ss_pred             CccCcccccccCCchhHHHHHHHhccC
Q psy12258        112 PHFCPVCNKMFRVRSDMKRHLNTHNVD  138 (171)
Q Consensus       112 ~~~C~~C~~~f~~~~~l~~H~~~h~~~  138 (171)
                      .|.|..|...|-..-+...|-..|.-.
T Consensus       345 ~y~C~~Ck~~FCldCDv~iHesLh~Cp  371 (378)
T KOG2807|consen  345 RYRCESCKNVFCLDCDVFIHESLHNCP  371 (378)
T ss_pred             cEEchhccceeeccchHHHHhhhhcCC
Confidence            488888988888888888887777543


No 120
>KOG2593|consensus
Probab=64.33  E-value=7  Score=29.87  Aligned_cols=39  Identities=23%  Similarity=0.468  Sum_probs=26.8

Q ss_pred             cCCCCccCccchhhcCCHHHHHHHHHHhcCCCCccCcccccc
Q psy12258         80 TGERNYQCEFCHKAFRASSYLQNHRRIHTGEKPHFCPVCNKM  121 (171)
Q Consensus        80 ~~~~~~~C~~C~~~~~~~~~l~~H~~~h~~~~~~~C~~C~~~  121 (171)
                      +...-|.||.|.+.|+....++-   .......|.|..|+-.
T Consensus       124 t~~~~Y~Cp~C~kkyt~Lea~~L---~~~~~~~F~C~~C~ge  162 (436)
T KOG2593|consen  124 TNVAGYVCPNCQKKYTSLEALQL---LDNETGEFHCENCGGE  162 (436)
T ss_pred             cccccccCCccccchhhhHHHHh---hcccCceEEEecCCCc
Confidence            34567999999998877766542   2333456889888844


No 121
>PF12760 Zn_Tnp_IS1595:  Transposase zinc-ribbon domain;  InterPro: IPR024442 This zinc binding domain is found in a range of transposase proteins such as ISSPO8, ISSOD11, ISRSSP2 etc. It may be a zinc-binding beta ribbon domain that could bind DNA.
Probab=64.30  E-value=7.8  Score=19.44  Aligned_cols=21  Identities=14%  Similarity=0.172  Sum_probs=12.0

Q ss_pred             HHHHHHcCCCCCeeCCccchh
Q psy12258         16 KVHNRVHLGLKPYGCEVCGRH   36 (171)
Q Consensus        16 ~~H~~~h~~~~~~~C~~C~~~   36 (171)
                      ..++....-...+.|+.||..
T Consensus         7 ~~~l~~~RW~~g~~CP~Cg~~   27 (46)
T PF12760_consen    7 REYLEEIRWPDGFVCPHCGST   27 (46)
T ss_pred             HHHHHHhcCCCCCCCCCCCCe
Confidence            344444444555677777754


No 122
>KOG2186|consensus
Probab=64.21  E-value=4.4  Score=28.58  Aligned_cols=48  Identities=23%  Similarity=0.519  Sum_probs=38.4

Q ss_pred             cccccchhhhccChHHHHHHHhhhcCCCCccCccchhhcCCHHHHHHHHHH
Q psy12258         56 AFQCEYCGKDFARKYSLVVHRRIHTGERNYQCEFCHKAFRASSYLQNHRRI  106 (171)
Q Consensus        56 ~~~C~~C~~~~~~~~~l~~h~~~~~~~~~~~C~~C~~~~~~~~~l~~H~~~  106 (171)
                      -|.|..||.+..-. .+..|+...++ ..|.|-.|+..|.. .++..|..-
T Consensus         3 ~FtCnvCgEsvKKp-~vekH~srCrn-~~fSCIDC~k~F~~-~sYknH~kC   50 (276)
T KOG2186|consen    3 FFTCNVCGESVKKP-QVEKHMSRCRN-AYFSCIDCGKTFER-VSYKNHTKC   50 (276)
T ss_pred             EEehhhhhhhcccc-chHHHHHhccC-CeeEEeeccccccc-chhhhhhhh
Confidence            37899999988765 56679888877 67999999999987 677788653


No 123
>PRK04023 DNA polymerase II large subunit; Validated
Probab=64.18  E-value=7  Score=33.35  Aligned_cols=49  Identities=24%  Similarity=0.629  Sum_probs=29.6

Q ss_pred             CeeCCccchhccCcccHHHhhhhcCCCCCcccccchhhhccChHHHHHHHhhhcCCCCccCccchhhcCCHHHHHHHHHH
Q psy12258         27 PYGCEVCGRHFRQWGDLKYHKASLHSDVKAFQCEYCGKDFARKYSLVVHRRIHTGERNYQCEFCHKAFRASSYLQNHRRI  106 (171)
Q Consensus        27 ~~~C~~C~~~f~~~~~l~~H~~~~h~~~~~~~C~~C~~~~~~~~~l~~h~~~~~~~~~~~C~~C~~~~~~~~~l~~H~~~  106 (171)
                      ...|+.||...                 ..+.|+.||..               ....+.|+.|+...            
T Consensus       626 ~RfCpsCG~~t-----------------~~frCP~CG~~---------------Te~i~fCP~CG~~~------------  661 (1121)
T PRK04023        626 RRKCPSCGKET-----------------FYRRCPFCGTH---------------TEPVYRCPRCGIEV------------  661 (1121)
T ss_pred             CccCCCCCCcC-----------------CcccCCCCCCC---------------CCcceeCccccCcC------------
Confidence            45788888762                 12568888775               12346777775332            


Q ss_pred             hcCCCCccCcccccccC
Q psy12258        107 HTGEKPHFCPVCNKMFR  123 (171)
Q Consensus       107 h~~~~~~~C~~C~~~f~  123 (171)
                          .++.|+.||..-.
T Consensus       662 ----~~y~CPKCG~El~  674 (1121)
T PRK04023        662 ----EEDECEKCGREPT  674 (1121)
T ss_pred             ----CCCcCCCCCCCCC
Confidence                2366777775543


No 124
>COG4957 Predicted transcriptional regulator [Transcription]
Probab=63.76  E-value=4.3  Score=25.68  Aligned_cols=21  Identities=48%  Similarity=0.744  Sum_probs=11.4

Q ss_pred             CCccccccCChhhHHHHHHHcCCC
Q psy12258          2 CDTCGKSFFSSTALKVHNRVHLGL   25 (171)
Q Consensus         2 C~~C~~~f~~~~~l~~H~~~h~~~   25 (171)
                      |-++|+.|   .+|.+|+.+|.+-
T Consensus        79 cLEDGkkf---KSLKRHL~t~~gm   99 (148)
T COG4957          79 CLEDGKKF---KSLKRHLTTHYGL   99 (148)
T ss_pred             EeccCcch---HHHHHHHhcccCC
Confidence            44555555   5556666665543


No 125
>COG0068 HypF Hydrogenase maturation factor [Posttranslational modification, protein turnover, chaperones]
Probab=63.54  E-value=1.4  Score=35.66  Aligned_cols=60  Identities=25%  Similarity=0.519  Sum_probs=37.4

Q ss_pred             cccchhhhccChHHHHHHHhhhcCCCCccCccchhhcCCHHHHHHHHHHhcCCCCccCcccccccC
Q psy12258         58 QCEYCGKDFARKYSLVVHRRIHTGERNYQCEFCHKAFRASSYLQNHRRIHTGEKPHFCPVCNKMFR  123 (171)
Q Consensus        58 ~C~~C~~~~~~~~~l~~h~~~~~~~~~~~C~~C~~~~~~~~~l~~H~~~h~~~~~~~C~~C~~~f~  123 (171)
                      .|..||-.|+-...|.--+..-+-..--.|+.|.+.|.....-+-|      .+|.-|+.||-...
T Consensus       125 ~CT~CGPRfTIi~alPYDR~nTsM~~F~lC~~C~~EY~dP~nRRfH------AQp~aCp~CGP~~~  184 (750)
T COG0068         125 NCTNCGPRFTIIEALPYDRENTSMADFPLCPFCDKEYKDPLNRRFH------AQPIACPKCGPHLF  184 (750)
T ss_pred             ccCCCCcceeeeccCCCCcccCccccCcCCHHHHHHhcCccccccc------cccccCcccCCCeE
Confidence            5788887777654443322222222223688888888887766555      45678888986543


No 126
>PF13240 zinc_ribbon_2:  zinc-ribbon domain
Probab=63.35  E-value=3.2  Score=17.54  Aligned_cols=7  Identities=43%  Similarity=1.388  Sum_probs=3.8

Q ss_pred             CCccccc
Q psy12258          2 CDTCGKS    8 (171)
Q Consensus         2 C~~C~~~    8 (171)
                      |+.|+..
T Consensus         2 Cp~CG~~    8 (23)
T PF13240_consen    2 CPNCGAE    8 (23)
T ss_pred             CcccCCC
Confidence            5555554


No 127
>KOG1280|consensus
Probab=63.19  E-value=6.3  Score=29.20  Aligned_cols=27  Identities=22%  Similarity=0.343  Sum_probs=17.5

Q ss_pred             CeeCCccchhccCcccHHHhhhhcCCC
Q psy12258         27 PYGCEVCGRHFRQWGDLKYHKASLHSD   53 (171)
Q Consensus        27 ~~~C~~C~~~f~~~~~l~~H~~~~h~~   53 (171)
                      .|.|++|+.+=.....|..|....|..
T Consensus        79 SftCPyC~~~Gfte~~f~~Hv~s~Hpd  105 (381)
T KOG1280|consen   79 SFTCPYCGIMGFTERQFGTHVLSQHPE  105 (381)
T ss_pred             cccCCcccccccchhHHHHHhhhcCcc
Confidence            467777776666666666676666653


No 128
>KOG2907|consensus
Probab=62.48  E-value=4  Score=24.92  Aligned_cols=35  Identities=29%  Similarity=0.729  Sum_probs=19.5

Q ss_pred             eeCCccchhccCcccHHHhhhhcCCC----CCcccccchhhhcc
Q psy12258         28 YGCEVCGRHFRQWGDLKYHKASLHSD----VKAFQCEYCGKDFA   67 (171)
Q Consensus        28 ~~C~~C~~~f~~~~~l~~H~~~~h~~----~~~~~C~~C~~~~~   67 (171)
                      ..|+.||--     .|..|-++..+.    ..-|.|+.|+.-|.
T Consensus        75 ~kCpkCghe-----~m~Y~T~QlRSADEGQTVFYTC~kC~~k~~  113 (116)
T KOG2907|consen   75 HKCPKCGHE-----EMSYHTLQLRSADEGQTVFYTCPKCKYKFT  113 (116)
T ss_pred             ccCcccCCc-----hhhhhhhhcccccCCceEEEEcCccceeee
Confidence            568888743     344443332221    22378888887665


No 129
>PF13824 zf-Mss51:  Zinc-finger of mitochondrial splicing suppressor 51
Probab=62.28  E-value=6.7  Score=20.71  Aligned_cols=15  Identities=20%  Similarity=0.476  Sum_probs=9.4

Q ss_pred             CCCCeeCCccchhcc
Q psy12258         24 GLKPYGCEVCGRHFR   38 (171)
Q Consensus        24 ~~~~~~C~~C~~~f~   38 (171)
                      +...|.|+.||..+.
T Consensus        11 ~~v~~~Cp~cGipth   25 (55)
T PF13824_consen   11 AHVNFECPDCGIPTH   25 (55)
T ss_pred             cccCCcCCCCCCcCc
Confidence            345577777776653


No 130
>TIGR01206 lysW lysine biosynthesis protein LysW. This very small, poorly characterized protein has been shown essential in Thermus thermophilus for an unusual pathway of Lys biosynthesis from aspartate by way of alpha-aminoadipate (AAA) rather than diaminopimelate. It is found also in Deinococcus radiodurans and Pyrococcus horikoshii, which appear to share the AAA pathway.
Probab=61.75  E-value=1.8  Score=22.76  Aligned_cols=31  Identities=13%  Similarity=0.344  Sum_probs=16.0

Q ss_pred             ccCccchhhcCCHHHHHHHHHHhcCCCCccCcccccccC
Q psy12258         85 YQCEFCHKAFRASSYLQNHRRIHTGEKPHFCPVCNKMFR  123 (171)
Q Consensus        85 ~~C~~C~~~~~~~~~l~~H~~~h~~~~~~~C~~C~~~f~  123 (171)
                      ++|+.|+..+.-....        ......|+.||..+.
T Consensus         3 ~~CP~CG~~iev~~~~--------~GeiV~Cp~CGaele   33 (54)
T TIGR01206         3 FECPDCGAEIELENPE--------LGELVICDECGAELE   33 (54)
T ss_pred             cCCCCCCCEEecCCCc--------cCCEEeCCCCCCEEE
Confidence            4677777655332221        122456777775543


No 131
>PF00301 Rubredoxin:  Rubredoxin;  InterPro: IPR004039 Rubredoxin is a low molecular weight iron-containing bacterial protein involved in electron transfer [, ], sometimes replacing ferredoxin as an electron carrier []. The 3-D structures of a number of rubredoxins have been solved [, ]. The fold belongs to the alpha+beta class, with 2 alpha-helices and 2-3 beta-strands. Its active site contains an iron ion which is co-ordinated by the sulphurs of four conserved cysteine residues forming an almost regular tetrahedron. The conserved cysteines reside on two loops, which are the most conserved regions of the protein. In addition, a ring of acidic residues in the proximity of the [Fe(Cys)4] centre is also well-conserved []. ; GO: 0009055 electron carrier activity, 0046872 metal ion binding; PDB: 2RDV_C 1RDV_A 1S24_A 1T9O_B 1B2J_A 1SMW_A 2PVE_B 1BFY_A 1T9P_C 1C09_C ....
Probab=61.25  E-value=4.6  Score=20.55  Aligned_cols=15  Identities=33%  Similarity=0.773  Sum_probs=8.6

Q ss_pred             eeCCccchhccCccc
Q psy12258         28 YGCEVCGRHFRQWGD   42 (171)
Q Consensus        28 ~~C~~C~~~f~~~~~   42 (171)
                      |.|..|+..+.....
T Consensus         2 y~C~~CgyvYd~~~G   16 (47)
T PF00301_consen    2 YQCPVCGYVYDPEKG   16 (47)
T ss_dssp             EEETTTSBEEETTTB
T ss_pred             cCCCCCCEEEcCCcC
Confidence            556666666555443


No 132
>PF14446 Prok-RING_1:  Prokaryotic RING finger family 1
Probab=60.35  E-value=1.6  Score=22.92  Aligned_cols=9  Identities=56%  Similarity=1.327  Sum_probs=4.4

Q ss_pred             CCccccccC
Q psy12258          2 CDTCGKSFF   10 (171)
Q Consensus         2 C~~C~~~f~   10 (171)
                      |+.|+..|.
T Consensus         8 C~~Cg~~~~   16 (54)
T PF14446_consen    8 CPVCGKKFK   16 (54)
T ss_pred             ChhhCCccc
Confidence            455555543


No 133
>COG1656 Uncharacterized conserved protein [Function unknown]
Probab=59.64  E-value=9.3  Score=25.20  Aligned_cols=49  Identities=20%  Similarity=0.402  Sum_probs=26.9

Q ss_pred             ccCccchhhcCCHHHH--HHHHH--H-hcCCCCccCcccccccCCchhHHHHHH
Q psy12258         85 YQCEFCHKAFRASSYL--QNHRR--I-HTGEKPHFCPVCNKMFRVRSDMKRHLN  133 (171)
Q Consensus        85 ~~C~~C~~~~~~~~~l--~~H~~--~-h~~~~~~~C~~C~~~f~~~~~l~~H~~  133 (171)
                      -+|+.|+....-.+.=  ..-+.  + --....|.|+.||+.|-.-+....-.+
T Consensus        98 ~RCp~CN~~L~~vs~eev~~~Vp~~~~~~~~~f~~C~~CgkiYW~GsHw~~m~~  151 (165)
T COG1656          98 SRCPECNGELEKVSREEVKEKVPEKVYRNYEEFYRCPKCGKIYWKGSHWRRMVE  151 (165)
T ss_pred             ccCcccCCEeccCcHHHHhhccchhhhhcccceeECCCCcccccCchHHHHHHH
Confidence            4789998765332221  10000  0 011345889999999976665544433


No 134
>KOG2593|consensus
Probab=59.63  E-value=6.7  Score=29.98  Aligned_cols=42  Identities=21%  Similarity=0.634  Sum_probs=27.5

Q ss_pred             cCCCCCeeCCccchhccCcccHHHhhhhcCCCCCcccccchhhhcc
Q psy12258         22 HLGLKPYGCEVCGRHFRQWGDLKYHKASLHSDVKAFQCEYCGKDFA   67 (171)
Q Consensus        22 h~~~~~~~C~~C~~~f~~~~~l~~H~~~~h~~~~~~~C~~C~~~~~   67 (171)
                      -.....|.|+.|.+.|.+...+..-    -...-.|.|..|+....
T Consensus       123 ~t~~~~Y~Cp~C~kkyt~Lea~~L~----~~~~~~F~C~~C~gelv  164 (436)
T KOG2593|consen  123 DTNVAGYVCPNCQKKYTSLEALQLL----DNETGEFHCENCGGELV  164 (436)
T ss_pred             ccccccccCCccccchhhhHHHHhh----cccCceEEEecCCCchh
Confidence            3445679999999998776665432    22244688988886543


No 135
>PF15135 UPF0515:  Uncharacterised protein UPF0515
Probab=59.29  E-value=8.7  Score=27.11  Aligned_cols=27  Identities=15%  Similarity=0.588  Sum_probs=15.8

Q ss_pred             ChhhHHHHHHHcCCC-----CCeeCCccchhc
Q psy12258         11 SSTALKVHNRVHLGL-----KPYGCEVCGRHF   37 (171)
Q Consensus        11 ~~~~l~~H~~~h~~~-----~~~~C~~C~~~f   37 (171)
                      +..+|+.....+...     ..|.|..|....
T Consensus        91 Te~Nlrm~d~a~~~~ip~~drqFaC~~Cd~~W  122 (278)
T PF15135_consen   91 TEENLRMFDDAQENLIPSVDRQFACSSCDHMW  122 (278)
T ss_pred             hHHHHHHhhhhhhccccccceeeeccccchHH
Confidence            344555554444333     678898887654


No 136
>PRK03824 hypA hydrogenase nickel incorporation protein; Provisional
Probab=58.56  E-value=2.7  Score=26.76  Aligned_cols=11  Identities=27%  Similarity=1.220  Sum_probs=5.3

Q ss_pred             ccccchhhhcc
Q psy12258         57 FQCEYCGKDFA   67 (171)
Q Consensus        57 ~~C~~C~~~~~   67 (171)
                      +.|..|+..|.
T Consensus        71 ~~C~~CG~~~~   81 (135)
T PRK03824         71 LKCRNCGNEWS   81 (135)
T ss_pred             EECCCCCCEEe
Confidence            44555554443


No 137
>KOG4167|consensus
Probab=58.44  E-value=2.3  Score=34.62  Aligned_cols=23  Identities=35%  Similarity=0.767  Sum_probs=19.2

Q ss_pred             CCccccccCChhhHHHHHHHcCC
Q psy12258          2 CDTCGKSFFSSTALKVHNRVHLG   24 (171)
Q Consensus         2 C~~C~~~f~~~~~l~~H~~~h~~   24 (171)
                      |.+|+++|....++..||+.|..
T Consensus       795 CreC~kvF~KiKSrNAHMK~Hr~  817 (907)
T KOG4167|consen  795 CRECGKVFFKIKSRNAHMKTHRQ  817 (907)
T ss_pred             hHHHHHHHHHHhhhhHHHHHHHH
Confidence            77888898888888888888854


No 138
>COG2331 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=58.27  E-value=5.8  Score=22.37  Aligned_cols=10  Identities=50%  Similarity=1.414  Sum_probs=5.3

Q ss_pred             eeCCccchhc
Q psy12258         28 YGCEVCGRHF   37 (171)
Q Consensus        28 ~~C~~C~~~f   37 (171)
                      |.|..|+..|
T Consensus        13 Y~c~~cg~~~   22 (82)
T COG2331          13 YECTECGNRF   22 (82)
T ss_pred             EeecccchHH
Confidence            4555555544


No 139
>KOG3408|consensus
Probab=57.94  E-value=5.3  Score=24.77  Aligned_cols=23  Identities=30%  Similarity=0.426  Sum_probs=15.9

Q ss_pred             CCeeCCccchhccCcccHHHhhh
Q psy12258         26 KPYGCEVCGRHFRQWGDLKYHKA   48 (171)
Q Consensus        26 ~~~~C~~C~~~f~~~~~l~~H~~   48 (171)
                      .+|-|-.|.+-|.+...|..|.+
T Consensus        56 GqfyCi~CaRyFi~~~~l~~H~k   78 (129)
T KOG3408|consen   56 GQFYCIECARYFIDAKALKTHFK   78 (129)
T ss_pred             ceeehhhhhhhhcchHHHHHHHh
Confidence            44667777777777777777765


No 140
>TIGR00244 transcriptional regulator NrdR. Members of this almost entirely bacterial family contain an ATP cone domain (PFAM:PF03477). There is never more than one member per genome. Common gene symbols given include nrdR, ybaD, ribX and ytcG. The member from Streptomyces coelicolor is found upstream in the operon of the class II oxygen-independent ribonucleotide reductase gene nrdJ and was shown to repress nrdJ expression. Many members of this family are found near genes for riboflavin biosynthesis in Gram-negative bacteria, suggesting a role in that pathway. However, a phylogenetic profiling study associates members of this family with the presence of a palindromic signal with consensus acaCwAtATaTwGtgt, termed the NrdR-box, an upstream element for most operons for ribonucleotide reductase of all three classes in bacterial genomes.
Probab=57.63  E-value=1.4  Score=28.29  Aligned_cols=13  Identities=23%  Similarity=0.508  Sum_probs=7.0

Q ss_pred             ccCcccccccCCc
Q psy12258        113 HFCPVCNKMFRVR  125 (171)
Q Consensus       113 ~~C~~C~~~f~~~  125 (171)
                      -.|..||+.|++.
T Consensus        29 ReC~~C~~RFTTy   41 (147)
T TIGR00244        29 RECLECHERFTTF   41 (147)
T ss_pred             ccCCccCCcccee
Confidence            3455555555544


No 141
>PF15269 zf-C2H2_7:  Zinc-finger
Probab=57.15  E-value=6.9  Score=19.56  Aligned_cols=22  Identities=18%  Similarity=0.271  Sum_probs=17.1

Q ss_pred             ccCcccccccCCchhHHHHHHH
Q psy12258        113 HFCPVCNKMFRVRSDMKRHLNT  134 (171)
Q Consensus       113 ~~C~~C~~~f~~~~~l~~H~~~  134 (171)
                      |+|-.|......++.|..||+-
T Consensus        21 ykcfqcpftc~~kshl~nhmky   42 (54)
T PF15269_consen   21 YKCFQCPFTCNEKSHLFNHMKY   42 (54)
T ss_pred             ceeecCCcccchHHHHHHHHHH
Confidence            6777788777788888888764


No 142
>COG5151 SSL1 RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, subunit SSL1 [Transcription / DNA replication, recombination, and repair]
Probab=57.09  E-value=16  Score=26.84  Aligned_cols=80  Identities=23%  Similarity=0.382  Sum_probs=45.3

Q ss_pred             CCeeCCccchhccCcccHHHhhhhcCC----CC-------CcccccchhhhccChHHHHHHHhhhcCCCCccCccchhhc
Q psy12258         26 KPYGCEVCGRHFRQWGDLKYHKASLHS----DV-------KAFQCEYCGKDFARKYSLVVHRRIHTGERNYQCEFCHKAF   94 (171)
Q Consensus        26 ~~~~C~~C~~~f~~~~~l~~H~~~~h~----~~-------~~~~C~~C~~~~~~~~~l~~h~~~~~~~~~~~C~~C~~~~   94 (171)
                      -|..|+.|.-..-....|.+-.....+    .+       +.--|-.|...|+-...-.  .-..+..-.|.|+.|...|
T Consensus       321 LPi~CP~Csl~LilsthLarSyhhL~PLk~f~E~p~~~~~ks~~Cf~CQ~~fp~~~~~~--~~~~~ss~rY~Ce~CK~~F  398 (421)
T COG5151         321 LPISCPICSLQLILSTHLARSYHHLYPLKPFVEKPEGTNPKSTHCFVCQGPFPKPPVSP--FDESTSSGRYQCELCKSTF  398 (421)
T ss_pred             CCccCcchhHHHHHHHHHHHHHHhhccCcccccccCCCCCCCccceeccCCCCCCCCCc--ccccccccceechhhhhhh
Confidence            356788888777666666554431111    01       1123667777666432100  0111223468899998888


Q ss_pred             CCHHHHHHHHHHh
Q psy12258         95 RASSYLQNHRRIH  107 (171)
Q Consensus        95 ~~~~~l~~H~~~h  107 (171)
                      ...-..-.|...|
T Consensus       399 C~dCdvfiHe~Lh  411 (421)
T COG5151         399 CSDCDVFIHETLH  411 (421)
T ss_pred             hhhhHHHHHHHHh
Confidence            8887777776655


No 143
>PF13451 zf-trcl:  Probable zinc-binding domain
Probab=56.80  E-value=11  Score=19.38  Aligned_cols=14  Identities=29%  Similarity=0.878  Sum_probs=7.4

Q ss_pred             cccccchhhhccCh
Q psy12258         56 AFQCEYCGKDFARK   69 (171)
Q Consensus        56 ~~~C~~C~~~~~~~   69 (171)
                      .+.|..|+..|...
T Consensus         4 ~l~C~dCg~~FvfT   17 (49)
T PF13451_consen    4 TLTCKDCGAEFVFT   17 (49)
T ss_pred             eEEcccCCCeEEEe
Confidence            34555566555543


No 144
>PF08271 TF_Zn_Ribbon:  TFIIB zinc-binding;  InterPro: IPR013137 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents a zinc finger motif found in transcription factor IIB (TFIIB). In eukaryotes the initiation of transcription of protein encoding genes by the polymerase II complexe (Pol II) is modulated by general and specific transcription factors. The general transcription factors operate through common promoters elements (such as the TATA box). At least seven different proteins associate to form the general transcription factors: TFIIA, -IIB, -IID, -IIE, -IIF, -IIG, and -IIH [].  TFIIB and TFIID are responsible for promoter recognition and interaction with pol II; together with Pol II, they form a minimal initiation complex capable of transcription under certain conditions. The TATA box of a Pol II promoter is bound in the initiation complex by the TBP subunit of TFIID, which bends the DNA around the C-terminal domain of TFIIB whereas the N-terminal zinc finger of TFIIB interacts with Pol II [, ]. The TFIIB zinc finger adopts a zinc ribbon fold characterised by two beta-hairpins forming two structurally similar zinc-binding sub-sites []. The zinc finger contacts the rbp1 subunit of Pol II through its dock domain, a conserved region of about 70 amino acids located close to the polymerase active site []. In the Pol II complex this surface is located near the RNA exit groove. Interestingly this sequence is best conserved in the three polymerases that utilise a TFIIB-like general transcription factor (Pol II, Pol III, and archaeal RNA polymerase) but not in Pol I [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0006355 regulation of transcription, DNA-dependent; PDB: 1VD4_A 1PFT_A 3K1F_M 3K7A_M 1RO4_A 1RLY_A 1DL6_A.
Probab=56.28  E-value=2.4  Score=20.95  Aligned_cols=12  Identities=25%  Similarity=0.703  Sum_probs=6.1

Q ss_pred             CCCccCcccccc
Q psy12258        110 EKPHFCPVCNKM  121 (171)
Q Consensus       110 ~~~~~C~~C~~~  121 (171)
                      ...+.|+.||..
T Consensus        17 ~g~~vC~~CG~V   28 (43)
T PF08271_consen   17 RGELVCPNCGLV   28 (43)
T ss_dssp             TTEEEETTT-BB
T ss_pred             CCeEECCCCCCE
Confidence            344566666654


No 145
>COG1594 RPB9 DNA-directed RNA polymerase, subunit M/Transcription elongation factor TFIIS [Transcription]
Probab=56.11  E-value=2.8  Score=25.86  Aligned_cols=39  Identities=18%  Similarity=0.509  Sum_probs=19.5

Q ss_pred             eeCCccchhccCcccHHHhhhhcCCCCCcccccchhhhcc
Q psy12258         28 YGCEVCGRHFRQWGDLKYHKASLHSDVKAFQCEYCGKDFA   67 (171)
Q Consensus        28 ~~C~~C~~~f~~~~~l~~H~~~~h~~~~~~~C~~C~~~~~   67 (171)
                      ..|+.||..=.....++.-. ..-+...-|.|..|+..+.
T Consensus        73 ~~CpkCg~~ea~y~~~QtRs-aDEp~T~Fy~C~~Cg~~wr  111 (113)
T COG1594          73 EKCPKCGNKEAYYWQLQTRS-ADEPETRFYKCTRCGYRWR  111 (113)
T ss_pred             ccCCCCCCceeEEEeeehhc-cCCCceEEEEecccCCEee
Confidence            56888876433333222111 1122233478888887654


No 146
>PF07282 OrfB_Zn_ribbon:  Putative transposase DNA-binding domain;  InterPro: IPR010095 This entry represents a region of a sequence similarity between a family of putative transposases of Thermoanaerobacter tengcongensis, smaller related proteins from Bacillus anthracis, putative transposes described by IPR001959 from INTERPRO, and other proteins. More information about these proteins can be found at Protein of the Month: Transposase [].
Probab=55.72  E-value=8.4  Score=21.07  Aligned_cols=32  Identities=25%  Similarity=0.708  Sum_probs=20.2

Q ss_pred             CeeCCccchhccCcccHHHhhhhcCCCCCcccccchhhhccCh
Q psy12258         27 PYGCEVCGRHFRQWGDLKYHKASLHSDVKAFQCEYCGKDFARK   69 (171)
Q Consensus        27 ~~~C~~C~~~f~~~~~l~~H~~~~h~~~~~~~C~~C~~~~~~~   69 (171)
                      +-.|+.||.....           -...+.|.|+.|+......
T Consensus        28 Sq~C~~CG~~~~~-----------~~~~r~~~C~~Cg~~~~rD   59 (69)
T PF07282_consen   28 SQTCPRCGHRNKK-----------RRSGRVFTCPNCGFEMDRD   59 (69)
T ss_pred             ccCccCccccccc-----------ccccceEEcCCCCCEECcH
Confidence            3468888877544           1124457888888775543


No 147
>COG1327 Predicted transcriptional regulator, consists of a Zn-ribbon and ATP-cone domains [Transcription]
Probab=55.33  E-value=2.1  Score=27.62  Aligned_cols=11  Identities=27%  Similarity=0.655  Sum_probs=5.6

Q ss_pred             cCcccccccCC
Q psy12258        114 FCPVCNKMFRV  124 (171)
Q Consensus       114 ~C~~C~~~f~~  124 (171)
                      .|+.||..|++
T Consensus        30 eC~~C~~RFTT   40 (156)
T COG1327          30 ECLECGERFTT   40 (156)
T ss_pred             cccccccccch
Confidence            45555555543


No 148
>COG1655 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=54.86  E-value=3  Score=28.99  Aligned_cols=36  Identities=19%  Similarity=0.319  Sum_probs=23.2

Q ss_pred             CCCccccccCChhhHHHHHHHcCCCC---------------CeeCCccchh
Q psy12258          1 MCDTCGKSFFSSTALKVHNRVHLGLK---------------PYGCEVCGRH   36 (171)
Q Consensus         1 ~C~~C~~~f~~~~~l~~H~~~h~~~~---------------~~~C~~C~~~   36 (171)
                      .||+|+.+|....-+..-.++-.++-               -+.||.|...
T Consensus        21 eCPvC~tkFkkeev~tgsiRiiagDld~~lkygninP~fY~VvvCP~C~yA   71 (267)
T COG1655          21 ECPVCNTKFKKEEVKTGSIRIIAGDLDFFLKYGNINPYFYDVVVCPICYYA   71 (267)
T ss_pred             ccCcccchhhhhheeccceeEecccccceeeccccCCceeEEEEcchhhHH
Confidence            49999999977665554444443331               1568888763


No 149
>KOG4167|consensus
Probab=53.81  E-value=3.4  Score=33.72  Aligned_cols=29  Identities=24%  Similarity=0.397  Sum_probs=24.8

Q ss_pred             CCccCcccccccCCchhHHHHHHHhccCc
Q psy12258        111 KPHFCPVCNKMFRVRSDMKRHLNTHNVDA  139 (171)
Q Consensus       111 ~~~~C~~C~~~f~~~~~l~~H~~~h~~~~  139 (171)
                      ..|.|..|++.|.-..++..||+.|....
T Consensus       791 giFpCreC~kvF~KiKSrNAHMK~Hr~q~  819 (907)
T KOG4167|consen  791 GIFPCRECGKVFFKIKSRNAHMKTHRQQE  819 (907)
T ss_pred             ceeehHHHHHHHHHHhhhhHHHHHHHHHH
Confidence            35999999999999999999999986443


No 150
>PF04780 DUF629:  Protein of unknown function (DUF629);  InterPro: IPR006865 This domain represents a region of several plant proteins of unknown function. A C2H2 zinc finger is predicted in this region in some family members, but the spacing between the cysteine residues is not conserved throughout the family.
Probab=53.56  E-value=6.7  Score=30.51  Aligned_cols=27  Identities=19%  Similarity=0.333  Sum_probs=24.1

Q ss_pred             eeCCccchhccCcccHHHhhhhcCCCC
Q psy12258         28 YGCEVCGRHFRQWGDLKYHKASLHSDV   54 (171)
Q Consensus        28 ~~C~~C~~~f~~~~~l~~H~~~~h~~~   54 (171)
                      +.|+.|.+.|.+...+..|+...|.+.
T Consensus        58 WiCp~CskkF~d~~~~~~H~~~eH~~~   84 (466)
T PF04780_consen   58 WICPRCSKKFSDAESCLSHMEQEHPAG   84 (466)
T ss_pred             eeCCcccceeCCHHHHHHHHHHhhhhh
Confidence            779999999999999999999888653


No 151
>COG4896 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=53.47  E-value=7.8  Score=20.83  Aligned_cols=8  Identities=25%  Similarity=0.986  Sum_probs=3.8

Q ss_pred             ccccchhh
Q psy12258         57 FQCEYCGK   64 (171)
Q Consensus        57 ~~C~~C~~   64 (171)
                      |-|+.|..
T Consensus        32 ymC~eC~~   39 (68)
T COG4896          32 YMCPECEH   39 (68)
T ss_pred             EechhhHh
Confidence            44555444


No 152
>smart00440 ZnF_C2C2 C2C2 Zinc finger. Nucleic-acid-binding motif in transcriptional elongation factor TFIIS and RNA polymerases.
Probab=52.12  E-value=1.6  Score=21.37  Aligned_cols=9  Identities=33%  Similarity=1.158  Sum_probs=4.4

Q ss_pred             ccccchhhh
Q psy12258         57 FQCEYCGKD   65 (171)
Q Consensus        57 ~~C~~C~~~   65 (171)
                      |.|..|+..
T Consensus        29 y~C~~C~~~   37 (40)
T smart00440       29 YVCTKCGHR   37 (40)
T ss_pred             EEeCCCCCE
Confidence            455555543


No 153
>KOG4124|consensus
Probab=52.04  E-value=2.4  Score=31.34  Aligned_cols=50  Identities=30%  Similarity=0.681  Sum_probs=36.0

Q ss_pred             CCCccCcc--chhhcCCHHHHHHHHHHhc-------------------CCCCccCcccccccCCchhHHHH
Q psy12258         82 ERNYQCEF--CHKAFRASSYLQNHRRIHT-------------------GEKPHFCPVCNKMFRVRSDMKRH  131 (171)
Q Consensus        82 ~~~~~C~~--C~~~~~~~~~l~~H~~~h~-------------------~~~~~~C~~C~~~f~~~~~l~~H  131 (171)
                      .++|+|++  |.+.+.....|..|...-+                   ..++|+|++|.++++....|.-|
T Consensus       347 ~~~~~~~vp~~~~~~~n~ng~~~~~~~~h~s~i~~~s~~~~ph~~~~~~nk~~r~~i~~~~~k~~~~l~~~  417 (442)
T KOG4124|consen  347 DKPYKCPVPNCDKAYKNQNGLKYHKLHGHCSPITTPTPAPIPHQGFVVENKPYRCEVCSKRYKNLNGLKYH  417 (442)
T ss_pred             cCCCCCCCCcchhhcccCcceeeccccCcCCCCCCCCCCCCCcceeeeccCcccChhhhhhhccCCCCCce
Confidence            46788866  8888888777776654311                   25789999999999876665444


No 154
>PF04959 ARS2:  Arsenite-resistance protein 2;  InterPro: IPR007042 This entry represents Arsenite-resistance protein 2 (also known as Serrate RNA effector molecule homolog) which is thought to play a role in arsenite resistance [], although does not directly confer arsenite resistance but rather modulates arsenic sensitivity []. Arsenite is a carcinogenic compound which can act as a comutagen by inhibiting DNA repair. It is also involved in cell cycle progression at S phase. ; PDB: 3AX1_A.
Probab=51.77  E-value=8.5  Score=26.67  Aligned_cols=30  Identities=23%  Similarity=0.609  Sum_probs=22.1

Q ss_pred             CCCCccCccchhhcCCHHHHHHHHHHhcCC
Q psy12258         81 GERNYQCEFCHKAFRASSYLQNHRRIHTGE  110 (171)
Q Consensus        81 ~~~~~~C~~C~~~~~~~~~l~~H~~~h~~~  110 (171)
                      .+..|.|++|++.|....-...|+..-|.+
T Consensus        74 ~~~K~~C~lc~KlFkg~eFV~KHI~nKH~e  103 (214)
T PF04959_consen   74 DEDKWRCPLCGKLFKGPEFVRKHIFNKHPE  103 (214)
T ss_dssp             SSEEEEE-SSS-EESSHHHHHHHHHHH-HH
T ss_pred             cCCEECCCCCCcccCChHHHHHHHhhcCHH
Confidence            345699999999999999999999875543


No 155
>COG3091 SprT Zn-dependent metalloprotease, SprT family [General function prediction only]
Probab=51.55  E-value=4.3  Score=26.28  Aligned_cols=35  Identities=23%  Similarity=0.625  Sum_probs=22.0

Q ss_pred             CCCccCccchhhcCCHHHHHHHHHHhcCCCCccCcccccc
Q psy12258         82 ERNYQCEFCHKAFRASSYLQNHRRIHTGEKPHFCPVCNKM  121 (171)
Q Consensus        82 ~~~~~C~~C~~~~~~~~~l~~H~~~h~~~~~~~C~~C~~~  121 (171)
                      .-+|.|. |+..|...   ++|-.+-.++ .|.|..|+-.
T Consensus       115 ~~~Y~C~-C~q~~l~~---RRhn~~~~g~-~YrC~~C~gk  149 (156)
T COG3091         115 TYPYRCQ-CQQHYLRI---RRHNTVRRGE-VYRCGKCGGK  149 (156)
T ss_pred             ceeEEee-cCCccchh---hhcccccccc-eEEeccCCce
Confidence            3468888 88765443   3343333444 7999988854


No 156
>PF07503 zf-HYPF:  HypF finger;  InterPro: IPR011125 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  Proteins of the HypF family are involved in the maturation and regulation of hydrogenase []. In the N terminus they appear to have two zinc finger domains that are similar to those found in the DnaJ chaperone []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 3TTD_A 3TSQ_A 3TTC_A 3TSP_A 3TTF_A 3TSU_A.
Probab=51.40  E-value=2.6  Score=19.99  Aligned_cols=12  Identities=17%  Similarity=0.420  Sum_probs=5.2

Q ss_pred             CccCcccccccC
Q psy12258        112 PHFCPVCNKMFR  123 (171)
Q Consensus       112 ~~~C~~C~~~f~  123 (171)
                      +.-|..||-.++
T Consensus        21 ~isC~~CGPr~~   32 (35)
T PF07503_consen   21 FISCTNCGPRYS   32 (35)
T ss_dssp             T--BTTCC-SCC
T ss_pred             CccCCCCCCCEE
Confidence            345666665543


No 157
>smart00661 RPOL9 RNA polymerase subunit 9.
Probab=50.76  E-value=12  Score=19.08  Aligned_cols=14  Identities=21%  Similarity=0.401  Sum_probs=8.6

Q ss_pred             CeeCCccchhccCc
Q psy12258         27 PYGCEVCGRHFRQW   40 (171)
Q Consensus        27 ~~~C~~C~~~f~~~   40 (171)
                      .+.|+.|+..+...
T Consensus        20 ~~vC~~Cg~~~~~~   33 (52)
T smart00661       20 RFVCRKCGYEEPIE   33 (52)
T ss_pred             EEECCcCCCeEECC
Confidence            46677777655443


No 158
>KOG2807|consensus
Probab=50.29  E-value=17  Score=26.89  Aligned_cols=31  Identities=32%  Similarity=0.772  Sum_probs=23.6

Q ss_pred             CCccCccchhhcCCHHHHHHHHHHhcCCCCccCcccc
Q psy12258         83 RNYQCEFCHKAFRASSYLQNHRRIHTGEKPHFCPVCN  119 (171)
Q Consensus        83 ~~~~C~~C~~~~~~~~~l~~H~~~h~~~~~~~C~~C~  119 (171)
                      ..|+|..|...|-..-+.-.|...|      .|+.|.
T Consensus       344 ~~y~C~~Ck~~FCldCDv~iHesLh------~CpgCe  374 (378)
T KOG2807|consen  344 GRYRCESCKNVFCLDCDVFIHESLH------NCPGCE  374 (378)
T ss_pred             CcEEchhccceeeccchHHHHhhhh------cCCCcC
Confidence            3588999999998887777776665      677665


No 159
>smart00154 ZnF_AN1 AN1-like Zinc finger. Zinc finger at the C-terminus of An1, a ubiquitin-like protein in Xenopus laevis.
Probab=49.25  E-value=9.2  Score=18.53  Aligned_cols=14  Identities=29%  Similarity=0.674  Sum_probs=11.6

Q ss_pred             CeeCCccchhccCc
Q psy12258         27 PYGCEVCGRHFRQW   40 (171)
Q Consensus        27 ~~~C~~C~~~f~~~   40 (171)
                      ++.|+.|+..|-..
T Consensus        12 ~f~C~~C~~~FC~~   25 (39)
T smart00154       12 GFKCRHCGNLFCGE   25 (39)
T ss_pred             CeECCccCCccccc
Confidence            78999999998554


No 160
>PF07975 C1_4:  TFIIH C1-like domain;  InterPro: IPR004595 All proteins in this domain for which functions are known are components of the TFIIH complex which is involved in the initiation of transcription and nucleotide excision repair. It includes the yeast transcription factor Ssl1 (Suppressor of stem-loop protein 1) that is essential for translation initiation and affects UV resistance. The C-terminal region is essential for transcription activity. This regions binds three zinc atoms through two independent domain. The first contains a C4 zinc finger motif, whereas the second is characterised by a CX(2)CX(2-4)FCADCD motif. The solution structure of the second C-terminal domain revealed homology with the regulatory domain of protein kinase C [].; GO: 0006281 DNA repair, 0005634 nucleus; PDB: 1Z60_A.
Probab=49.00  E-value=4.2  Score=21.11  Aligned_cols=17  Identities=18%  Similarity=0.679  Sum_probs=4.9

Q ss_pred             ccccchhhhccChHHHH
Q psy12258         57 FQCEYCGKDFARKYSLV   73 (171)
Q Consensus        57 ~~C~~C~~~~~~~~~l~   73 (171)
                      |.|+.|...|=..-++.
T Consensus        22 y~C~~C~~~FC~dCD~f   38 (51)
T PF07975_consen   22 YRCPKCKNHFCIDCDVF   38 (51)
T ss_dssp             E--TTTT--B-HHHHHT
T ss_pred             EECCCCCCccccCcChh
Confidence            44444444444333333


No 161
>KOG1280|consensus
Probab=48.58  E-value=16  Score=27.22  Aligned_cols=36  Identities=19%  Similarity=0.514  Sum_probs=22.8

Q ss_pred             CccCccchhhcCCHHHHHHHHHHhcCCCC--ccCcccc
Q psy12258         84 NYQCEFCHKAFRASSYLQNHRRIHTGEKP--HFCPVCN  119 (171)
Q Consensus        84 ~~~C~~C~~~~~~~~~l~~H~~~h~~~~~--~~C~~C~  119 (171)
                      -|.|++|+..-.....|..|+...+.+-.  ..|++|+
T Consensus        79 SftCPyC~~~Gfte~~f~~Hv~s~Hpda~~~~icp~c~  116 (381)
T KOG1280|consen   79 SFTCPYCGIMGFTERQFGTHVLSQHPEASTSVICPLCA  116 (381)
T ss_pred             cccCCcccccccchhHHHHHhhhcCcccCcceeeeccc
Confidence            57777777777777777777766444332  2355555


No 162
>PF14787 zf-CCHC_5:  GAG-polyprotein viral zinc-finger; PDB: 1CL4_A 1DSV_A.
Probab=48.41  E-value=9.1  Score=18.21  Aligned_cols=15  Identities=40%  Similarity=0.857  Sum_probs=9.5

Q ss_pred             ccCcccccccCCchh
Q psy12258        113 HFCPVCNKMFRVRSD  127 (171)
Q Consensus       113 ~~C~~C~~~f~~~~~  127 (171)
                      -.|+.|++.|...++
T Consensus         3 ~~CprC~kg~Hwa~~   17 (36)
T PF14787_consen    3 GLCPRCGKGFHWASE   17 (36)
T ss_dssp             -C-TTTSSSCS-TTT
T ss_pred             ccCcccCCCcchhhh
Confidence            368899999887655


No 163
>PF02176 zf-TRAF:  TRAF-type zinc finger; PDB: 2EOD_A 2YUC_A 3HCU_A 3HCS_B 3HCT_A.
Probab=48.29  E-value=8.2  Score=20.31  Aligned_cols=41  Identities=22%  Similarity=0.571  Sum_probs=20.3

Q ss_pred             CCeeCCc--cchhccCcccHHHhhhhcCCCCCcccccc----hhhhccC
Q psy12258         26 KPYGCEV--CGRHFRQWGDLKYHKASLHSDVKAFQCEY----CGKDFAR   68 (171)
Q Consensus        26 ~~~~C~~--C~~~f~~~~~l~~H~~~~h~~~~~~~C~~----C~~~~~~   68 (171)
                      .+..|+.  |...+. +..|..|+.. .=..++..|..    |+..+..
T Consensus         8 ~~v~C~~~cc~~~i~-r~~l~~H~~~-~C~~~~v~C~~~~~GC~~~~~~   54 (60)
T PF02176_consen    8 RPVPCPNGCCNEMIP-RKELDDHLEN-ECPKRPVPCPYSPYGCKERVPR   54 (60)
T ss_dssp             SEEE-TT--S-BEEE-CCCHHHHHHT-TSTTSEEE-SS----S--EEEH
T ss_pred             CEeeCCCCCccccee-HHHHHHHHHc-cCCCCcEECCCCCCCCCCccch
Confidence            4466776  444343 5567778763 22345566777    7665543


No 164
>PTZ00255 60S ribosomal protein L37a; Provisional
Probab=48.17  E-value=4  Score=23.99  Aligned_cols=31  Identities=26%  Similarity=0.543  Sum_probs=17.8

Q ss_pred             CCccCccchhhcCCHHHHHHHHHHhcCCCCccCcccccccC
Q psy12258         83 RNYQCEFCHKAFRASSYLQNHRRIHTGEKPHFCPVCNKMFR  123 (171)
Q Consensus        83 ~~~~C~~C~~~~~~~~~l~~H~~~h~~~~~~~C~~C~~~f~  123 (171)
                      ..|.|+.|++.-     +.     -....++.|..|++.|.
T Consensus        35 a~y~CpfCgk~~-----vk-----R~a~GIW~C~~C~~~~A   65 (90)
T PTZ00255         35 AKYFCPFCGKHA-----VK-----RQAVGIWRCKGCKKTVA   65 (90)
T ss_pred             CCccCCCCCCCc-----ee-----eeeeEEEEcCCCCCEEe
Confidence            457787776431     11     11235678888887765


No 165
>PF01096 TFIIS_C:  Transcription factor S-II (TFIIS);  InterPro: IPR001222 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents a zinc finger motif found in transcription factor IIs (TFIIS). In eukaryotes the initiation of transcription of protein encoding genes by polymerase II (Pol II) is modulated by general and specific transcription factors. The general transcription factors operate through common promoters elements (such as the TATA box). At least eight different proteins associate to form the general transcription factors: TFIIA, -IIB, -IID, -IIE, -IIF, -IIG, -IIH and -IIS []. During mRNA elongation, Pol II can encounter DNA sequences that cause reverse movement of the enzyme. Such backtracking involves extrusion of the RNA 3'-end into the pore, and can lead to transcriptional arrest. Escape from arrest requires cleavage of the extruded RNA with the help of TFIIS, which induces mRNA cleavage by enhancing the intrinsic nuclease activity of RNA polymerase (Pol) II, past template-encoded pause sites []. TFIIS extends from the polymerase surface via a pore to the internal active site. Two essential and invariant acidic residues in a TFIIS loop complement the Pol II active site and could position a metal ion and a water molecule for hydrolytic RNA cleavage. TFIIS also induces extensive structural changes in Pol II that would realign nucleic acids in the active centre.  TFIIS is a protein of about 300 amino acids. It contains three regions: a variable N-terminal domain not required for TFIIS activity; a conserved central domain required for Pol II binding; and a conserved C-terminal C4-type zinc finger essential for RNA cleavage. The zinc finger folds in a conformation termed a zinc ribbon [] characterised by a three-stranded antiparallel beta-sheet and two beta-hairpins. A backbone model for Pol II-TFIIS complex was obtained from X-ray analysis. It shows that a beta hairpin protrudes from the zinc finger and complements the pol II active site [].  Some viral proteins also contain the TFIIS zinc ribbon C-terminal domain. The Vaccinia virus protein, unlike its eukaryotic homologue, is an integral RNA polymerase subunit rather than a readily separable transcription factor []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003676 nucleic acid binding, 0008270 zinc ion binding, 0006351 transcription, DNA-dependent; PDB: 3M4O_I 3S14_I 2E2J_I 4A3J_I 3HOZ_I 1TWA_I 3S1Q_I 3S1N_I 1TWG_I 3I4M_I ....
Probab=47.74  E-value=0.14  Score=24.97  Aligned_cols=10  Identities=20%  Similarity=0.617  Sum_probs=6.1

Q ss_pred             ccCccccccc
Q psy12258        113 HFCPVCNKMF  122 (171)
Q Consensus       113 ~~C~~C~~~f  122 (171)
                      |.|..||..+
T Consensus        29 y~C~~C~~~w   38 (39)
T PF01096_consen   29 YVCCNCGHRW   38 (39)
T ss_dssp             EEESSSTEEE
T ss_pred             EEeCCCCCee
Confidence            6666666544


No 166
>PHA02998 RNA polymerase subunit; Provisional
Probab=47.24  E-value=1.8  Score=28.77  Aligned_cols=41  Identities=22%  Similarity=0.376  Sum_probs=22.7

Q ss_pred             CccCccchhhcCCHHHHHHHHHHhcCCCCccCcccccccCC
Q psy12258         84 NYQCEFCHKAFRASSYLQNHRRIHTGEKPHFCPVCNKMFRV  124 (171)
Q Consensus        84 ~~~C~~C~~~~~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~  124 (171)
                      ...|+.|+..=.....++..-.-......|+|..||+.|.-
T Consensus       143 ~v~CPkCg~~~A~f~qlQTRSADEPmT~FYkC~~CG~~wkp  183 (195)
T PHA02998        143 NTPCPNCKSKNTTPMMIQTRAADEPPLVRHACRDCKKHFKP  183 (195)
T ss_pred             CCCCCCCCCCceEEEEEeeccCCCCceEEEEcCCCCCccCC
Confidence            46788887543333232222111222344899999988764


No 167
>PRK00432 30S ribosomal protein S27ae; Validated
Probab=47.23  E-value=12  Score=19.36  Aligned_cols=12  Identities=25%  Similarity=0.706  Sum_probs=7.6

Q ss_pred             Ccccccchhhhc
Q psy12258         55 KAFQCEYCGKDF   66 (171)
Q Consensus        55 ~~~~C~~C~~~~   66 (171)
                      ..+.|..|+..+
T Consensus        36 ~r~~C~~Cgyt~   47 (50)
T PRK00432         36 DRWHCGKCGYTE   47 (50)
T ss_pred             CcEECCCcCCEE
Confidence            346777777643


No 168
>COG1998 RPS31 Ribosomal protein S27AE [Translation, ribosomal structure and biogenesis]
Probab=47.15  E-value=8.8  Score=19.71  Aligned_cols=10  Identities=20%  Similarity=0.448  Sum_probs=6.6

Q ss_pred             CccCcccccc
Q psy12258        112 PHFCPVCNKM  121 (171)
Q Consensus       112 ~~~C~~C~~~  121 (171)
                      .|.|..||..
T Consensus        37 R~~CGkCgyT   46 (51)
T COG1998          37 RWACGKCGYT   46 (51)
T ss_pred             eeEeccccce
Confidence            4677777754


No 169
>PF04780 DUF629:  Protein of unknown function (DUF629);  InterPro: IPR006865 This domain represents a region of several plant proteins of unknown function. A C2H2 zinc finger is predicted in this region in some family members, but the spacing between the cysteine residues is not conserved throughout the family.
Probab=47.13  E-value=14  Score=28.89  Aligned_cols=31  Identities=19%  Similarity=0.411  Sum_probs=22.5

Q ss_pred             hcCCCCccCcccccccCCchhHHHHHHHhcc
Q psy12258        107 HTGEKPHFCPVCNKMFRVRSDMKRHLNTHNV  137 (171)
Q Consensus       107 h~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~  137 (171)
                      +..-+.+.|+.|.+.|.....+..|+..-|.
T Consensus        52 n~sWrFWiCp~CskkF~d~~~~~~H~~~eH~   82 (466)
T PF04780_consen   52 NKSWRFWICPRCSKKFSDAESCLSHMEQEHP   82 (466)
T ss_pred             cCceeEeeCCcccceeCCHHHHHHHHHHhhh
Confidence            3344567888888888888888888865443


No 170
>PRK12380 hydrogenase nickel incorporation protein HybF; Provisional
Probab=46.11  E-value=6.5  Score=24.19  Aligned_cols=10  Identities=20%  Similarity=0.361  Sum_probs=6.2

Q ss_pred             ccCccchhhc
Q psy12258         85 YQCEFCHKAF   94 (171)
Q Consensus        85 ~~C~~C~~~~   94 (171)
                      +.|..|+..|
T Consensus        71 ~~C~~Cg~~~   80 (113)
T PRK12380         71 AWCWDCSQVV   80 (113)
T ss_pred             EEcccCCCEE
Confidence            5666666555


No 171
>COG2879 Uncharacterized small protein [Function unknown]
Probab=44.35  E-value=25  Score=19.07  Aligned_cols=20  Identities=10%  Similarity=0.137  Sum_probs=15.4

Q ss_pred             cCCchhHHHHHHHhccCccc
Q psy12258        122 FRVRSDMKRHLNTHNVDARQ  141 (171)
Q Consensus       122 f~~~~~l~~H~~~h~~~~~~  141 (171)
                      ..+.++...|||.+|.+..+
T Consensus        22 vpdYdnYVehmr~~hPd~p~   41 (65)
T COG2879          22 VPDYDNYVEHMRKKHPDKPP   41 (65)
T ss_pred             CCcHHHHHHHHHHhCcCCCc
Confidence            45677888999988877664


No 172
>KOG1842|consensus
Probab=44.17  E-value=13  Score=28.65  Aligned_cols=25  Identities=20%  Similarity=0.473  Sum_probs=15.8

Q ss_pred             CccCccchhhcCCHHHHHHHHHHhc
Q psy12258         84 NYQCEFCHKAFRASSYLQNHRRIHT  108 (171)
Q Consensus        84 ~~~C~~C~~~~~~~~~l~~H~~~h~  108 (171)
                      .|.||+|...|.+...|..|...-|
T Consensus        15 gflCPiC~~dl~~~~~L~~H~d~eH   39 (505)
T KOG1842|consen   15 GFLCPICLLDLPNLSALNDHLDVEH   39 (505)
T ss_pred             cccCchHhhhhhhHHHHHHHHhhhc
Confidence            4666666666666666666665533


No 173
>COG1571 Predicted DNA-binding protein containing a Zn-ribbon domain [General function prediction only]
Probab=43.52  E-value=13  Score=28.50  Aligned_cols=30  Identities=20%  Similarity=0.454  Sum_probs=19.9

Q ss_pred             ccCccchhhcCCHHHHHHHHHHhcCCCCccCcccccccCCc
Q psy12258         85 YQCEFCHKAFRASSYLQNHRRIHTGEKPHFCPVCNKMFRVR  125 (171)
Q Consensus        85 ~~C~~C~~~~~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~  125 (171)
                      -.|+.||....+.           |..-|+|+.||..+...
T Consensus       351 p~Cp~Cg~~m~S~-----------G~~g~rC~kCg~~~~~~  380 (421)
T COG1571         351 PVCPRCGGRMKSA-----------GRNGFRCKKCGTRARET  380 (421)
T ss_pred             CCCCccCCchhhc-----------CCCCcccccccccCCcc
Confidence            3788888654332           22378999999777654


No 174
>COG1675 TFA1 Transcription initiation factor IIE, alpha subunit [Transcription]
Probab=43.26  E-value=26  Score=23.52  Aligned_cols=36  Identities=22%  Similarity=0.565  Sum_probs=22.6

Q ss_pred             hcCCCCccCccchhhcCCHHHHHHHHHHhcCCCCccCcccccccC
Q psy12258         79 HTGERNYQCEFCHKAFRASSYLQNHRRIHTGEKPHFCPVCNKMFR  123 (171)
Q Consensus        79 ~~~~~~~~C~~C~~~~~~~~~l~~H~~~h~~~~~~~C~~C~~~f~  123 (171)
                      -.....|.|+.|...|+....+.         ..|.|+.||-...
T Consensus       108 ~~~~~~y~C~~~~~r~sfdeA~~---------~~F~Cp~Cg~~L~  143 (176)
T COG1675         108 ETENNYYVCPNCHVKYSFDEAME---------LGFTCPKCGEDLE  143 (176)
T ss_pred             hccCCceeCCCCCCcccHHHHHH---------hCCCCCCCCchhh
Confidence            34556688887776665554432         2278888886544


No 175
>PRK14714 DNA polymerase II large subunit; Provisional
Probab=42.72  E-value=18  Score=31.84  Aligned_cols=9  Identities=33%  Similarity=0.944  Sum_probs=6.9

Q ss_pred             eeCCccchh
Q psy12258         28 YGCEVCGRH   36 (171)
Q Consensus        28 ~~C~~C~~~   36 (171)
                      +.|+.||..
T Consensus       668 rkCPkCG~~  676 (1337)
T PRK14714        668 RRCPSCGTE  676 (1337)
T ss_pred             EECCCCCCc
Confidence            678888864


No 176
>PF07800 DUF1644:  Protein of unknown function (DUF1644);  InterPro: IPR012866 This family consists of sequences found in a number of hypothetical plant proteins of unknown function. The region of interest contains nine highly conserved cysteine residues and is approximately 160 amino acids in length, which probably represent a zinc-binding domain. 
Probab=42.67  E-value=32  Score=22.64  Aligned_cols=60  Identities=17%  Similarity=0.304  Sum_probs=33.0

Q ss_pred             CccCccchhhcCCHHHHHHHHHHhcCCCCccCccccccc-CCchhHHHHHHHhccCcccccc
Q psy12258         84 NYQCEFCHKAFRASSYLQNHRRIHTGEKPHFCPVCNKMF-RVRSDMKRHLNTHNVDARQYLT  144 (171)
Q Consensus        84 ~~~C~~C~~~~~~~~~l~~H~~~h~~~~~~~C~~C~~~f-~~~~~l~~H~~~h~~~~~~~~~  144 (171)
                      ...||+|.-...- +....-.+.+-+.++--|..=+=.| .++..|++|.+.-|....+...
T Consensus        80 ~L~CPLCRG~V~G-Wtvve~AR~~LN~K~RsC~~e~C~F~GtY~eLrKHar~~HP~~rP~~v  140 (162)
T PF07800_consen   80 ELACPLCRGEVKG-WTVVEPARRFLNAKKRSCSQESCSFSGTYSELRKHARSEHPSARPSEV  140 (162)
T ss_pred             cccCccccCceec-eEEchHHHHHhccCCccCcccccccccCHHHHHHHHHhhCCCCCCccC
Confidence            4688988533211 1111222333344555554422233 3788999999998877775443


No 177
>PLN02294 cytochrome c oxidase subunit Vb
Probab=42.58  E-value=11  Score=24.91  Aligned_cols=16  Identities=38%  Similarity=0.889  Sum_probs=13.0

Q ss_pred             CCCCccCcccccccCC
Q psy12258        109 GEKPHFCPVCNKMFRV  124 (171)
Q Consensus       109 ~~~~~~C~~C~~~f~~  124 (171)
                      ..++++|++||..|..
T Consensus       138 kGkp~RCpeCG~~fkL  153 (174)
T PLN02294        138 KGKSFECPVCTQYFEL  153 (174)
T ss_pred             CCCceeCCCCCCEEEE
Confidence            3578999999988863


No 178
>KOG2857|consensus
Probab=42.17  E-value=32  Score=22.12  Aligned_cols=20  Identities=25%  Similarity=0.391  Sum_probs=10.4

Q ss_pred             ccCcccccccCCchhHHHHH
Q psy12258        113 HFCPVCNKMFRVRSDMKRHL  132 (171)
Q Consensus       113 ~~C~~C~~~f~~~~~l~~H~  132 (171)
                      |+|+.|..-|-+..-+..|.
T Consensus        18 YKCpkC~vPYCSl~CfKiHk   37 (157)
T KOG2857|consen   18 YKCPKCSVPYCSLPCFKIHK   37 (157)
T ss_pred             ccCCCCCCccccchhhhhcc
Confidence            55555555555555554443


No 179
>PF01363 FYVE:  FYVE zinc finger;  InterPro: IPR000306 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The FYVE zinc finger is named after four proteins that it has been found in: Fab1, YOTB/ZK632.12, Vac1, and EEA1. The FYVE finger has been shown to bind two zinc ions []. The FYVE finger has eight potential zinc coordinating cysteine positions. Many members of this family also include two histidines in a motif R+HHC+XCG, where + represents a charged residue and X any residue. FYVE-type domains are divided into two known classes: FYVE domains that specifically bind to phosphatidylinositol 3-phosphate in lipid bilayers and FYVE-related domains of undetermined function []. Those that bind to phosphatidylinositol 3-phosphate are often found in proteins targeted to lipid membranes that are involved in regulating membrane traffic [, , ]. Most FYVE domains target proteins to endosomes by binding specifically to phosphatidylinositol-3-phosphate at the membrane surface. By contrast, the CARP2 FYVE-like domain is not optimized to bind to phosphoinositides or insert into lipid bilayers. FYVE domains are distinguished from other zinc fingers by three signature sequences: an N-terminal WxxD motif, a basic R(R/K)HHCR patch, and a C-terminal RVC motif. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0046872 metal ion binding; PDB: 1HYI_A 1JOC_B 1HYJ_A 1DVP_A 3ZYQ_A 4AVX_A 1VFY_A 3T7L_A 1X4U_A 1WFK_A ....
Probab=41.71  E-value=15  Score=20.03  Aligned_cols=9  Identities=44%  Similarity=1.531  Sum_probs=2.6

Q ss_pred             eCCccchhc
Q psy12258         29 GCEVCGRHF   37 (171)
Q Consensus        29 ~C~~C~~~f   37 (171)
                      .|..|++.|
T Consensus        11 ~C~~C~~~F   19 (69)
T PF01363_consen   11 NCMICGKKF   19 (69)
T ss_dssp             B-TTT--B-
T ss_pred             cCcCcCCcC
Confidence            355555555


No 180
>TIGR00280 L37a ribosomal protein L37a. This model finds eukaryotic ribosomal protein L37a and its archaeal orthologs. The nomeclature is tricky because eukaryotes have proteins called both L37 and L37a.
Probab=41.43  E-value=4.3  Score=23.87  Aligned_cols=31  Identities=26%  Similarity=0.575  Sum_probs=17.8

Q ss_pred             CCccCccchhhcCCHHHHHHHHHHhcCCCCccCcccccccC
Q psy12258         83 RNYQCEFCHKAFRASSYLQNHRRIHTGEKPHFCPVCNKMFR  123 (171)
Q Consensus        83 ~~~~C~~C~~~~~~~~~l~~H~~~h~~~~~~~C~~C~~~f~  123 (171)
                      ..|.|+.|++.-     +     .-..-.++.|..|++.|.
T Consensus        34 a~y~CpfCgk~~-----v-----kR~a~GIW~C~~C~~~~A   64 (91)
T TIGR00280        34 AKYVCPFCGKKT-----V-----KRGSTGIWTCRKCGAKFA   64 (91)
T ss_pred             cCccCCCCCCCc-----e-----EEEeeEEEEcCCCCCEEe
Confidence            457788776431     0     012235578888887765


No 181
>PF09845 DUF2072:  Zn-ribbon containing protein (DUF2072);  InterPro: IPR018645  This archaeal Zinc-ribbon containing proteins have no known function. 
Probab=41.23  E-value=14  Score=23.40  Aligned_cols=12  Identities=33%  Similarity=0.944  Sum_probs=5.5

Q ss_pred             ccCcccccccCC
Q psy12258        113 HFCPVCNKMFRV  124 (171)
Q Consensus       113 ~~C~~C~~~f~~  124 (171)
                      ++|..||+.|..
T Consensus         2 H~Ct~Cg~~f~d   13 (131)
T PF09845_consen    2 HQCTKCGRVFED   13 (131)
T ss_pred             cccCcCCCCcCC
Confidence            344444444443


No 182
>KOG1842|consensus
Probab=40.70  E-value=12  Score=28.82  Aligned_cols=28  Identities=18%  Similarity=0.305  Sum_probs=20.5

Q ss_pred             CeeCCccchhccCcccHHHhhhhcCCCC
Q psy12258         27 PYGCEVCGRHFRQWGDLKYHKASLHSDV   54 (171)
Q Consensus        27 ~~~C~~C~~~f~~~~~l~~H~~~~h~~~   54 (171)
                      .|.||+|..-|.+...|..|....|..+
T Consensus        15 gflCPiC~~dl~~~~~L~~H~d~eH~~e   42 (505)
T KOG1842|consen   15 GFLCPICLLDLPNLSALNDHLDVEHFEE   42 (505)
T ss_pred             cccCchHhhhhhhHHHHHHHHhhhcccc
Confidence            4777888777777777777777666554


No 183
>PF04423 Rad50_zn_hook:  Rad50 zinc hook motif;  InterPro: IPR007517 The Mre11 complex (Mre11 Rad50 Nbs1) is central to chromosomal maintenance and functions in homologous recombination, telomere maintenance and sister chromatid association. The Rad50 coiled-coil region contains a dimer interface at the apex of the coiled coils in which pairs of conserved Cys-X-X-Cys motifs form interlocking hooks that bind one Zn ion. This alignment includes the zinc hook motif and a short stretch of coiled-coil on either side.; GO: 0004518 nuclease activity, 0005524 ATP binding, 0008270 zinc ion binding, 0006281 DNA repair; PDB: 1L8D_B.
Probab=40.56  E-value=8.7  Score=19.98  Aligned_cols=12  Identities=17%  Similarity=0.711  Sum_probs=6.3

Q ss_pred             cCccchhhcCCH
Q psy12258         86 QCEFCHKAFRAS   97 (171)
Q Consensus        86 ~C~~C~~~~~~~   97 (171)
                      .||+|++.|...
T Consensus        22 ~CPlC~r~l~~e   33 (54)
T PF04423_consen   22 CCPLCGRPLDEE   33 (54)
T ss_dssp             E-TTT--EE-HH
T ss_pred             cCCCCCCCCCHH
Confidence            899999888654


No 184
>COG5151 SSL1 RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, subunit SSL1 [Transcription / DNA replication, recombination, and repair]
Probab=40.51  E-value=33  Score=25.27  Aligned_cols=27  Identities=22%  Similarity=0.338  Sum_probs=22.3

Q ss_pred             CCccCcccccccCCchhHHHHHHHhcc
Q psy12258        111 KPHFCPVCNKMFRVRSDMKRHLNTHNV  137 (171)
Q Consensus       111 ~~~~C~~C~~~f~~~~~l~~H~~~h~~  137 (171)
                      ..|.|+.|...|-...+...|...|..
T Consensus       387 ~rY~Ce~CK~~FC~dCdvfiHe~Lh~C  413 (421)
T COG5151         387 GRYQCELCKSTFCSDCDVFIHETLHFC  413 (421)
T ss_pred             cceechhhhhhhhhhhHHHHHHHHhhC
Confidence            459999999999988888888777753


No 185
>TIGR00100 hypA hydrogenase nickel insertion protein HypA. In Hpylori, hypA mutant abolished hydrogenase activity and decrease in urease activity. Nickel supplementation in media restored urease activity and partial hydrogenase activity. HypA probably involved in inserting Ni in enzymes.
Probab=40.12  E-value=13  Score=22.96  Aligned_cols=27  Identities=22%  Similarity=0.452  Sum_probs=17.8

Q ss_pred             CCeeCCccchhccCcccHHHhhhhcCCCCCcccccchhhh
Q psy12258         26 KPYGCEVCGRHFRQWGDLKYHKASLHSDVKAFQCEYCGKD   65 (171)
Q Consensus        26 ~~~~C~~C~~~f~~~~~l~~H~~~~h~~~~~~~C~~C~~~   65 (171)
                      ....|+.|+..|.....             .+.|+.|+..
T Consensus        69 ~~~~C~~Cg~~~~~~~~-------------~~~CP~Cgs~   95 (115)
T TIGR00100        69 VECECEDCSEEVSPEID-------------LYRCPKCHGI   95 (115)
T ss_pred             cEEEcccCCCEEecCCc-------------CccCcCCcCC
Confidence            34788899877755432             2568888854


No 186
>PF09963 DUF2197:  Uncharacterized protein conserved in bacteria (DUF2197);  InterPro: IPR019241  This family represents various hypothetical bacterial proteins with no known function. 
Probab=39.54  E-value=15  Score=19.52  Aligned_cols=12  Identities=17%  Similarity=0.866  Sum_probs=6.7

Q ss_pred             CCcccccchhhh
Q psy12258         54 VKAFQCEYCGKD   65 (171)
Q Consensus        54 ~~~~~C~~C~~~   65 (171)
                      ...|.|..|...
T Consensus        29 i~tYmC~eC~~R   40 (56)
T PF09963_consen   29 IHTYMCDECKER   40 (56)
T ss_pred             CcceeChhHHHH
Confidence            334666666654


No 187
>PRK12496 hypothetical protein; Provisional
Probab=39.52  E-value=13  Score=24.64  Aligned_cols=29  Identities=17%  Similarity=0.529  Sum_probs=18.1

Q ss_pred             CCccCccchhhcCCHHHHHHHHHHhcCCCCccCcccccccC
Q psy12258         83 RNYQCEFCHKAFRASSYLQNHRRIHTGEKPHFCPVCNKMFR  123 (171)
Q Consensus        83 ~~~~C~~C~~~~~~~~~l~~H~~~h~~~~~~~C~~C~~~f~  123 (171)
                      +.+.|+.|++.|....            ..-.|++||....
T Consensus       126 w~~~C~gC~~~~~~~~------------~~~~C~~CG~~~~  154 (164)
T PRK12496        126 WRKVCKGCKKKYPEDY------------PDDVCEICGSPVK  154 (164)
T ss_pred             eeEECCCCCccccCCC------------CCCcCCCCCChhh
Confidence            3478999998874321            1126999996543


No 188
>COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair]
Probab=39.38  E-value=4.1  Score=33.63  Aligned_cols=15  Identities=27%  Similarity=0.614  Sum_probs=10.8

Q ss_pred             hcCCCCccCcccccc
Q psy12258        107 HTGEKPHFCPVCNKM  121 (171)
Q Consensus       107 h~~~~~~~C~~C~~~  121 (171)
                      +....|..|+.||-.
T Consensus       470 ~~~~~p~~Cp~Cgs~  484 (730)
T COG1198         470 YQEPIPQSCPECGSE  484 (730)
T ss_pred             CCCCCCCCCCCCCCC
Confidence            445677889999844


No 189
>TIGR00686 phnA alkylphosphonate utilization operon protein PhnA. The protein family includes an uncharacterized member designated phnA in Escherichia coli, part of a large operon associated with alkylphosphonate uptake and carbon-phosphorus bond cleavage. This protein is not related to the characterized phosphonoacetate hydrolase designated PhnA by Kulakova, et al. (2001, 1997).
Probab=39.26  E-value=18  Score=22.00  Aligned_cols=15  Identities=13%  Similarity=0.293  Sum_probs=9.5

Q ss_pred             CCeeCCccchhccCc
Q psy12258         26 KPYGCEVCGRHFRQW   40 (171)
Q Consensus        26 ~~~~C~~C~~~f~~~   40 (171)
                      ..|.|+.|+..+...
T Consensus        18 ~~~iCpeC~~EW~~~   32 (109)
T TIGR00686        18 TQLICPSCLYEWNEN   32 (109)
T ss_pred             CeeECcccccccccc
Confidence            447777777666544


No 190
>PF03811 Zn_Tnp_IS1:  InsA N-terminal domain;  InterPro: IPR003220 Insertion elements are mobile elements in DNA, usually encoding proteins required for transposition, for example transposases. Protein InsA is absolutely required for transposition of insertion element 1. This entry represents a short zinc binding domain found in IS1 InsA family protein. It is found at the N terminus of the protein and may be a DNA-binding domain.; GO: 0006313 transposition, DNA-mediated
Probab=39.09  E-value=6.2  Score=18.82  Aligned_cols=30  Identities=20%  Similarity=0.460  Sum_probs=14.0

Q ss_pred             eeCCccchhccCcccHHHhhhhcCCCCCcccccch
Q psy12258         28 YGCEVCGRHFRQWGDLKYHKASLHSDVKAFQCEYC   62 (171)
Q Consensus        28 ~~C~~C~~~f~~~~~l~~H~~~~h~~~~~~~C~~C   62 (171)
                      ..|+.|+..-    .+..|-. ...+...|.|..|
T Consensus         6 v~CP~C~s~~----~v~k~G~-~~~G~qryrC~~C   35 (36)
T PF03811_consen    6 VHCPRCQSTE----GVKKNGK-SPSGHQRYRCKDC   35 (36)
T ss_pred             eeCCCCCCCC----cceeCCC-CCCCCEeEecCcC
Confidence            3466665431    2333333 2344455666655


No 191
>PRK10220 hypothetical protein; Provisional
Probab=38.95  E-value=23  Score=21.65  Aligned_cols=15  Identities=20%  Similarity=0.514  Sum_probs=8.6

Q ss_pred             CCeeCCccchhccCc
Q psy12258         26 KPYGCEVCGRHFRQW   40 (171)
Q Consensus        26 ~~~~C~~C~~~f~~~   40 (171)
                      ..|.|+.|+.-+...
T Consensus        19 ~~~vCpeC~hEW~~~   33 (111)
T PRK10220         19 GMYICPECAHEWNDA   33 (111)
T ss_pred             CeEECCcccCcCCcc
Confidence            346677776655443


No 192
>PRK05978 hypothetical protein; Provisional
Probab=38.10  E-value=11  Score=24.42  Aligned_cols=10  Identities=50%  Similarity=1.401  Sum_probs=5.9

Q ss_pred             cccchhhhcc
Q psy12258         58 QCEYCGKDFA   67 (171)
Q Consensus        58 ~C~~C~~~~~   67 (171)
                      .|+.|+..|.
T Consensus        54 ~C~~CG~~~~   63 (148)
T PRK05978         54 HCAACGEDFT   63 (148)
T ss_pred             CccccCCccc
Confidence            4666665554


No 193
>KOG2071|consensus
Probab=38.08  E-value=25  Score=28.26  Aligned_cols=27  Identities=22%  Similarity=0.617  Sum_probs=22.5

Q ss_pred             CCCCccCcccccccCCchhHHHHHHHh
Q psy12258        109 GEKPHFCPVCNKMFRVRSDMKRHLNTH  135 (171)
Q Consensus       109 ~~~~~~C~~C~~~f~~~~~l~~H~~~h  135 (171)
                      ...+..|..||..|.......+||..|
T Consensus       415 ~~~pnqC~~CG~R~~~~ee~sk~md~H  441 (579)
T KOG2071|consen  415 KDSPNQCKSCGLRFDDSEERSKHMDIH  441 (579)
T ss_pred             cCCcchhcccccccccchhhhhHhhhh
Confidence            456789999999999988888887766


No 194
>COG4888 Uncharacterized Zn ribbon-containing protein [General function prediction only]
Probab=37.85  E-value=6.2  Score=23.61  Aligned_cols=38  Identities=24%  Similarity=0.510  Sum_probs=19.7

Q ss_pred             CCCeeCCccchhccCcccHHHhhhhcCCCCCcccccchhhhcc
Q psy12258         25 LKPYGCEVCGRHFRQWGDLKYHKASLHSDVKAFQCEYCGKDFA   67 (171)
Q Consensus        25 ~~~~~C~~C~~~f~~~~~l~~H~~~~h~~~~~~~C~~C~~~~~   67 (171)
                      ++.|.|+.|+..-.....+..     -.......|..|+..|.
T Consensus        20 ~k~FtCp~Cghe~vs~ctvkk-----~~~~g~~~Cg~CGls~e   57 (104)
T COG4888          20 PKTFTCPRCGHEKVSSCTVKK-----TVNIGTAVCGNCGLSFE   57 (104)
T ss_pred             CceEecCccCCeeeeEEEEEe-----cCceeEEEcccCcceEE
Confidence            455778777765544333221     11122345777776554


No 195
>cd00924 Cyt_c_Oxidase_Vb Cytochrome c oxidase subunit Vb.  Cytochrome c oxidase (CcO), the terminal oxidase in the respiratory chains of eukaryotes and most bacteria, is a multi-chain transmembrane protein located in the inner membrane of mitochondria and the cell membrane of prokaryotes.  It catalyzes the reduction of O2 and simultaneously pumps protons across the membrane.  The number of subunits varies from three to five in bacteria and up to 13 in mammalian mitochondria. Subunits I, II, and III of mammalian CcO are encoded within the mitochondrial genome and the remaining 10 subunits are encoded within the nuclear genome.  Found only in eukaryotes, subunit Vb is one of three mammalian subunits that lacks a transmembrane region.  Subunit Vb is located on the matrix side of the membrane and binds the regulatory subunit of protein kinase A.  The abnormally extended conformation is stable only in the CcO assembly.
Probab=37.30  E-value=15  Score=21.95  Aligned_cols=14  Identities=43%  Similarity=1.151  Sum_probs=10.4

Q ss_pred             CCCccCcccccccC
Q psy12258        110 EKPHFCPVCNKMFR  123 (171)
Q Consensus       110 ~~~~~C~~C~~~f~  123 (171)
                      .++++|+.||.-|.
T Consensus        77 g~~~rC~eCG~~fk   90 (97)
T cd00924          77 GKPKRCPECGHVFK   90 (97)
T ss_pred             CCceeCCCCCcEEE
Confidence            36788888887775


No 196
>PRK00564 hypA hydrogenase nickel incorporation protein; Provisional
Probab=37.10  E-value=10  Score=23.54  Aligned_cols=10  Identities=30%  Similarity=0.962  Sum_probs=6.0

Q ss_pred             ccCccchhhc
Q psy12258         85 YQCEFCHKAF   94 (171)
Q Consensus        85 ~~C~~C~~~~   94 (171)
                      +.|..|+..|
T Consensus        72 ~~C~~Cg~~~   81 (117)
T PRK00564         72 LECKDCSHVF   81 (117)
T ss_pred             EEhhhCCCcc
Confidence            5566666554


No 197
>PF14311 DUF4379:  Domain of unknown function (DUF4379)
Probab=37.07  E-value=21  Score=18.53  Aligned_cols=15  Identities=20%  Similarity=0.735  Sum_probs=10.7

Q ss_pred             eeCCccchhccCccc
Q psy12258         28 YGCEVCGRHFRQWGD   42 (171)
Q Consensus        28 ~~C~~C~~~f~~~~~   42 (171)
                      +.|+.|+..+...-.
T Consensus        29 W~C~~Cgh~w~~~v~   43 (55)
T PF14311_consen   29 WKCPKCGHEWKASVN   43 (55)
T ss_pred             EECCCCCCeeEccHh
Confidence            789999877755443


No 198
>KOG0717|consensus
Probab=37.00  E-value=18  Score=28.14  Aligned_cols=21  Identities=43%  Similarity=0.901  Sum_probs=19.0

Q ss_pred             ccCcccccccCCchhHHHHHH
Q psy12258        113 HFCPVCNKMFRVRSDMKRHLN  133 (171)
Q Consensus       113 ~~C~~C~~~f~~~~~l~~H~~  133 (171)
                      +-|.+|+++|.+...|..|..
T Consensus       293 lyC~vCnKsFKseKq~kNHEn  313 (508)
T KOG0717|consen  293 LYCVVCNKSFKSEKQLKNHEN  313 (508)
T ss_pred             eEEeeccccccchHHHHhhHH
Confidence            789999999999999999974


No 199
>cd00730 rubredoxin Rubredoxin; nonheme iron binding domains containing a [Fe(SCys)4] center. Rubredoxins are small nonheme iron proteins. The iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), but iron can also be replaced by cobalt, nickel or zinc. They are believed to be involved in electron transfer.
Probab=36.30  E-value=15  Score=18.97  Aligned_cols=12  Identities=17%  Similarity=0.636  Sum_probs=9.7

Q ss_pred             ccCcccccccCC
Q psy12258        113 HFCPVCNKMFRV  124 (171)
Q Consensus       113 ~~C~~C~~~f~~  124 (171)
                      |+|.+||..+.-
T Consensus         2 y~C~~CgyiYd~   13 (50)
T cd00730           2 YECRICGYIYDP   13 (50)
T ss_pred             cCCCCCCeEECC
Confidence            789999988763


No 200
>PF01428 zf-AN1:  AN1-like Zinc finger;  InterPro: IPR000058 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents the AN1-type zinc finger domain, which has a dimetal (zinc)-bound alpha/beta fold. This domain was first identified as a zinc finger at the C terminus of AN1 Q91889 from SWISSPROT, a ubiquitin-like protein in Xenopus laevis []. The AN1-type zinc finger contains six conserved cysteines and two histidines that could potentially coordinate 2 zinc atoms. Certain stress-associated proteins (SAP) contain AN1 domain, often in combination with A20 zinc finger domains (SAP8) or C2H2 domains (SAP16) []. For example, the human protein Znf216 has an A20 zinc-finger at the N terminus and an AN1 zinc-finger at the C terminus, acting to negatively regulate the NFkappaB activation pathway and to interact with components of the immune response like RIP, IKKgamma and TRAF6. The interact of Znf216 with IKK-gamma and RIP is mediated by the A20 zinc-finger domain, while its interaction with TRAF6 is mediated by the AN1 zinc-finger domain; therefore, both zinc-finger domains are involved in regulating the immune response []. The AN1 zinc finger domain is also found in proteins containing a ubiquitin-like domain, which are involved in the ubiquitination pathway []. Proteins containing an AN1-type zinc finger include:   Ascidian posterior end mark 6 (pem-6) protein []. Human AWP1 protein (associated with PRK1), which is expressed during early embryogenesis []. Human immunoglobulin mu binding protein 2 (SMUBP-2), mutations in which cause muscular atrophy with respiratory distress type 1 [].   More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 1WFP_A 1WYS_A 1WG2_A 1WFH_A 1X4W_A 1WFE_A 1WFL_A 1X4V_A.
Probab=36.20  E-value=13  Score=18.33  Aligned_cols=15  Identities=33%  Similarity=0.899  Sum_probs=9.4

Q ss_pred             CCeeCCccchhccCc
Q psy12258         26 KPYGCEVCGRHFRQW   40 (171)
Q Consensus        26 ~~~~C~~C~~~f~~~   40 (171)
                      .++.|+.|+..|-..
T Consensus        12 ~~~~C~~C~~~FC~~   26 (43)
T PF01428_consen   12 LPFKCKHCGKSFCLK   26 (43)
T ss_dssp             SHEE-TTTS-EE-TT
T ss_pred             CCeECCCCCcccCcc
Confidence            478999999998544


No 201
>COG4640 Predicted membrane protein [Function unknown]
Probab=36.17  E-value=23  Score=26.99  Aligned_cols=18  Identities=22%  Similarity=0.493  Sum_probs=10.5

Q ss_pred             CCccCcccccccCCchhH
Q psy12258        111 KPHFCPVCNKMFRVRSDM  128 (171)
Q Consensus       111 ~~~~C~~C~~~f~~~~~l  128 (171)
                      ..+.|+.||..|.....+
T Consensus        14 d~~qC~qCG~~~t~~~sq   31 (465)
T COG4640          14 DDVQCTQCGHKFTSRQSQ   31 (465)
T ss_pred             ccccccccCCcCCchhhh
Confidence            344577777666655544


No 202
>COG0068 HypF Hydrogenase maturation factor [Posttranslational modification, protein turnover, chaperones]
Probab=35.01  E-value=17  Score=29.92  Aligned_cols=58  Identities=26%  Similarity=0.728  Sum_probs=40.2

Q ss_pred             eCCccchhccCcccHHHhhhhcCCCCCcc-cccchhhhccChHHHHHHHhhhcCCCCccCccchhhc
Q psy12258         29 GCEVCGRHFRQWGDLKYHKASLHSDVKAF-QCEYCGKDFARKYSLVVHRRIHTGERNYQCEFCHKAF   94 (171)
Q Consensus        29 ~C~~C~~~f~~~~~l~~H~~~~h~~~~~~-~C~~C~~~~~~~~~l~~h~~~~~~~~~~~C~~C~~~~   94 (171)
                      .|..||-.|+--..|-.-+.  ++..+.| -|+.|.+.+.+..+    ++.|.  .+..|+.||-..
T Consensus       125 ~CT~CGPRfTIi~alPYDR~--nTsM~~F~lC~~C~~EY~dP~n----RRfHA--Qp~aCp~CGP~~  183 (750)
T COG0068         125 NCTNCGPRFTIIEALPYDRE--NTSMADFPLCPFCDKEYKDPLN----RRFHA--QPIACPKCGPHL  183 (750)
T ss_pred             ccCCCCcceeeeccCCCCcc--cCccccCcCCHHHHHHhcCccc----ccccc--ccccCcccCCCe
Confidence            49999999987777655443  3334444 49999998887754    34453  567899999743


No 203
>TIGR00515 accD acetyl-CoA carboxylase, carboxyl transferase, beta subunit. The enzyme acetyl-CoA carboxylase contains a biotin carboxyl carrier protein or domain, a biotin carboxylase, and a carboxyl transferase. This model represents the beta chain of the carboxyl transferase for cases in which the architecture of the protein is as in E. coli, in which the carboxyltransferase portion consists of two non-identical subnits, alpha and beta.
Probab=34.91  E-value=20  Score=26.15  Aligned_cols=11  Identities=36%  Similarity=1.126  Sum_probs=5.0

Q ss_pred             ccCcccccccC
Q psy12258        113 HFCPVCNKMFR  123 (171)
Q Consensus       113 ~~C~~C~~~f~  123 (171)
                      +.|+.|+.-|.
T Consensus        46 ~vc~~c~~h~r   56 (285)
T TIGR00515        46 EVCPKCDHHMR   56 (285)
T ss_pred             CCCCCCCCcCc
Confidence            34555554443


No 204
>smart00064 FYVE Protein present in Fab1, YOTB, Vac1, and EEA1. The FYVE zinc finger is named after four proteins where it was first found: Fab1, YOTB/ZK632.12, Vac1, and EEA1. The FYVE finger has been shown to bind two Zn2+ ions. The FYVE finger has eight potential zinc coordinating cysteine positions. The FYVE finger is structurally related to the COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair]
Probab=34.58  E-value=10  Score=31.36  Aligned_cols=11  Identities=36%  Similarity=0.875  Sum_probs=4.8

Q ss_pred             CCCeeCCccch
Q psy12258         25 LKPYGCEVCGR   35 (171)
Q Consensus        25 ~~~~~C~~C~~   35 (171)
                      ..|..|+.||.
T Consensus       473 ~~p~~Cp~Cgs  483 (730)
T COG1198         473 PIPQSCPECGS  483 (730)
T ss_pred             CCCCCCCCCCC
Confidence            34444444443


No 206
>COG1773 Rubredoxin [Energy production and conversion]
Probab=34.58  E-value=14  Score=19.52  Aligned_cols=12  Identities=25%  Similarity=0.739  Sum_probs=9.9

Q ss_pred             CccCcccccccC
Q psy12258        112 PHFCPVCNKMFR  123 (171)
Q Consensus       112 ~~~C~~C~~~f~  123 (171)
                      .|+|..||..|.
T Consensus         3 ~~~C~~CG~vYd   14 (55)
T COG1773           3 RWRCSVCGYVYD   14 (55)
T ss_pred             ceEecCCceEec
Confidence            478999998875


No 207
>PRK00420 hypothetical protein; Validated
Probab=34.46  E-value=24  Score=21.78  Aligned_cols=29  Identities=24%  Similarity=0.442  Sum_probs=16.3

Q ss_pred             eeCCccchhccCcccHHHhhhhcCCCCCcccccchhhhccC
Q psy12258         28 YGCEVCGRHFRQWGDLKYHKASLHSDVKAFQCEYCGKDFAR   68 (171)
Q Consensus        28 ~~C~~C~~~f~~~~~l~~H~~~~h~~~~~~~C~~C~~~~~~   68 (171)
                      -.|+.||..+...            ......|+.|+....-
T Consensus        24 ~~CP~Cg~pLf~l------------k~g~~~Cp~Cg~~~~v   52 (112)
T PRK00420         24 KHCPVCGLPLFEL------------KDGEVVCPVHGKVYIV   52 (112)
T ss_pred             CCCCCCCCcceec------------CCCceECCCCCCeeee
Confidence            4688888654221            0123568888875543


No 208
>COG3364 Zn-ribbon containing protein [General function prediction only]
Probab=34.31  E-value=22  Score=21.43  Aligned_cols=14  Identities=36%  Similarity=0.907  Sum_probs=7.8

Q ss_pred             CccCcccccccCCc
Q psy12258        112 PHFCPVCNKMFRVR  125 (171)
Q Consensus       112 ~~~C~~C~~~f~~~  125 (171)
                      |++|..||..|..-
T Consensus         2 pH~CtrCG~vf~~g   15 (112)
T COG3364           2 PHQCTRCGEVFDDG   15 (112)
T ss_pred             Cceecccccccccc
Confidence            34566666666553


No 209
>PF10276 zf-CHCC:  Zinc-finger domain;  InterPro: IPR019401 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.   This entry represents a short conserved zinc-finger domain. It contains the sequence motif Cx8Hx14Cx2C. ; PDB: 2JVM_A 2JRR_A 2JZ8_A.
Probab=33.75  E-value=16  Score=17.90  Aligned_cols=12  Identities=33%  Similarity=0.988  Sum_probs=9.6

Q ss_pred             CCeeCCccchhc
Q psy12258         26 KPYGCEVCGRHF   37 (171)
Q Consensus        26 ~~~~C~~C~~~f   37 (171)
                      ++..|++|+..|
T Consensus        28 ~~~~CpYCg~~y   39 (40)
T PF10276_consen   28 GPVVCPYCGTRY   39 (40)
T ss_dssp             CEEEETTTTEEE
T ss_pred             CeEECCCCCCEE
Confidence            457899999876


No 210
>cd00065 FYVE FYVE domain; Zinc-binding domain; targets proteins to membrane lipids via interaction with phosphatidylinositol-3-phosphate, PI3P; present in Fab1, YOTB, Vac1, and EEA1;
Probab=33.51  E-value=30  Score=17.84  Aligned_cols=8  Identities=50%  Similarity=1.369  Sum_probs=3.7

Q ss_pred             CCccchhc
Q psy12258         30 CEVCGRHF   37 (171)
Q Consensus        30 C~~C~~~f   37 (171)
                      |..|++.|
T Consensus         5 C~~C~~~F   12 (57)
T cd00065           5 CMGCGKPF   12 (57)
T ss_pred             CcccCccc
Confidence            44444444


No 211
>PF12773 DZR:  Double zinc ribbon
Probab=33.30  E-value=29  Score=17.43  Aligned_cols=10  Identities=30%  Similarity=0.723  Sum_probs=6.0

Q ss_pred             eCCccchhcc
Q psy12258         29 GCEVCGRHFR   38 (171)
Q Consensus        29 ~C~~C~~~f~   38 (171)
                      .|+.||..+.
T Consensus        14 fC~~CG~~l~   23 (50)
T PF12773_consen   14 FCPHCGTPLP   23 (50)
T ss_pred             CChhhcCChh
Confidence            4666666554


No 212
>PF05290 Baculo_IE-1:  Baculovirus immediate-early protein (IE-0);  InterPro: IPR007954 This entry contains the Baculovirus immediate-early protein IE-0.
Probab=33.15  E-value=22  Score=22.60  Aligned_cols=18  Identities=28%  Similarity=0.632  Sum_probs=11.4

Q ss_pred             CCCCcccccchhhhccCh
Q psy12258         52 SDVKAFQCEYCGKDFARK   69 (171)
Q Consensus        52 ~~~~~~~C~~C~~~~~~~   69 (171)
                      ...+.|+|..|.+++...
T Consensus        76 ~d~~lYeCnIC~etS~ee   93 (140)
T PF05290_consen   76 LDPKLYECNICKETSAEE   93 (140)
T ss_pred             cCCCceeccCcccccchh
Confidence            344567777777765544


No 213
>PF10013 DUF2256:  Uncharacterized protein conserved in bacteria (DUF2256);  InterPro: IPR017136 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function.
Probab=33.09  E-value=23  Score=17.55  Aligned_cols=13  Identities=46%  Similarity=1.145  Sum_probs=7.9

Q ss_pred             cCcccccccCCch
Q psy12258        114 FCPVCNKMFRVRS  126 (171)
Q Consensus       114 ~C~~C~~~f~~~~  126 (171)
                      .|++||+.|....
T Consensus        10 ~C~~C~rpf~WRK   22 (42)
T PF10013_consen   10 ICPVCGRPFTWRK   22 (42)
T ss_pred             cCcccCCcchHHH
Confidence            4666776666443


No 214
>PF11672 DUF3268:  Protein of unknown function (DUF3268);  InterPro: IPR021686 This entry is represented by Listeria phage P100, Gp150. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches.
Probab=33.01  E-value=12  Score=22.67  Aligned_cols=7  Identities=29%  Similarity=1.018  Sum_probs=3.5

Q ss_pred             ccCcccc
Q psy12258        113 HFCPVCN  119 (171)
Q Consensus       113 ~~C~~C~  119 (171)
                      |.|.-|+
T Consensus        32 y~C~~C~   38 (102)
T PF11672_consen   32 YVCTPCD   38 (102)
T ss_pred             EECCCCC
Confidence            4555554


No 215
>KOG2636|consensus
Probab=32.82  E-value=42  Score=26.08  Aligned_cols=28  Identities=21%  Similarity=0.597  Sum_probs=22.0

Q ss_pred             HHhcCCCCccCcccc-cccCCchhHHHHH
Q psy12258        105 RIHTGEKPHFCPVCN-KMFRVRSDMKRHL  132 (171)
Q Consensus       105 ~~h~~~~~~~C~~C~-~~f~~~~~l~~H~  132 (171)
                      ..|.-...|.|.+|| +++.-+..+.+|.
T Consensus       394 KLHGL~~ey~CEICGNy~Y~GrkaF~RHF  422 (497)
T KOG2636|consen  394 KLHGLDIEYNCEICGNYVYKGRKAFDRHF  422 (497)
T ss_pred             hhcCCCcccceeeccCccccCcHHHHHHh
Confidence            345666779999999 7888888888886


No 216
>PF02891 zf-MIZ:  MIZ/SP-RING zinc finger;  InterPro: IPR004181 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents MIZ-type zinc finger domains. Miz1 (Msx-interacting-zinc finger) is a zinc finger-containing protein with homology to the yeast protein, Nfi-1. Miz1 is a sequence specific DNA binding protein that can function as a positive-acting transcription factor. Miz1 binds to the homeobox protein Msx2, enhancing the specific DNA-binding ability of Msx2 []. Other proteins containing this domain include the human pias family (protein inhibitor of activated STAT protein). More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 3I2D_A.
Probab=32.37  E-value=18  Score=18.54  Aligned_cols=7  Identities=57%  Similarity=1.587  Sum_probs=2.0

Q ss_pred             ccCcccc
Q psy12258        113 HFCPVCN  119 (171)
Q Consensus       113 ~~C~~C~  119 (171)
                      |+|++|+
T Consensus        42 W~CPiC~   48 (50)
T PF02891_consen   42 WKCPICN   48 (50)
T ss_dssp             -B-TTT-
T ss_pred             eECcCCc
Confidence            4555544


No 217
>PF06397 Desulfoferrod_N:  Desulfoferrodoxin, N-terminal domain;  InterPro: IPR004462 This domain is found as essentially the full length of desulforedoxin, a 37-residue homodimeric non-haem iron protein. It is also found as the N-terminal domain of desulfoferrodoxin (rbo), a homodimeric non-haem iron protein with 2 Fe atoms per monomer in different oxidation states. This domain binds the ferric rather than the ferrous Fe of desulfoferrodoxin. Neelaredoxin, a monomeric blue non-haem iron protein, lacks this domain.; GO: 0005506 iron ion binding; PDB: 1DFX_A 1VZI_B 2JI2_D 1VZH_B 2JI3_C 2JI1_C 1VZG_A 1CFW_A 2LK5_B 1DHG_B ....
Probab=32.29  E-value=17  Score=17.38  Aligned_cols=12  Identities=17%  Similarity=0.451  Sum_probs=6.5

Q ss_pred             CCccCccccccc
Q psy12258        111 KPHFCPVCNKMF  122 (171)
Q Consensus       111 ~~~~C~~C~~~f  122 (171)
                      +.|+|..||...
T Consensus         5 ~~YkC~~CGniV   16 (36)
T PF06397_consen    5 EFYKCEHCGNIV   16 (36)
T ss_dssp             EEEE-TTT--EE
T ss_pred             cEEEccCCCCEE
Confidence            468999998654


No 218
>PRK04351 hypothetical protein; Provisional
Probab=32.07  E-value=12  Score=24.38  Aligned_cols=33  Identities=24%  Similarity=0.613  Sum_probs=19.4

Q ss_pred             CccCccchhhcCCHHHHHHHHHHhcCCCCccCcccccccCC
Q psy12258         84 NYQCEFCHKAFRASSYLQNHRRIHTGEKPHFCPVCNKMFRV  124 (171)
Q Consensus        84 ~~~C~~C~~~~~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~  124 (171)
                      .|.|..|+..+...      .+  .+...|.|..|+-.+..
T Consensus       112 ~Y~C~~Cg~~~~r~------Rr--~n~~~yrCg~C~g~L~~  144 (149)
T PRK04351        112 LYECQSCGQQYLRK------RR--INTKRYRCGKCRGKLKL  144 (149)
T ss_pred             EEECCCCCCEeeee------ee--cCCCcEEeCCCCcEeee
Confidence            47787787655332      11  13456888888766543


No 219
>PF01155 HypA:  Hydrogenase expression/synthesis hypA family;  InterPro: IPR000688 Bacterial membrane-bound nickel-dependent hydrogenases requires a number of accessory proteins which are involved in their maturation. The exact role of these proteins is not yet clear, but some seem to be required for the incorporation of the nickel ions []. One of these proteins is generally known as hypA. It is a protein of about 12 to 14 kDa that contains, in its C-terminal region, four conserved cysteines that form a zinc-finger like motif. Escherichia coli has two proteins that belong to this family, hypA and hybF. A homologue, MJ0214, has also been found in a number of archaeal species, including the genome of Methanocaldococcus jannaschii (Methanococcus jannaschii).; GO: 0016151 nickel ion binding, 0006464 protein modification process; PDB: 2KDX_A 3A44_D 3A43_B.
Probab=31.88  E-value=10  Score=23.27  Aligned_cols=13  Identities=23%  Similarity=0.657  Sum_probs=6.6

Q ss_pred             ccCccchhhcCCH
Q psy12258         85 YQCEFCHKAFRAS   97 (171)
Q Consensus        85 ~~C~~C~~~~~~~   97 (171)
                      +.|..|+..|...
T Consensus        71 ~~C~~Cg~~~~~~   83 (113)
T PF01155_consen   71 ARCRDCGHEFEPD   83 (113)
T ss_dssp             EEETTTS-EEECH
T ss_pred             EECCCCCCEEecC
Confidence            4566666665443


No 220
>PF15616 TerY-C:  TerY-C metal binding domain
Probab=31.59  E-value=8.5  Score=24.41  Aligned_cols=13  Identities=23%  Similarity=0.733  Sum_probs=8.5

Q ss_pred             CCcccccchhhhc
Q psy12258         54 VKAFQCEYCGKDF   66 (171)
Q Consensus        54 ~~~~~C~~C~~~~   66 (171)
                      .....|++|+..-
T Consensus       103 ~~~~~CPwCg~~g  115 (131)
T PF15616_consen  103 EGEVTCPWCGNEG  115 (131)
T ss_pred             CCCEECCCCCCee
Confidence            3456788888653


No 221
>PF10263 SprT-like:  SprT-like family;  InterPro: IPR006640 This is a family of uncharacterised bacterial proteins which includes Escherichia coli SprT (P39902 from SWISSPROT). SprT is described as a regulator of bolA gene in stationary phase []. The majority of members contain the metallopeptidase zinc binding signature which has a HExxH motif, however there is no evidence for them being metallopeptidases. 
Probab=31.57  E-value=8.6  Score=24.88  Aligned_cols=33  Identities=18%  Similarity=0.425  Sum_probs=19.1

Q ss_pred             CCccCccchhhcCCHHHHHHHHHHhcCCCCccCcccccccC
Q psy12258         83 RNYQCEFCHKAFRASSYLQNHRRIHTGEKPHFCPVCNKMFR  123 (171)
Q Consensus        83 ~~~~C~~C~~~~~~~~~l~~H~~~h~~~~~~~C~~C~~~f~  123 (171)
                      -.|.|+.|+..+.....      +  +...|.|+.|+..+.
T Consensus       122 ~~~~C~~C~~~~~r~~~------~--~~~~~~C~~C~~~l~  154 (157)
T PF10263_consen  122 YVYRCPSCGREYKRHRR------S--KRKRYRCGRCGGPLV  154 (157)
T ss_pred             eEEEcCCCCCEeeeecc------c--chhhEECCCCCCEEE
Confidence            35778888866533222      2  223378888886553


No 222
>TIGR00310 ZPR1_znf ZPR1 zinc finger domain.
Probab=31.05  E-value=6.9  Score=26.61  Aligned_cols=39  Identities=21%  Similarity=0.307  Sum_probs=22.3

Q ss_pred             CCCccccccCChhhHHHHHHHcCCC---CCeeCCccchhccCc
Q psy12258          1 MCDTCGKSFFSSTALKVHNRVHLGL---KPYGCEVCGRHFRQW   40 (171)
Q Consensus         1 ~C~~C~~~f~~~~~l~~H~~~h~~~---~~~~C~~C~~~f~~~   40 (171)
                      .|+.|+....+...+..+ --+.++   ..|.|+.||.....-
T Consensus         2 ~Cp~C~~~~~~~~~~~~~-IP~F~evii~sf~C~~CGyr~~ev   43 (192)
T TIGR00310         2 DCPSCGGECETVMKTVND-IPYFGEVLETSTICEHCGYRSNDV   43 (192)
T ss_pred             cCCCCCCCCEEEEEEEcC-CCCcceEEEEEEECCCCCCcccee
Confidence            488888654444443332 122222   358899999876543


No 223
>PF05495 zf-CHY:  CHY zinc finger;  InterPro: IPR008913 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  Pirh2 is an eukaryotic ubiquitin protein ligase, which has been shown to promote p53 degradation in mammals. Pirh2 physically interacts with p53 and promotes ubiquitination of p53 independently of MDM2. Like MDM2, Pirh2 is thought to participate in an autoregulatory feedback loop that controls p53 function. Pirh2 proteins contain three distinct zinc fingers, the CHY-type, the CTCHY-type which is C-terminal to the CHY-type zinc finger and a RING finger. The CHY-type zinc finger has no currently known function []. As well as Pirh2, the CHY-type zinc finger is also found in the following proteins:   Yeast helper of Tim protein 13. Hot13 may have a role in the assembly and recycling of the small Tims, a complex of the mitochondrial intermembrane space that participates in the TIM22 import pathway for assembly of the inner membrane [] Several plant hypothetical proteins that also contain haemerythrin cation binding domains Several protozoan hypothetical proteins that also contain a Myb domain   The solution structure of this zinc finger has been solved and binds 3 zinc atoms as shown in the following schematic representation:   ++---------+-----+ || | | CXHYxxxxxxxxxCCxxxxxCxxCHxxxxxHxxxxxxxxxxxCxxCxxxxxxxxxCxxC | | | | | | | | +-+-----------------+--+ +--+---------+--+ 'C': conserved cysteine involved in the binding of one zinc atom. 'H': conserved histidine involved in the binding of one zinc atom.  More information about these proteins can be found at Protein of the Month: Zinc Fingers []; GO: 0008270 zinc ion binding; PDB: 2DKT_A 2K2C_A.
Probab=30.79  E-value=5.8  Score=22.13  Aligned_cols=9  Identities=44%  Similarity=1.335  Sum_probs=4.5

Q ss_pred             CccCccccc
Q psy12258        112 PHFCPVCNK  120 (171)
Q Consensus       112 ~~~C~~C~~  120 (171)
                      .|.|+.|+.
T Consensus        61 ~~~C~~C~~   69 (71)
T PF05495_consen   61 DYFCPICGL   69 (71)
T ss_dssp             SEEETTTTE
T ss_pred             CccCcCcCC
Confidence            355555543


No 224
>CHL00174 accD acetyl-CoA carboxylase beta subunit; Reviewed
Probab=30.64  E-value=17  Score=26.56  Aligned_cols=11  Identities=36%  Similarity=0.800  Sum_probs=5.1

Q ss_pred             ccccchhhhcc
Q psy12258         57 FQCEYCGKDFA   67 (171)
Q Consensus        57 ~~C~~C~~~~~   67 (171)
                      +.|+.|+..|.
T Consensus        58 ~vcp~c~~h~r   68 (296)
T CHL00174         58 NICEQCGYHLK   68 (296)
T ss_pred             CCCCCCCCCcC
Confidence            34555554443


No 225
>PTZ00448 hypothetical protein; Provisional
Probab=30.46  E-value=36  Score=25.74  Aligned_cols=23  Identities=22%  Similarity=0.457  Sum_probs=20.7

Q ss_pred             CccCcccccccCCchhHHHHHHH
Q psy12258        112 PHFCPVCNKMFRVRSDMKRHLNT  134 (171)
Q Consensus       112 ~~~C~~C~~~f~~~~~l~~H~~~  134 (171)
                      .|.|..|+..|.+....+.|+++
T Consensus       314 ~~tC~~C~v~F~~~~~qR~H~KS  336 (373)
T PTZ00448        314 MLLCRKCNIQLMDHNAFKQHYRS  336 (373)
T ss_pred             CccccccccccCCHHHHHHHhhh
Confidence            58899999999999999999875


No 226
>PF15176 LRR19-TM:  Leucine-rich repeat family 19 TM domain
Probab=30.30  E-value=19  Score=21.64  Aligned_cols=12  Identities=33%  Similarity=0.512  Sum_probs=6.9

Q ss_pred             cCcccccccCCc
Q psy12258        114 FCPVCNKMFRVR  125 (171)
Q Consensus       114 ~C~~C~~~f~~~  125 (171)
                      +|+.|-+-|.++
T Consensus        39 KC~~~~k~~~SY   50 (102)
T PF15176_consen   39 KCPVWYKYLASY   50 (102)
T ss_pred             HhHHHHHHHhcc
Confidence            566666555544


No 227
>COG4338 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=30.30  E-value=14  Score=18.84  Aligned_cols=9  Identities=33%  Similarity=1.058  Sum_probs=4.5

Q ss_pred             CCccccccC
Q psy12258          2 CDTCGKSFF   10 (171)
Q Consensus         2 C~~C~~~f~   10 (171)
                      |+.|+..|.
T Consensus        15 CpvCqRPFs   23 (54)
T COG4338          15 CPVCQRPFS   23 (54)
T ss_pred             hhhhcCchH
Confidence            555555443


No 228
>KOG0978|consensus
Probab=30.14  E-value=14  Score=30.41  Aligned_cols=17  Identities=29%  Similarity=0.616  Sum_probs=10.9

Q ss_pred             CccCcccccccCCchhH
Q psy12258        112 PHFCPVCNKMFRVRSDM  128 (171)
Q Consensus       112 ~~~C~~C~~~f~~~~~l  128 (171)
                      .-+||.|+.+|..-.-+
T Consensus       678 qRKCP~Cn~aFganDv~  694 (698)
T KOG0978|consen  678 QRKCPKCNAAFGANDVH  694 (698)
T ss_pred             cCCCCCCCCCCCccccc
Confidence            34788888887654433


No 229
>COG3677 Transposase and inactivated derivatives [DNA replication, recombination, and repair]
Probab=29.10  E-value=27  Score=22.10  Aligned_cols=35  Identities=23%  Similarity=0.501  Sum_probs=21.5

Q ss_pred             ccCccchhhcCCHHHHHHHHHHhcCCCCccCcccccccCC
Q psy12258         85 YQCEFCHKAFRASSYLQNHRRIHTGEKPHFCPVCNKMFRV  124 (171)
Q Consensus        85 ~~C~~C~~~~~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~  124 (171)
                      ..||.|+...     ...+-..-.+...|+|+.|++.|..
T Consensus        31 ~~cP~C~s~~-----~~k~g~~~~~~qRyrC~~C~~tf~~   65 (129)
T COG3677          31 VNCPRCKSSN-----VVKIGGIRRGHQRYKCKSCGSTFTV   65 (129)
T ss_pred             CcCCCCCccc-----eeeECCccccccccccCCcCcceee
Confidence            4788887443     1111112233567999999999974


No 230
>PF14205 Cys_rich_KTR:  Cysteine-rich KTR
Probab=28.61  E-value=15  Score=19.27  Aligned_cols=8  Identities=38%  Similarity=0.970  Sum_probs=3.4

Q ss_pred             CeeCCccc
Q psy12258         27 PYGCEVCG   34 (171)
Q Consensus        27 ~~~C~~C~   34 (171)
                      |.-|+.|.
T Consensus        28 PlyCpKCK   35 (55)
T PF14205_consen   28 PLYCPKCK   35 (55)
T ss_pred             cccCCCCC
Confidence            34444443


No 231
>PF08792 A2L_zn_ribbon:  A2L zinc ribbon domain;  InterPro: IPR014900 This zinc ribbon protein is found associated with some viral A2L transcription factors []. 
Probab=28.36  E-value=24  Score=16.37  Aligned_cols=13  Identities=23%  Similarity=0.606  Sum_probs=7.6

Q ss_pred             CCccCcccccccC
Q psy12258        111 KPHFCPVCNKMFR  123 (171)
Q Consensus       111 ~~~~C~~C~~~f~  123 (171)
                      ..+.|..||..|.
T Consensus        20 ~~~~C~~Cg~~~~   32 (33)
T PF08792_consen   20 DYEVCIFCGSSFP   32 (33)
T ss_pred             CeEEcccCCcEee
Confidence            3456666666553


No 232
>COG4391 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=28.31  E-value=34  Score=18.52  Aligned_cols=13  Identities=23%  Similarity=0.667  Sum_probs=9.8

Q ss_pred             CCeeCCccchhcc
Q psy12258         26 KPYGCEVCGRHFR   38 (171)
Q Consensus        26 ~~~~C~~C~~~f~   38 (171)
                      +...|++|+..|.
T Consensus        47 gev~CPYC~t~y~   59 (62)
T COG4391          47 GEVVCPYCSTRYR   59 (62)
T ss_pred             CcEecCccccEEE
Confidence            4467999988875


No 233
>PF14803 Nudix_N_2:  Nudix N-terminal; PDB: 3CNG_C.
Probab=28.18  E-value=8.8  Score=18.03  Aligned_cols=8  Identities=38%  Similarity=1.003  Sum_probs=4.0

Q ss_pred             ccccchhh
Q psy12258         57 FQCEYCGK   64 (171)
Q Consensus        57 ~~C~~C~~   64 (171)
                      +.|+.|+.
T Consensus        23 ~vC~~Cg~   30 (34)
T PF14803_consen   23 LVCPACGF   30 (34)
T ss_dssp             EEETTTTE
T ss_pred             eECCCCCC
Confidence            45555544


No 234
>PRK05654 acetyl-CoA carboxylase subunit beta; Validated
Probab=28.16  E-value=20  Score=26.21  Aligned_cols=11  Identities=27%  Similarity=0.739  Sum_probs=6.3

Q ss_pred             ccccchhhhcc
Q psy12258         57 FQCEYCGKDFA   67 (171)
Q Consensus        57 ~~C~~C~~~~~   67 (171)
                      +.|+.|+..|.
T Consensus        47 ~vc~~c~~h~r   57 (292)
T PRK05654         47 NVCPKCGHHMR   57 (292)
T ss_pred             CCCCCCCCCee
Confidence            45666665554


No 235
>PF02318 FYVE_2:  FYVE-type zinc finger;  InterPro: IPR003315 This entry represents the zinc-binding domain found in rabphilin Rab3A. The small G protein Rab3A plays an important role in the regulation of neurotransmitter release. The crystal structure of the small G protein Rab3A complexed with the effector domain of rabphilin-3A shows that the effector domain of rabphilin-3A contacts Rab3A in two distinct areas. The first interface involves the Rab3A switch I and switch II regions, which are sensitive to the nucleotide-binding state of Rab3A. The second interface consists of a deep pocket in Rab3A that interacts with a SGAWFF structural element of rabphilin-3A. Sequence and structure analysis, and biochemical data suggest that this pocket, or Rab complementarity-determining region (RabCDR), establishes a specific interaction between each Rab protein and its effectors. It has been suggested that RabCDRs could be major determinants of effector specificity during vesicle trafficking and fusion [].; GO: 0008270 zinc ion binding, 0017137 Rab GTPase binding, 0006886 intracellular protein transport; PDB: 2CSZ_A 2ZET_C 1ZBD_B 3BC1_B 2CJS_C 2A20_A.
Probab=27.81  E-value=30  Score=21.39  Aligned_cols=14  Identities=29%  Similarity=0.662  Sum_probs=8.0

Q ss_pred             CCeeCCccchhccC
Q psy12258         26 KPYGCEVCGRHFRQ   39 (171)
Q Consensus        26 ~~~~C~~C~~~f~~   39 (171)
                      ....|..|+..|..
T Consensus        53 ~~~~C~~C~~~fg~   66 (118)
T PF02318_consen   53 GERHCARCGKPFGF   66 (118)
T ss_dssp             CCSB-TTTS-BCSC
T ss_pred             CCcchhhhCCcccc
Confidence            34578889887743


No 236
>TIGR00143 hypF [NiFe] hydrogenase maturation protein HypF. A previously described regulatory effect of HypF mutatation is attributable to loss of activity of a regulatory hydrogenase. A zinc finger-like region CXXCX(18)CXXCX(24)CXXCX(18)CXXC region further supported the regulatory hypothesis. However, more recent work (PUBMED:11375153) shows the direct effect is on the activity of expressed hydrogenases with nickel/iron centers, rather than on expression.
Probab=27.47  E-value=7.8  Score=32.05  Aligned_cols=60  Identities=23%  Similarity=0.457  Sum_probs=32.2

Q ss_pred             ccccchhhhccChHHHHHHHhhhcCCCCccCccchhhcCCHHHHHHHHHHhcCCCCccCccccccc
Q psy12258         57 FQCEYCGKDFARKYSLVVHRRIHTGERNYQCEFCHKAFRASSYLQNHRRIHTGEKPHFCPVCNKMF  122 (171)
Q Consensus        57 ~~C~~C~~~~~~~~~l~~h~~~~~~~~~~~C~~C~~~~~~~~~l~~H~~~h~~~~~~~C~~C~~~f  122 (171)
                      ..|..||-.|+-...|.--...-.-..---|+.|.+.+.+....+.|      -.+.-|+.||-..
T Consensus        91 ~nCt~CGPr~~i~~~lpydr~~t~m~~f~~C~~C~~ey~~p~~rr~h------~~~~~C~~Cgp~l  150 (711)
T TIGR00143        91 ISCTHCGPRFTIIEALPYDRENTSMADFPLCPDCAKEYKDPLDRRFH------AQPIACPRCGPQL  150 (711)
T ss_pred             ccccCCCCCeEEeecCCCCCCCcCCCCCcCCHHHHHHhcCCccccCC------CCCccCCCCCcEE
Confidence            35777887666443322111111111223578888777666554433      3456788888654


No 237
>PF14369 zf-RING_3:  zinc-finger
Probab=27.40  E-value=29  Score=16.33  Aligned_cols=8  Identities=38%  Similarity=1.124  Sum_probs=4.2

Q ss_pred             CCcccccc
Q psy12258          2 CDTCGKSF    9 (171)
Q Consensus         2 C~~C~~~f    9 (171)
                      ||.|+..|
T Consensus        24 CP~C~~gF   31 (35)
T PF14369_consen   24 CPRCHGGF   31 (35)
T ss_pred             CcCCCCcE
Confidence            55555544


No 238
>KOG3214|consensus
Probab=26.15  E-value=14  Score=22.09  Aligned_cols=14  Identities=21%  Similarity=0.693  Sum_probs=9.5

Q ss_pred             CCccCcccccccCC
Q psy12258        111 KPHFCPVCNKMFRV  124 (171)
Q Consensus       111 ~~~~C~~C~~~f~~  124 (171)
                      ....|.+|+.+|..
T Consensus        46 G~~sC~iC~esFqt   59 (109)
T KOG3214|consen   46 GKASCRICEESFQT   59 (109)
T ss_pred             ceeeeeehhhhhcc
Confidence            34567778777764


No 239
>KOG0717|consensus
Probab=25.82  E-value=45  Score=26.10  Aligned_cols=23  Identities=26%  Similarity=0.573  Sum_probs=20.6

Q ss_pred             ccCcccccccCCchhHHHHHHHh
Q psy12258        113 HFCPVCNKMFRVRSDMKRHLNTH  135 (171)
Q Consensus       113 ~~C~~C~~~f~~~~~l~~H~~~h  135 (171)
                      ..|.-|+.+|.++..|..|++..
T Consensus       461 ~~C~tCr~~FdSRnkLF~Hlk~t  483 (508)
T KOG0717|consen  461 ISCTTCRESFDSRNKLFAHLKKT  483 (508)
T ss_pred             HhhhhhhhhccchhHHHHHhhhc
Confidence            57999999999999999999753


No 240
>PF06220 zf-U1:  U1 zinc finger;  InterPro: IPR013085 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  C2H2-type (classical) zinc fingers (Znf) were the first class to be characterised. They contain a short beta hairpin and an alpha helix (beta/beta/alpha structure), where a single zinc atom is held in place by Cys(2)His(2) (C2H2) residues in a tetrahedral array. C2H2 Znf's can be divided into three groups based on the number and pattern of fingers: triple-C2H2 (binds single ligand), multiple-adjacent-C2H2 (binds multiple ligands), and separated paired-C2H2 []. C2H2 Znf's are the most common DNA-binding motifs found in eukaryotic transcription factors, and have also been identified in prokaryotes []. Transcription factors usually contain several Znf's (each with a conserved beta/beta/alpha structure) capable of making multiple contacts along the DNA, where the C2H2 Znf motifs recognise DNA sequences by binding to the major groove of DNA via a short alpha-helix in the Znf, the Znf spanning 3-4 bases of the DNA []. C2H2 Znf's can also bind to RNA and protein targets []. This entry represents a C2H2-type zinc finger motif found in several U1 small nuclear ribonucleoprotein C (U1-C) proteins. Some proteins contain multiple copies of this motif. The U1 small nuclear ribonucleoprotein (U1 snRNP) binds to the pre-mRNA 5' splice site at early stages of spliceosome assembly. Recruitment of U1 to a class of weak 5' splice site is promoted by binding of the protein TIA-1 to uridine-rich sequences immediately downstream from the 5' splice site. Binding of TIA-1 in the vicinity of a 5' splice site helps to stabilise U1 snRNP recruitment, at least in part, via a direct interaction with U1-C, thus providing one molecular mechanism for the function of this splicing regulator []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 2VRD_A.
Probab=25.72  E-value=40  Score=16.19  Aligned_cols=11  Identities=27%  Similarity=0.896  Sum_probs=3.8

Q ss_pred             eeCCccchhcc
Q psy12258         28 YGCEVCGRHFR   38 (171)
Q Consensus        28 ~~C~~C~~~f~   38 (171)
                      |-|+.|...|.
T Consensus         4 yyCdyC~~~~~   14 (38)
T PF06220_consen    4 YYCDYCKKYLT   14 (38)
T ss_dssp             -B-TTT--B-S
T ss_pred             eecccccceec
Confidence            56777776663


No 241
>KOG0782|consensus
Probab=25.64  E-value=21  Score=28.68  Aligned_cols=26  Identities=31%  Similarity=0.556  Sum_probs=11.6

Q ss_pred             HHHHHHHcCCCCCeeCCccchhccCc
Q psy12258         15 LKVHNRVHLGLKPYGCEVCGRHFRQW   40 (171)
Q Consensus        15 l~~H~~~h~~~~~~~C~~C~~~f~~~   40 (171)
                      |.+|-=+|....--.|..|++.|-+.
T Consensus       241 fvrHHWVHrrRqeGkC~~CgKgFQQK  266 (1004)
T KOG0782|consen  241 FVRHHWVHRRRQEGKCNTCGKGFQQK  266 (1004)
T ss_pred             chHHhHhhHhhhccccchhhhhhhhh
Confidence            33343333333333466666655443


No 242
>PRK03681 hypA hydrogenase nickel incorporation protein; Validated
Probab=25.29  E-value=23  Score=21.78  Aligned_cols=28  Identities=21%  Similarity=0.489  Sum_probs=17.2

Q ss_pred             CCeeCCccchhccCcccHHHhhhhcCCCCCcccccchhhh
Q psy12258         26 KPYGCEVCGRHFRQWGDLKYHKASLHSDVKAFQCEYCGKD   65 (171)
Q Consensus        26 ~~~~C~~C~~~f~~~~~l~~H~~~~h~~~~~~~C~~C~~~   65 (171)
                      ..+.|..|+..|.....            ..+.|+.|+..
T Consensus        69 ~~~~C~~Cg~~~~~~~~------------~~~~CP~Cgs~   96 (114)
T PRK03681         69 AECWCETCQQYVTLLTQ------------RVRRCPQCHGD   96 (114)
T ss_pred             cEEEcccCCCeeecCCc------------cCCcCcCcCCC
Confidence            44788899876643321            11468888853


No 243
>PF04810 zf-Sec23_Sec24:  Sec23/Sec24 zinc finger;  InterPro: IPR006895 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  COPII (coat protein complex II)-coated vesicles carry proteins from the endoplasmic reticulum (ER) to the Golgi complex []. COPII-coated vesicles form on the ER by the stepwise recruitment of three cytosolic components: Sar1-GTP to initiate coat formation, Sec23/24 heterodimer to select SNARE and cargo molecules, and Sec13/31 to induce coat polymerisation and membrane deformation [].  Sec23 p and Sec24p are structurally related, folding into five distinct domains: a beta-barrel, a zinc-finger, an alpha/beta trunk domain (IPR006896 from INTERPRO), an all-helical region (IPR006900 from INTERPRO), and a C-terminal gelsolin-like domain (IPR007123 from INTERPRO). This entry describes an approximately 55-residue Sec23/24 zinc-binding domain, which lies against the beta-barrel at the periphery of the complex. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0006886 intracellular protein transport, 0006888 ER to Golgi vesicle-mediated transport, 0030127 COPII vesicle coat; PDB: 3EFO_B 3EG9_B 3EGD_A 2YRC_A 2NUP_A 2YRD_A 3EGX_A 2NUT_A 3EH1_A 1PD0_A ....
Probab=25.26  E-value=46  Score=16.04  Aligned_cols=9  Identities=33%  Similarity=1.405  Sum_probs=3.4

Q ss_pred             cccccchhh
Q psy12258         56 AFQCEYCGK   64 (171)
Q Consensus        56 ~~~C~~C~~   64 (171)
                      .|.|..|+.
T Consensus        24 ~w~C~~C~~   32 (40)
T PF04810_consen   24 TWICNFCGT   32 (40)
T ss_dssp             EEEETTT--
T ss_pred             EEECcCCCC
Confidence            345555543


No 244
>PF08790 zf-LYAR:  LYAR-type C2HC zinc finger ;  InterPro: IPR014898 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This C2HC zinc finger domain is found in LYAR proteins such as Q08288 from SWISSPROT, which are involved in cell growth regulation.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 1WJV_A.
Probab=24.52  E-value=18  Score=16.18  Aligned_cols=9  Identities=33%  Similarity=1.047  Sum_probs=5.0

Q ss_pred             eCCccchhc
Q psy12258         29 GCEVCGRHF   37 (171)
Q Consensus        29 ~C~~C~~~f   37 (171)
                      .|-.|++.|
T Consensus         2 sCiDC~~~F   10 (28)
T PF08790_consen    2 SCIDCSKDF   10 (28)
T ss_dssp             EETTTTEEE
T ss_pred             eeecCCCCc
Confidence            455555555


No 245
>PTZ00043 cytochrome c oxidase subunit; Provisional
Probab=24.25  E-value=36  Score=23.82  Aligned_cols=16  Identities=19%  Similarity=0.422  Sum_probs=13.2

Q ss_pred             CCCCccCcccccccCC
Q psy12258        109 GEKPHFCPVCNKMFRV  124 (171)
Q Consensus       109 ~~~~~~C~~C~~~f~~  124 (171)
                      ..++.+|+.||..|..
T Consensus       178 EGkpqRCpECGqVFKL  193 (268)
T PTZ00043        178 EGFLYRCGECDQIFML  193 (268)
T ss_pred             CCCCccCCCCCcEEEE
Confidence            4568999999998874


No 246
>PF09855 DUF2082:  Nucleic-acid-binding protein containing Zn-ribbon domain (DUF2082);  InterPro: IPR018652  This family of proteins contains various hypothetical prokaryotic proteins as well as some Zn-ribbon nucleic-acid-binding proteins.
Probab=24.06  E-value=34  Score=18.74  Aligned_cols=9  Identities=33%  Similarity=0.837  Sum_probs=6.5

Q ss_pred             ccCcccccc
Q psy12258        113 HFCPVCNKM  121 (171)
Q Consensus       113 ~~C~~C~~~  121 (171)
                      |.|++||-.
T Consensus         1 y~C~KCg~~    9 (64)
T PF09855_consen    1 YKCPKCGNE    9 (64)
T ss_pred             CCCCCCCCc
Confidence            678888853


No 247
>COG5188 PRP9 Splicing factor 3a, subunit 3 [RNA processing and modification]
Probab=23.85  E-value=61  Score=24.42  Aligned_cols=28  Identities=21%  Similarity=0.564  Sum_probs=21.6

Q ss_pred             HHhcCCCCccCcccc-cccCCchhHHHHH
Q psy12258        105 RIHTGEKPHFCPVCN-KMFRVRSDMKRHL  132 (171)
Q Consensus       105 ~~h~~~~~~~C~~C~-~~f~~~~~l~~H~  132 (171)
                      ..|.-.+.|.|.+|| +++.-+..+.+|.
T Consensus       367 klhgLd~ef~CEICgNyvy~GR~~FdrHF  395 (470)
T COG5188         367 KLHGLDIEFECEICGNYVYYGRDRFDRHF  395 (470)
T ss_pred             HhcCCCcceeeeecccccccchHHHHhhh
Confidence            456667789999999 7777777777776


No 248
>KOG4118|consensus
Probab=23.61  E-value=58  Score=17.84  Aligned_cols=26  Identities=23%  Similarity=0.336  Sum_probs=21.5

Q ss_pred             eeCCccchhccCcccHHHhhhhcCCC
Q psy12258         28 YGCEVCGRHFRQWGDLKYHKASLHSD   53 (171)
Q Consensus        28 ~~C~~C~~~f~~~~~l~~H~~~~h~~   53 (171)
                      |.|..|-........+..|...-|+.
T Consensus        39 ~kCtVC~~~mpdpktfkqhfe~kHpk   64 (74)
T KOG4118|consen   39 HKCTVCMVQMPDPKTFKQHFENKHPK   64 (74)
T ss_pred             hhhHhhHhhCCCCchHHHHHhhcCCC
Confidence            78999998888888888888766654


No 249
>KOG4377|consensus
Probab=23.43  E-value=23  Score=27.05  Aligned_cols=21  Identities=24%  Similarity=0.406  Sum_probs=16.8

Q ss_pred             cccccCCchhHHHHHHHhccC
Q psy12258        118 CNKMFRVRSDMKRHLNTHNVD  138 (171)
Q Consensus       118 C~~~f~~~~~l~~H~~~h~~~  138 (171)
                      |+..+.+.+.+..|.|.|-..
T Consensus       409 c~~tl~s~sqm~shkrkheRq  429 (480)
T KOG4377|consen  409 CEATLYSVSQMASHKRKHERQ  429 (480)
T ss_pred             CceEEEehhhhhhhhhhhhhh
Confidence            778888888999998887544


No 250
>TIGR00595 priA primosomal protein N'. All proteins in this family for which functions are known are components of the primosome which is involved in replication, repair, and recombination.This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=23.31  E-value=8.5  Score=30.42  Aligned_cols=14  Identities=29%  Similarity=0.714  Sum_probs=9.0

Q ss_pred             hcCCCCccCccccc
Q psy12258        107 HTGEKPHFCPVCNK  120 (171)
Q Consensus       107 h~~~~~~~C~~C~~  120 (171)
                      +...-|..|+.||.
T Consensus       248 ~~~~~~~~Cp~C~s  261 (505)
T TIGR00595       248 YQEPIPKTCPQCGS  261 (505)
T ss_pred             CcCCCCCCCCCCCC
Confidence            33345677888875


No 251
>KOG4317|consensus
Probab=23.14  E-value=20  Score=26.35  Aligned_cols=20  Identities=25%  Similarity=0.645  Sum_probs=14.6

Q ss_pred             CccCccchhhcCCHHHHHHH
Q psy12258         84 NYQCEFCHKAFRASSYLQNH  103 (171)
Q Consensus        84 ~~~C~~C~~~~~~~~~l~~H  103 (171)
                      .|.||.|+..|.+..-++.|
T Consensus        19 ~YtCPRCn~~YCsl~CYr~h   38 (383)
T KOG4317|consen   19 EYTCPRCNLLYCSLKCYRNH   38 (383)
T ss_pred             cccCCCCCccceeeeeecCC
Confidence            48888888887776665555


No 252
>KOG4727|consensus
Probab=22.84  E-value=37  Score=22.61  Aligned_cols=23  Identities=22%  Similarity=0.362  Sum_probs=20.3

Q ss_pred             CCeeCCccchhccCcccHHHhhh
Q psy12258         26 KPYGCEVCGRHFRQWGDLKYHKA   48 (171)
Q Consensus        26 ~~~~C~~C~~~f~~~~~l~~H~~   48 (171)
                      ..|-|++|.-+|...-++..|++
T Consensus        74 ~GyyCdVCdcvvKDSinflDHiN   96 (193)
T KOG4727|consen   74 GGYYCDVCDCVVKDSINFLDHIN   96 (193)
T ss_pred             CceeeeecceeehhhHHHHHHhc
Confidence            35899999999999999999976


No 253
>PRK00762 hypA hydrogenase nickel incorporation protein; Provisional
Probab=22.69  E-value=21  Score=22.37  Aligned_cols=11  Identities=18%  Similarity=0.289  Sum_probs=6.5

Q ss_pred             ccCccchhhcCC
Q psy12258         85 YQCEFCHKAFRA   96 (171)
Q Consensus        85 ~~C~~C~~~~~~   96 (171)
                      +.| .|+..|..
T Consensus        71 ~~C-~Cg~~~~~   81 (124)
T PRK00762         71 IEC-ECGYEGVV   81 (124)
T ss_pred             EEe-eCcCcccc
Confidence            567 67755543


No 254
>PF07295 DUF1451:  Protein of unknown function (DUF1451);  InterPro: IPR009912 This family consists of several hypothetical bacterial proteins of around 160 residues in length. Members of this family contain four highly conserved cysteine resides toward the C-terminal region of the protein. The function of this family is unknown.
Probab=22.50  E-value=15  Score=23.80  Aligned_cols=29  Identities=24%  Similarity=0.578  Sum_probs=16.9

Q ss_pred             CCccCccchhhcCCHHHHHHHHHHhcCCCCccCcccccc
Q psy12258         83 RNYQCEFCHKAFRASSYLQNHRRIHTGEKPHFCPVCNKM  121 (171)
Q Consensus        83 ~~~~C~~C~~~~~~~~~l~~H~~~h~~~~~~~C~~C~~~  121 (171)
                      ..|.|..||....          ..+....-.|+.||..
T Consensus       111 G~l~C~~Cg~~~~----------~~~~~~l~~Cp~C~~~  139 (146)
T PF07295_consen  111 GTLVCENCGHEVE----------LTHPERLPPCPKCGHT  139 (146)
T ss_pred             ceEecccCCCEEE----------ecCCCcCCCCCCCCCC
Confidence            3477888875431          1123445678888754


No 255
>TIGR01384 TFS_arch transcription factor S, archaeal. There has been an apparent duplication event in the Halobacteriaceae lineage (Haloarcula, Haloferax, Haloquadratum, Halobacterium and Natromonas). There appears to be a separate duplication in Methanosphaera stadtmanae.
Probab=22.48  E-value=12  Score=22.40  Aligned_cols=39  Identities=18%  Similarity=0.449  Sum_probs=20.4

Q ss_pred             CeeCCccchhccCcccHHHhhhh-cCCCCCcccccchhhhcc
Q psy12258         27 PYGCEVCGRHFRQWGDLKYHKAS-LHSDVKAFQCEYCGKDFA   67 (171)
Q Consensus        27 ~~~C~~C~~~f~~~~~l~~H~~~-~h~~~~~~~C~~C~~~~~   67 (171)
                      ...|+.||..-.....++  ++. .-....-|.|..|+..+.
T Consensus        62 ~~~Cp~Cg~~~a~f~~~Q--~RsadE~~T~fy~C~~C~~~w~  101 (104)
T TIGR01384        62 RVECPKCGHKEAYYWLLQ--TRRADEPETRFYKCTKCGYVWR  101 (104)
T ss_pred             cCCCCCCCCCeeEEEEec--cCCCCCCcEEEEEeCCCCCeeE
Confidence            367999986533223222  111 111223488988887553


No 256
>PF04438 zf-HIT:  HIT zinc finger;  InterPro: IPR007529 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents the HIT-type zinc finger, which contains 7 conserved cysteines and one histidine that can potentially coordinate two zinc atoms. It has been named after the first protein that originally defined the domain: the yeast HIT1 protein (P46973 from SWISSPROT) []. The HIT-type zinc finger displays some sequence similarities to the MYND-type zinc finger. The function of this domain is unknown but it is mainly found in nuclear proteins involved in gene regulation and chromatin remodeling. This domain is also found in the thyroid receptor interacting protein 3 (TRIP-3) Q15649 from SWISSPROT, that specifically interacts with the ligand binding domain of the thyroid receptor. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 2YQP_A 2YQQ_A 1X4S_A.
Probab=22.08  E-value=30  Score=15.62  Aligned_cols=11  Identities=27%  Similarity=0.787  Sum_probs=4.9

Q ss_pred             CccCccccccc
Q psy12258        112 PHFCPVCNKMF  122 (171)
Q Consensus       112 ~~~C~~C~~~f  122 (171)
                      .|.|+.|+..+
T Consensus        13 kY~Cp~C~~~~   23 (30)
T PF04438_consen   13 KYRCPRCGARY   23 (30)
T ss_dssp             SEE-TTT--EE
T ss_pred             EEECCCcCCce
Confidence            46777776554


No 257
>COG5112 UFD2 U1-like Zn-finger-containing protein [General function prediction only]
Probab=21.49  E-value=35  Score=20.71  Aligned_cols=24  Identities=29%  Similarity=0.306  Sum_probs=17.8

Q ss_pred             CCeeCCccchhccCcccHHHhhhh
Q psy12258         26 KPYGCEVCGRHFRQWGDLKYHKAS   49 (171)
Q Consensus        26 ~~~~C~~C~~~f~~~~~l~~H~~~   49 (171)
                      ..|-|-.|.+-|.....|..|.+.
T Consensus        54 GqhYCieCaryf~t~~aL~~Hkkg   77 (126)
T COG5112          54 GQHYCIECARYFITEKALMEHKKG   77 (126)
T ss_pred             ceeeeehhHHHHHHHHHHHHHhcc
Confidence            447788888888888888877653


No 258
>KOG2272|consensus
Probab=21.26  E-value=48  Score=23.68  Aligned_cols=13  Identities=31%  Similarity=0.723  Sum_probs=8.6

Q ss_pred             CCccCcccccccC
Q psy12258        111 KPHFCPVCNKMFR  123 (171)
Q Consensus       111 ~~~~C~~C~~~f~  123 (171)
                      .-|.|..|.+.|-
T Consensus       220 eHFvCa~CekPFl  232 (332)
T KOG2272|consen  220 EHFVCAKCEKPFL  232 (332)
T ss_pred             hheeehhcCCccc
Confidence            3467777777764


No 259
>PF11781 RRN7:  RNA polymerase I-specific transcription initiation factor Rrn7;  InterPro: IPR021752  Rrn7 is a transcription binding factor that associates strongly with both Rrn6 and Rrn11 to form a complex which itself binds the TATA-binding protein and is required for transcription by the core domain of the RNA PolI promoter [],[]. 
Probab=21.18  E-value=38  Score=16.06  Aligned_cols=9  Identities=44%  Similarity=1.058  Sum_probs=5.0

Q ss_pred             eeCCccchh
Q psy12258         28 YGCEVCGRH   36 (171)
Q Consensus        28 ~~C~~C~~~   36 (171)
                      ..|++|+..
T Consensus         9 ~~C~~C~~~   17 (36)
T PF11781_consen    9 EPCPVCGSR   17 (36)
T ss_pred             CcCCCCCCe
Confidence            346666554


No 260
>PF01215 COX5B:  Cytochrome c oxidase subunit Vb This family consists of chains F and S ;  InterPro: IPR002124 Cytochrome c oxidase (1.9.3.1 from EC) is an oligomeric enzymatic complex which is a component of the respiratory chain complex and is involved in the transfer of electrons from cytochrome c to oxygen []. In eukaryotes this enzyme complex is located in the mitochondrial inner membrane; in aerobic prokaryotes it is found in the plasma membrane.  In eukaryotes, in addition to the three large subunits, I, II and III, that form the catalytic centre of the enzyme complex, there are a variable number of small polypeptidic subunits. One of these subunits, which is known as Vb in mammals, V in Dictyostelium discoideum (Slime mold) and IV in yeast, binds a zinc atom. The sequence of subunit Vb is well conserved and includes three conserved cysteines that coordinate the zinc ion [, ]. Two of these cysteines are clustered in the C-terminal section of the subunit.; GO: 0004129 cytochrome-c oxidase activity, 0005740 mitochondrial envelope; PDB: 2EIL_S 2ZXW_S 3ASN_S 1OCO_S 3AG4_S 3ABK_S 1OCZ_S 1OCC_F 3ASO_S 3ABL_S ....
Probab=21.07  E-value=28  Score=22.31  Aligned_cols=15  Identities=40%  Similarity=1.147  Sum_probs=12.1

Q ss_pred             CCCccCcccccccCC
Q psy12258        110 EKPHFCPVCNKMFRV  124 (171)
Q Consensus       110 ~~~~~C~~C~~~f~~  124 (171)
                      .++.+|+.||.-|..
T Consensus       110 g~~~RCpeCG~~fkL  124 (136)
T PF01215_consen  110 GKPQRCPECGQVFKL  124 (136)
T ss_dssp             TSEEEETTTEEEEEE
T ss_pred             CCccCCCCCCeEEEE
Confidence            468899999988864


No 261
>smart00731 SprT SprT homologues. Predicted to have roles in transcription elongation. Contains a conserved HExxH motif, indicating a metalloprotease function.
Probab=20.76  E-value=27  Score=22.44  Aligned_cols=32  Identities=22%  Similarity=0.505  Sum_probs=16.4

Q ss_pred             CccCccchhhcCCHHHHHHHHHHhcCCCCccCccccccc
Q psy12258         84 NYQCEFCHKAFRASSYLQNHRRIHTGEKPHFCPVCNKMF  122 (171)
Q Consensus        84 ~~~C~~C~~~~~~~~~l~~H~~~h~~~~~~~C~~C~~~f  122 (171)
                      .|.|..|+..+.      ++.+ +.....|.|..|+..+
T Consensus       112 ~y~C~~C~~~~~------~~rr-~~~~~~y~C~~C~g~l  143 (146)
T smart00731      112 PYRCTGCGQRYL------RVRR-SNNVSRYRCGKCGGKL  143 (146)
T ss_pred             EEECCCCCCCCc------eEcc-ccCcceEEcCCCCCEE
Confidence            567777775542      1111 1111457777777554


No 262
>PF02591 DUF164:  Putative zinc ribbon domain;  InterPro: IPR003743 This entry describes proteins of unknown function.
Probab=20.16  E-value=82  Score=16.37  Aligned_cols=32  Identities=16%  Similarity=0.285  Sum_probs=17.1

Q ss_pred             eCCccchhccCcccHHHhhhhcCCCCCcccccchhhh
Q psy12258         29 GCEVCGRHFRQWGDLKYHKASLHSDVKAFQCEYCGKD   65 (171)
Q Consensus        29 ~C~~C~~~f~~~~~l~~H~~~~h~~~~~~~C~~C~~~   65 (171)
                      .|.-|+...+...-.  -+   ..+.....|+.|+..
T Consensus        24 ~C~gC~~~l~~~~~~--~i---~~~~~i~~Cp~CgRi   55 (56)
T PF02591_consen   24 TCSGCHMELPPQELN--EI---RKGDEIVFCPNCGRI   55 (56)
T ss_pred             ccCCCCEEcCHHHHH--HH---HcCCCeEECcCCCcc
Confidence            577777665433221  11   222455678888753


Done!