Query         psy12263
Match_columns 65
No_of_seqs    117 out of 255
Neff          4.1 
Searched_HMMs 46136
Date          Fri Aug 16 22:54:08 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy12263.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/12263hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG2614|consensus               98.8 1.2E-09 2.7E-14   84.5   1.5   57    2-65    198-256 (420)
  2 PF07151 DUF1391:  Protein of u  77.8     1.9 4.2E-05   25.0   1.8   35   18-61     11-45  (49)
  3 COG2088 SpoVG Uncharacterized   50.9      10 0.00022   24.7   1.4   19   15-33     39-60  (95)
  4 PLN02985 squalene monooxygenas  50.8      28 0.00061   27.1   4.0   37    6-49    237-274 (514)
  5 PF08350 DUF1724:  Domain of un  42.6      20 0.00044   20.9   1.7   15   16-30     20-34  (64)
  6 cd05859 Ig4_PDGFR-alpha Fourth  38.4      44 0.00095   20.3   2.8   23    8-30      1-23  (101)
  7 PRK06126 hypothetical protein;  33.3      93   0.002   23.7   4.4   24    6-30    224-249 (545)
  8 PF14353 CpXC:  CpXC protein     30.3      65  0.0014   20.2   2.7   24    2-25     47-70  (128)
  9 PF10568 Tom37:  Outer mitochon  28.9      27 0.00058   20.7   0.7    7   10-16      1-7   (72)
 10 cd08380 C2_PI3K_like C2 domain  28.0      71  0.0015   20.6   2.6   27    4-30    112-141 (156)
 11 PF01797 Y1_Tnp:  Transposase I  27.8      19 0.00041   21.7  -0.1   20    3-30     45-64  (121)
 12 TIGR03330 SAM_DCase_Bsu S-aden  27.4      48  0.0011   21.1   1.7   13    9-21     65-77  (112)
 13 PF02675 AdoMet_dc:  S-adenosyl  26.4      46 0.00099   20.6   1.5   14    9-22     60-73  (106)
 14 cd08693 C2_PI3K_class_I_beta_d  26.3      81  0.0018   21.3   2.8   26    5-30    126-159 (173)
 15 PRK03124 S-adenosylmethionine   25.8      53  0.0012   21.6   1.8   13    9-21     66-78  (127)
 16 PRK01706 S-adenosylmethionine   25.1      55  0.0012   21.4   1.7   13    9-21     68-80  (123)
 17 PRK00458 S-adenosylmethionine   24.4      57  0.0012   21.5   1.7   13    9-21     78-90  (127)
 18 PF11939 DUF3457:  Protein of u  24.4      54  0.0012   22.4   1.6   13   38-50     99-112 (155)
 19 PRK01236 S-adenosylmethionine   23.6      62  0.0013   21.5   1.8   14    9-22     67-80  (131)
 20 PRK04025 S-adenosylmethionine   22.4      67  0.0015   21.6   1.8   13    9-21     66-78  (139)
 21 PRK10465 hydrogenase 2-specifi  21.2      62  0.0014   22.6   1.5   31   13-50     87-120 (159)
 22 PRK02770 S-adenosylmethionine   20.8      73  0.0016   21.4   1.7   14    9-22     79-92  (139)
 23 PRK08849 2-octaprenyl-3-methyl  20.2      59  0.0013   23.5   1.2   22    9-30    202-223 (384)

No 1  
>KOG2614|consensus
Probab=98.82  E-value=1.2e-09  Score=84.52  Aligned_cols=57  Identities=33%  Similarity=0.476  Sum_probs=52.5

Q ss_pred             CcCCCCCeeeeecCCCeeEEeccCCCCCccccCcCceEEEEeCcc-ccccC-ChhHHhcccccCCC
Q psy12263          2 DFQMDPNFLHIWPRGTFMMIALPNQDLSKRTFQTNTSCCRYMKFK-LKCLK-LENEILSIFPSSPP   65 (65)
Q Consensus         2 ~~~~~pn~LHIWPrg~fmliAlPN~DgSf~~~~~~~T~tLF~P~~-f~~L~-~~~~i~~fF~~~fP   65 (65)
                      .|++.+|++|+|||+.++++|+.|.|+|+       |+|.|+|++ ++.++ ...++.+||.++||
T Consensus       198 vf~~~~~~~~~~~~~~~~~~~y~~~~k~~-------t~t~~~~~~e~~~l~~~~~~v~~~~~en~~  256 (420)
T KOG2614|consen  198 VFAIYGNGLHSWPRPGFHLIAYWFLDKSL-------TSTDFAPFDEPEKLKKTSLEVVDFFPENFP  256 (420)
T ss_pred             eecccCCeEEEcccCCceEEEEEeecCCc-------ccccccCcCCHHHHhhhHHHHHHHhHHhHH
Confidence            58899999999999999999999999999       999999998 99986 56889999988875


No 2  
>PF07151 DUF1391:  Protein of unknown function (DUF1391);  InterPro: IPR009821 This family consists of several Enterobacterial proteins of around 50 residues in length. Members of this family are found in Escherichia coli and Salmonella typhi where they are often known as YdfA. The function of this family is unknown.
Probab=77.83  E-value=1.9  Score=24.96  Aligned_cols=35  Identities=26%  Similarity=0.278  Sum_probs=21.5

Q ss_pred             eeEEeccCCCCCccccCcCceEEEEeCccccccCChhHHhcccc
Q psy12263         18 FMMIALPNQDLSKRTFQTNTSCCRYMKFKLKCLKLENEILSIFP   61 (65)
Q Consensus        18 fmliAlPN~DgSf~~~~~~~T~tLF~P~~f~~L~~~~~i~~fF~   61 (65)
                      ..+--.||.||.|       |.--+-..  ++.|++.-...+..
T Consensus        11 lv~gvfpn~dgtf-------tamtytks--ktfkte~garrwl~   45 (49)
T PF07151_consen   11 LVCGVFPNQDGTF-------TAMTYTKS--KTFKTESGARRWLA   45 (49)
T ss_pred             eEEeEeeCCCCcE-------EEEEEeec--ceeecchhhhHHHh
Confidence            4455689999999       88665544  33344544444433


No 3  
>COG2088 SpoVG Uncharacterized protein, involved in the regulation of septum location [Cell envelope biogenesis, outer membrane]
Probab=50.90  E-value=10  Score=24.69  Aligned_cols=19  Identities=21%  Similarity=0.328  Sum_probs=14.4

Q ss_pred             CCCeeEEeccC---CCCCcccc
Q psy12263         15 RGTFMMIALPN---QDLSKRTF   33 (65)
Q Consensus        15 rg~fmliAlPN---~DgSf~~~   33 (65)
                      +.+-+++|+|+   +||+|||-
T Consensus        39 G~~GlfVAMPSrrt~dgEFrDI   60 (95)
T COG2088          39 GNNGLFVAMPSRRTPDGEFRDI   60 (95)
T ss_pred             CCcceEEEccCccCCCcchhhc
Confidence            44568999998   58999554


No 4  
>PLN02985 squalene monooxygenase
Probab=50.75  E-value=28  Score=27.13  Aligned_cols=37  Identities=11%  Similarity=0.127  Sum_probs=25.1

Q ss_pred             CCCeeeeecCCCeeEEeccCCCCCccccCcCceEEEEeCcc-ccc
Q psy12263          6 DPNFLHIWPRGTFMMIALPNQDLSKRTFQTNTSCCRYMKFK-LKC   49 (65)
Q Consensus         6 ~pn~LHIWPrg~fmliAlPN~DgSf~~~~~~~T~tLF~P~~-f~~   49 (65)
                      .|++.|+|-...-+++..|..++..       .+....|.+ ..+
T Consensus       237 ~~~~~~~~~~~~~~~l~ypi~~~~~-------~~~~~~~~~~~~~  274 (514)
T PLN02985        237 EPEKLHLIMSKPSFTMLYQISSTDV-------RCVFEVLPDNIPS  274 (514)
T ss_pred             CCCcceEEcCCCceEEEEEeCCCeE-------EEEEEEeCCCCCC
Confidence            5788899965554555556677777       777777764 443


No 5  
>PF08350 DUF1724:  Domain of unknown function (DUF1724);  InterPro: IPR013561 This domain of unknown function has so far only been found at the C terminus of archaean proteins, including several transcriptional regulators of the ArsR family (see IPR001845 from INTERPRO). 
Probab=42.61  E-value=20  Score=20.93  Aligned_cols=15  Identities=33%  Similarity=0.390  Sum_probs=13.7

Q ss_pred             CCeeEEeccCCCCCc
Q psy12263         16 GTFMMIALPNQDLSK   30 (65)
Q Consensus        16 g~fmliAlPN~DgSf   30 (65)
                      .+||.+.|.++||.|
T Consensus        20 D~f~~l~Lf~~~G~y   34 (64)
T PF08350_consen   20 DKFMSLSLFNKDGRY   34 (64)
T ss_pred             cCeEEEEEEcCCCcC
Confidence            578999999999999


No 6  
>cd05859 Ig4_PDGFR-alpha Fourth immunoglobulin (Ig)-like domain of platelet-derived growth factor receptor (PDGFR) alpha. IG4_PDGFR-alpha: The fourth immunoglobulin (Ig)-like domain of platelet-derived growth factor receptor (PDGFR) alpha. PDGF is a potent mitogen for connective tissue cells. PDGF-stimulated processes are mediated by three different PDGFs (PDGF-A,-B, and C). PDGFR alpha binds to all three PDGFs, whereas the PDGFR beta (not included in this group) binds only to PDGF-B. PDGF alpha is organized as an extracellular component having five Ig-like domains, a transmembrane segment, and a cytoplasmic portion having protein tyrosine kinase activity. In mice, PDGFR alpha and PDGFR beta are essential for normal development.
Probab=38.40  E-value=44  Score=20.29  Aligned_cols=23  Identities=13%  Similarity=0.016  Sum_probs=17.6

Q ss_pred             CeeeeecCCCeeEEeccCCCCCc
Q psy12263          8 NFLHIWPRGTFMMIALPNQDLSK   30 (65)
Q Consensus         8 n~LHIWPrg~fmliAlPN~DgSf   30 (65)
                      .+++|||++..+.-+.-..+-.|
T Consensus         1 ~~i~l~~~~~~~~~~~~~~~~~l   23 (101)
T cd05859           1 GFIALKPTFGQLEFANLHEVKEF   23 (101)
T ss_pred             CceEEecCCCceEEEecCCcEEE
Confidence            37899999998777766666666


No 7  
>PRK06126 hypothetical protein; Provisional
Probab=33.28  E-value=93  Score=23.74  Aligned_cols=24  Identities=13%  Similarity=0.119  Sum_probs=15.7

Q ss_pred             CCCeeeee--cCCCeeEEeccCCCCCc
Q psy12263          6 DPNFLHIW--PRGTFMMIALPNQDLSK   30 (65)
Q Consensus         6 ~pn~LHIW--Prg~fmliAlPN~DgSf   30 (65)
                      .+..+|+|  |+ ..++++..+.++++
T Consensus       224 ~~~~~~~~~~p~-~~~~~~~~~~~~~~  249 (545)
T PRK06126        224 DPAWMYWLFNPD-RRGVLVAIDGRDEW  249 (545)
T ss_pred             CCceEEEEECCC-ccEEEEEECCCCeE
Confidence            34556766  55 45666677778888


No 8  
>PF14353 CpXC:  CpXC protein
Probab=30.27  E-value=65  Score=20.25  Aligned_cols=24  Identities=25%  Similarity=0.509  Sum_probs=21.8

Q ss_pred             CcCCCCCeeeeecCCCeeEEeccC
Q psy12263          2 DFQMDPNFLHIWPRGTFMMIALPN   25 (65)
Q Consensus         2 ~~~~~pn~LHIWPrg~fmliAlPN   25 (65)
                      .++++-..|-+||...+|+...|+
T Consensus        47 ~~~~~~p~lY~D~~~~~~i~~~P~   70 (128)
T PF14353_consen   47 KFRLEYPLLYHDPEKKFMIYYFPD   70 (128)
T ss_pred             ceecCCCEEEEcCCCCEEEEEcCC
Confidence            367888999999999999999999


No 9  
>PF10568 Tom37:  Outer mitochondrial membrane transport complex protein;  InterPro: IPR019564 Tom37 is one of the outer membrane proteins that make up the TOM complex for guiding cytosolic mitochondrial beta-barrel proteins from the cytosol across the outer mitochondrial membrane into the intramembrane space. In conjunction with Tom70, it guides peptides without an mitochondrial targeting sequence (MTS) into Tom40, the protein that forms the passage through the outer membrane []. It has homology with metaxin, also part of the outer mitochondrial membrane beta-barrel protein transport complex []. This entry represents outer mitochondrial membrane transport complex proteins Tom37 and metaxin.; GO: 0006626 protein targeting to mitochondrion, 0005741 mitochondrial outer membrane
Probab=28.85  E-value=27  Score=20.66  Aligned_cols=7  Identities=43%  Similarity=1.180  Sum_probs=5.1

Q ss_pred             eeeecCC
Q psy12263         10 LHIWPRG   16 (65)
Q Consensus        10 LHIWPrg   16 (65)
                      ||+|+.+
T Consensus         1 LhvWg~~    7 (72)
T PF10568_consen    1 LHVWGGD    7 (72)
T ss_pred             CeEeCCC
Confidence            6888665


No 10 
>cd08380 C2_PI3K_like C2 domain present in phosphatidylinositol 3-kinases (PI3Ks). C2 domain present in all classes of PI3Ks.  PI3Ks (AKA phosphatidylinositol (PtdIns) 3-kinases) regulate cell processes such as cell growth, differentiation, proliferation, and motility.  PI3Ks work on phosphorylation of phosphatidylinositol, phosphatidylinositide (4)P (PtdIns (4)P),2 or PtdIns(4,5)P2. Specifically they phosphorylate the D3 hydroxyl group of phosphoinositol lipids on the inositol ring. There are 3 classes of PI3Ks based on structure, regulation, and specificity. All classes contain a C2 domain, a PIK domain, and a kinase catalytic domain.  In addition some PI3Ks contain a Ras-binding domain and/or a p85-binding domain.  Class II PI3Ks contain both of these as well as a PX domain, and a C-terminal C2 domain containing a nuclear localization signal.  C2 domains fold into an 8-standed beta-sandwich that can adopt 2 structural arrangements: Type I and Type II, distinguished by a circular perm
Probab=28.04  E-value=71  Score=20.59  Aligned_cols=27  Identities=15%  Similarity=0.098  Sum_probs=16.3

Q ss_pred             CCCCCeeeeecCCCeeEEe---ccCCCCCc
Q psy12263          4 QMDPNFLHIWPRGTFMMIA---LPNQDLSK   30 (65)
Q Consensus         4 ~~~pn~LHIWPrg~fmliA---lPN~DgSf   30 (65)
                      +.-+..||+||.++-.-..   ..|++..-
T Consensus       112 ~~G~~~l~lW~~~~~~~~~~~~~~~~~~~~  141 (156)
T cd08380         112 RQGMITLNLWPGKKTDPRIACTPCNNSNEN  141 (156)
T ss_pred             ecCCEEEeccCCcccCcccccccCCCCCCC
Confidence            3446689999987754332   35555544


No 11 
>PF01797 Y1_Tnp:  Transposase IS200 like;  InterPro: IPR002686 Transposases are needed for efficient transposition of the insertion sequence or transposon DNA. This entry represents a domain found in transposases for IS200 from Escherichia coli []. More information about these proteins can be found at Protein of the Month: Transposase [].; GO: 0003677 DNA binding, 0004803 transposase activity, 0006313 transposition, DNA-mediated; PDB: 2F5G_B 2F4F_B 2EC2_F 2XM3_C 2XQC_D 2XO6_A 2XMA_E 2VJV_B 2VIH_B 2VJU_A ....
Probab=27.81  E-value=19  Score=21.69  Aligned_cols=20  Identities=30%  Similarity=0.750  Sum_probs=11.8

Q ss_pred             cCCCCCeeeeecCCCeeEEeccCCCCCc
Q psy12263          3 FQMDPNFLHIWPRGTFMMIALPNQDLSK   30 (65)
Q Consensus         3 ~~~~pn~LHIWPrg~fmliAlPN~DgSf   30 (65)
                      +.++|||+|+       ++.+|... +.
T Consensus        45 ~~vm~nHvHl-------lv~~~~~~-~i   64 (121)
T PF01797_consen   45 FVVMPNHVHL-------LVSIPPKQ-SI   64 (121)
T ss_dssp             EEEETTEEEE-------EEEE-TTS--H
T ss_pred             ecccCcccce-------eeeecccc-cc
Confidence            5678999994       55555433 44


No 12 
>TIGR03330 SAM_DCase_Bsu S-adenosylmethionine decarboxylase proenzyme, Bacillus form. Members of this protein family are the single chain precursor of the two chains of the mature S-adenosylmethionine decarboxylase as found in Methanocaldococcus jannaschii, Bacillus subtilis, and a wide range of other species. It differs substantially in architecture from the form as found in Escherichia coli, and lacks any extended homology to the eukaryotic form (TIGR00535).
Probab=27.39  E-value=48  Score=21.14  Aligned_cols=13  Identities=23%  Similarity=0.751  Sum_probs=10.2

Q ss_pred             eeeeecCCCeeEE
Q psy12263          9 FLHIWPRGTFMMI   21 (65)
Q Consensus         9 ~LHIWPrg~fmli   21 (65)
                      .+|.||...+.-|
T Consensus        65 siHTwPE~gyaav   77 (112)
T TIGR03330        65 SIHTWPEYGYAAV   77 (112)
T ss_pred             EEEeccCCCcEEE
Confidence            5899999887554


No 13 
>PF02675 AdoMet_dc:  S-adenosylmethionine decarboxylase ;  InterPro: IPR003826 Polyamines such as spermidine and spermine are essential for cellular growth under most conditions, being implicated in a large number of cellular processes including DNA, RNA and protein synthesis. S-adenosylmethionine decarboxylase (AdoMetDC) plays an essential regulatory role in the polyamine biosynthetic pathway by generating the n-propylamine residue required for the synthesis of spermidine and spermine from putrescein [, ]. Unlike many amino acid decarboxylases AdoMetDC uses a covalently bound pyruvate residue as a cofactor rather than the more common pyridoxal 5'-phosphate. These proteins can be divided into two main groups which show little sequence similarity either to each other, or to other pyruvoyl-dependent amino acid decarboxylases: class I enzymes found in bacteria and archaea, and class II enzymes found in eukaryotes. In both groups the active enzyme is generated by the post-translational autocatalytic cleavage of a precursor protein. This cleavage generates the pyruvate precursor from an internal serine residue and results in the formation of two non-identical subunits termed alpha and beta which form the active enzyme. Members of this family are related to the amino terminus of Escherichia coli S-adenosylmethionine decarboxylase.; GO: 0004014 adenosylmethionine decarboxylase activity, 0008295 spermidine biosynthetic process; PDB: 1VR7_A 3IWC_D 3IWD_D 3IWB_C 1TMI_A 1TLU_A 2III_A.
Probab=26.42  E-value=46  Score=20.61  Aligned_cols=14  Identities=21%  Similarity=0.752  Sum_probs=10.6

Q ss_pred             eeeeecCCCeeEEe
Q psy12263          9 FLHIWPRGTFMMIA   22 (65)
Q Consensus         9 ~LHIWPrg~fmliA   22 (65)
                      .+|.||...+.-|=
T Consensus        60 siHTwPE~~~~avD   73 (106)
T PF02675_consen   60 SIHTWPEHGYAAVD   73 (106)
T ss_dssp             EEEEEGGGTEEEEE
T ss_pred             EEEeCCCcCeEEEE
Confidence            48999998866553


No 14 
>cd08693 C2_PI3K_class_I_beta_delta C2 domain present in class I beta and delta phosphatidylinositol 3-kinases (PI3Ks). PI3Ks (AKA phosphatidylinositol (PtdIns) 3-kinases) regulate cell processes such as cell growth, differentiation, proliferation, and motility.  PI3Ks work on phosphorylation of phosphatidylinositol, phosphatidylinositide (4)P (PtdIns (4)P),2 or PtdIns(4,5)P2. Specifically they phosphorylate the D3 hydroxyl group of phosphoinositol lipids on the inositol ring. There are 3 classes of PI3Ks based on structure, regulation, and specificity. All classes contain a C2 domain, a PIK domain, and a kinase catalytic domain.  The members here are class I, beta and delta isoforms of PI3Ks and contain both a Ras-binding domain and a p85-binding domain.  Class II PI3Ks contain both of these as well as a PX domain, and a C-terminal C2 domain containing a nuclear localization signal.  C2 domains fold into an 8-standed beta-sandwich that can adopt 2 structural arrangements: Type I and Ty
Probab=26.31  E-value=81  Score=21.35  Aligned_cols=26  Identities=12%  Similarity=0.152  Sum_probs=17.3

Q ss_pred             CCCCeeeeecCCCe--------eEEeccCCCCCc
Q psy12263          5 MDPNFLHIWPRGTF--------MMIALPNQDLSK   30 (65)
Q Consensus         5 ~~pn~LHIWPrg~f--------mliAlPN~DgSf   30 (65)
                      --+..||+||..+-        +.....|++..-
T Consensus       126 ~G~~~L~lW~~~~~~~~~~~nP~gt~~~Np~~~~  159 (173)
T cd08693         126 TGDHTLYMWTYAEDQSEDLLNPLGTVESNPNTES  159 (173)
T ss_pred             cCCeEEEecCCCccccccccCCCccCcCCCCCCC
Confidence            34678999997443        555666776665


No 15 
>PRK03124 S-adenosylmethionine decarboxylase proenzyme; Provisional
Probab=25.80  E-value=53  Score=21.61  Aligned_cols=13  Identities=23%  Similarity=0.756  Sum_probs=10.3

Q ss_pred             eeeeecCCCeeEE
Q psy12263          9 FLHIWPRGTFMMI   21 (65)
Q Consensus         9 ~LHIWPrg~fmli   21 (65)
                      .+|.||...+.-|
T Consensus        66 sIHTwPE~gyaav   78 (127)
T PRK03124         66 TIHTWPELGYAAV   78 (127)
T ss_pred             EEEeCccCCeEEE
Confidence            5899999887554


No 16 
>PRK01706 S-adenosylmethionine decarboxylase proenzyme; Validated
Probab=25.14  E-value=55  Score=21.42  Aligned_cols=13  Identities=31%  Similarity=0.680  Sum_probs=10.3

Q ss_pred             eeeeecCCCeeEE
Q psy12263          9 FLHIWPRGTFMMI   21 (65)
Q Consensus         9 ~LHIWPrg~fmli   21 (65)
                      .+|.||...+.-|
T Consensus        68 sIHTwPE~gyaav   80 (123)
T PRK01706         68 SIHTYPEKNFAAI   80 (123)
T ss_pred             EEEeCccCCeEEE
Confidence            5899999887554


No 17 
>PRK00458 S-adenosylmethionine decarboxylase proenzyme; Provisional
Probab=24.44  E-value=57  Score=21.46  Aligned_cols=13  Identities=31%  Similarity=0.856  Sum_probs=10.4

Q ss_pred             eeeeecCCCeeEE
Q psy12263          9 FLHIWPRGTFMMI   21 (65)
Q Consensus         9 ~LHIWPrg~fmli   21 (65)
                      .+|.||...+.-|
T Consensus        78 sIHTwPE~gyaav   90 (127)
T PRK00458         78 AIHTWPEYNFATV   90 (127)
T ss_pred             EEEeCcCCCcEEE
Confidence            5899999887655


No 18 
>PF11939 DUF3457:  Protein of unknown function (DUF3457);  InterPro: IPR023994  Members of this family are chaperones for the assembly of [NiFe] hydrogenases, in the family of HybE, which is specific for hydrogenase-2 of Escherichia coli. Members often have an additional N-terminal rubredoxin domain. ; PDB: 2KC5_A.
Probab=24.38  E-value=54  Score=22.38  Aligned_cols=13  Identities=15%  Similarity=0.350  Sum_probs=5.9

Q ss_pred             eEEEEeCcc-cccc
Q psy12263         38 SCCRYMKFK-LKCL   50 (65)
Q Consensus        38 T~tLF~P~~-f~~L   50 (65)
                      +|+||-|.+ |++-
T Consensus        99 sCSLfSPm~~f~~~  112 (155)
T PF11939_consen   99 SCSLFSPMDEFADQ  112 (155)
T ss_dssp             EEEEE----TT--H
T ss_pred             EeeccCCCccccCH
Confidence            999999987 7653


No 19 
>PRK01236 S-adenosylmethionine decarboxylase proenzyme; Provisional
Probab=23.56  E-value=62  Score=21.49  Aligned_cols=14  Identities=21%  Similarity=0.667  Sum_probs=10.8

Q ss_pred             eeeeecCCCeeEEe
Q psy12263          9 FLHIWPRGTFMMIA   22 (65)
Q Consensus         9 ~LHIWPrg~fmliA   22 (65)
                      .+|.||...+.-|=
T Consensus        67 sIHTwPE~gyaavD   80 (131)
T PRK01236         67 SIHTWPEYGLVTLD   80 (131)
T ss_pred             EEEeCccCCeEEEE
Confidence            58999998876553


No 20 
>PRK04025 S-adenosylmethionine decarboxylase proenzyme; Validated
Probab=22.43  E-value=67  Score=21.57  Aligned_cols=13  Identities=23%  Similarity=0.792  Sum_probs=10.2

Q ss_pred             eeeeecCCCeeEE
Q psy12263          9 FLHIWPRGTFMMI   21 (65)
Q Consensus         9 ~LHIWPrg~fmli   21 (65)
                      .+|.||...+.-|
T Consensus        66 sIHTwPE~gyaav   78 (139)
T PRK04025         66 SVHTWPEKGYAAL   78 (139)
T ss_pred             EEEecccCCeEEE
Confidence            5899999887544


No 21 
>PRK10465 hydrogenase 2-specific chaperone; Provisional
Probab=21.21  E-value=62  Score=22.59  Aligned_cols=31  Identities=19%  Similarity=0.216  Sum_probs=18.9

Q ss_pred             ecCCCeeEE--eccCCCCCccccCcCceEEEEeCcc-cccc
Q psy12263         13 WPRGTFMMI--ALPNQDLSKRTFQTNTSCCRYMKFK-LKCL   50 (65)
Q Consensus        13 WPrg~fmli--AlPN~DgSf~~~~~~~T~tLF~P~~-f~~L   50 (65)
                      -|.|++-+|  -++.-.+..       +|+||-|.+ |.+-
T Consensus        87 lP~G~~~F~~~~~~~~G~y~-------sCSLfSPm~~f~~~  120 (159)
T PRK10465         87 LPYGTMTFTVGELDGVSQYL-------SCSLMSPLDPSLSA  120 (159)
T ss_pred             cCCceEEEEeecCCCCccee-------EeeccCCcccccCH
Confidence            355553333  244444555       999999997 7653


No 22 
>PRK02770 S-adenosylmethionine decarboxylase proenzyme; Provisional
Probab=20.84  E-value=73  Score=21.38  Aligned_cols=14  Identities=21%  Similarity=0.795  Sum_probs=10.8

Q ss_pred             eeeeecCCCeeEEe
Q psy12263          9 FLHIWPRGTFMMIA   22 (65)
Q Consensus         9 ~LHIWPrg~fmliA   22 (65)
                      .+|.||...+.-|=
T Consensus        79 sIHTwPE~gyaavD   92 (139)
T PRK02770         79 SIHTWPESGYAAVD   92 (139)
T ss_pred             EEEeCcCCCcEEEE
Confidence            58999998876543


No 23 
>PRK08849 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Provisional
Probab=20.18  E-value=59  Score=23.47  Aligned_cols=22  Identities=18%  Similarity=0.206  Sum_probs=15.4

Q ss_pred             eeeeecCCCeeEEeccCCCCCc
Q psy12263          9 FLHIWPRGTFMMIALPNQDLSK   30 (65)
Q Consensus         9 ~LHIWPrg~fmliAlPN~DgSf   30 (65)
                      +-|+||.|..+++.+|+.+++.
T Consensus       202 ~~~~~~~g~~~~~pl~~~~~~~  223 (384)
T PRK08849        202 WQQFTPSGPRSFLPLCGNQGSL  223 (384)
T ss_pred             EEEeCCCCCEEEeEcCCCceEE
Confidence            3457899999888777654433


Done!