Query         psy12265
Match_columns 71
No_of_seqs    106 out of 1117
Neff          11.4
Searched_HMMs 46136
Date          Fri Aug 16 22:56:01 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy12265.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/12265hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG2462|consensus               99.9 1.8E-22 3.9E-27  104.2   3.6   66    3-69    199-264 (279)
  2 KOG2462|consensus               99.8 6.2E-22 1.3E-26  102.3   3.2   66    3-71    173-238 (279)
  3 KOG3623|consensus               99.7 1.4E-18   3E-23   99.3   2.6   70    1-71    904-973 (1007)
  4 KOG3576|consensus               99.6 2.7E-16 5.9E-21   79.1   1.2   67    2-69    128-194 (267)
  5 KOG3623|consensus               99.6 4.7E-16   1E-20   89.3   1.8   70    1-71    250-332 (1007)
  6 PHA00733 hypothetical protein   99.4   2E-13 4.4E-18   65.2   3.3   60    7-70     62-121 (128)
  7 PHA02768 hypothetical protein;  99.4 7.2E-14 1.6E-18   57.3   1.0   45   19-66      5-49  (55)
  8 KOG1074|consensus               99.4 9.9E-14 2.2E-18   80.7   0.7   69    2-71    616-691 (958)
  9 KOG3576|consensus               99.3 9.8E-13 2.1E-17   66.5   2.0   70    1-70    155-234 (267)
 10 PF13465 zf-H2C2_2:  Zinc-finge  99.2   1E-11 2.2E-16   44.2   2.5   25    6-30      1-25  (26)
 11 PF13465 zf-H2C2_2:  Zinc-finge  99.2 6.8E-12 1.5E-16   44.7   0.6   26   34-60      1-26  (26)
 12 KOG1074|consensus               99.2 1.9E-11 4.2E-16   71.5   2.6   51   20-71    880-930 (958)
 13 KOG3608|consensus               99.1 5.2E-11 1.1E-15   64.5   3.2   70    1-70    189-259 (467)
 14 KOG3608|consensus               99.1 1.9E-10 4.1E-15   62.4   4.5   63    6-70    252-314 (467)
 15 PHA00732 hypothetical protein   99.0 1.7E-10 3.7E-15   51.0   1.6   46   19-70      1-46  (79)
 16 PHA00616 hypothetical protein   98.9 7.2E-10 1.6E-14   43.6   1.1   35   19-54      1-35  (44)
 17 PHA00733 hypothetical protein   98.7 4.8E-09   1E-13   50.3   1.2   65    6-70     27-95  (128)
 18 KOG3993|consensus               98.7 1.5E-08 3.2E-13   56.3   2.3   66    4-70    280-378 (500)
 19 COG5189 SFP1 Putative transcri  98.7   1E-08 2.2E-13   55.3   1.3   53   17-69    347-419 (423)
 20 PF05605 zf-Di19:  Drought indu  98.6 8.6E-08 1.9E-12   39.6   3.3   49   19-70      2-51  (54)
 21 PLN03086 PRLI-interacting fact  98.6   1E-07 2.3E-12   54.9   4.3   50    5-59    466-515 (567)
 22 PF00096 zf-C2H2:  Zinc finger,  98.6 1.6E-08 3.5E-13   34.7   0.3   21   49-69      1-21  (23)
 23 PHA00616 hypothetical protein   98.5 9.3E-08   2E-12   37.7   1.4   23   48-70      1-23  (44)
 24 PLN03086 PRLI-interacting fact  98.4   5E-07 1.1E-11   52.2   3.8   62    4-68    489-560 (567)
 25 PF13912 zf-C2H2_6:  C2H2-type   98.4 1.1E-07 2.4E-12   33.8   0.6   21   49-69      2-22  (27)
 26 PF00096 zf-C2H2:  Zinc finger,  98.3 3.9E-07 8.5E-12   31.1   1.6   21   20-40      1-21  (23)
 27 PHA02768 hypothetical protein;  98.3 3.4E-07 7.4E-12   37.7   1.4   34    1-36     15-48  (55)
 28 PF12756 zf-C2H2_2:  C2H2 type   98.3 2.6E-07 5.7E-12   42.1   1.1   23   48-70     50-72  (100)
 29 PF13894 zf-C2H2_4:  C2H2-type   98.3 2.8E-07 6.1E-12   31.5   0.8   22   49-70      1-22  (24)
 30 PF13912 zf-C2H2_6:  C2H2-type   98.1 3.9E-06 8.5E-11   29.7   1.9   24   19-43      1-24  (27)
 31 PF13894 zf-C2H2_4:  C2H2-type   98.1 5.8E-06 1.3E-10   28.1   2.2   22   20-41      1-22  (24)
 32 PRK04860 hypothetical protein;  98.0 3.6E-06 7.8E-11   41.9   1.4   39   19-62    119-157 (160)
 33 smart00355 ZnF_C2H2 zinc finge  97.9 3.9E-06 8.5E-11   28.9   0.9   20   50-69      2-21  (26)
 34 PF12171 zf-C2H2_jaz:  Zinc-fin  97.8 2.6E-06 5.5E-11   30.3  -0.5   22   49-70      2-23  (27)
 35 PF12874 zf-met:  Zinc-finger o  97.8 4.1E-06   9E-11   29.1  -0.1   19   21-39      2-20  (25)
 36 smart00355 ZnF_C2H2 zinc finge  97.6 6.8E-05 1.5E-09   25.6   1.8   24   20-44      1-24  (26)
 37 PF09237 GAGA:  GAGA factor;  I  97.6 2.2E-05 4.7E-10   31.8   0.5   26   45-70     21-46  (54)
 38 PF09237 GAGA:  GAGA factor;  I  97.6 3.7E-05 8.1E-10   31.2   1.1   32   15-47     20-51  (54)
 39 KOG3993|consensus               97.6 9.5E-06 2.1E-10   45.6  -0.8   50   20-70    268-317 (500)
 40 PHA00732 hypothetical protein   97.6 2.9E-05 6.3E-10   34.4   0.7   22   48-69      1-22  (79)
 41 PF13913 zf-C2HC_2:  zinc-finge  97.5 3.2E-05   7E-10   27.0   0.6   20   49-69      3-22  (25)
 42 PF12874 zf-met:  Zinc-finger o  97.3 0.00019   4E-09   24.7   1.6   22   49-70      1-22  (25)
 43 PF13909 zf-H2C2_5:  C2H2-type   97.2 0.00016 3.5E-09   24.7   0.6   21   49-70      1-21  (24)
 44 smart00451 ZnF_U1 U1-like zinc  97.0 0.00022 4.9E-09   26.5   0.5   20   20-39      4-23  (35)
 45 PRK04860 hypothetical protein;  96.5  0.0025 5.4E-08   31.9   1.9   29    5-33    129-157 (160)
 46 COG4049 Uncharacterized protei  96.3   0.004 8.6E-08   25.8   1.7   26   43-68     12-37  (65)
 47 cd00350 rubredoxin_like Rubred  96.0  0.0043 9.3E-08   22.9   1.0   24   20-56      2-25  (33)
 48 KOG1146|consensus               95.9   0.004 8.7E-08   39.9   1.0   56   14-69    460-539 (1406)
 49 COG5048 FOG: Zn-finger [Genera  95.5  0.0024 5.2E-08   35.5  -0.6   53   18-70    288-345 (467)
 50 KOG2893|consensus               95.4  0.0049 1.1E-07   32.9   0.2   42   21-67     12-53  (341)
 51 TIGR00373 conserved hypothetic  95.3   0.022 4.8E-07   28.5   2.4   33   15-57    105-137 (158)
 52 PF09538 FYDLN_acid:  Protein o  95.3  0.0067 1.4E-07   28.6   0.5   32   18-61      8-39  (108)
 53 COG1592 Rubrerythrin [Energy p  95.1   0.011 2.5E-07   29.8   1.0   25   18-56    133-157 (166)
 54 smart00531 TFIIE Transcription  95.1   0.049 1.1E-06   26.9   3.3   38   16-58     96-133 (147)
 55 PF13719 zinc_ribbon_5:  zinc-r  94.7   0.022 4.7E-07   21.6   1.1   34   20-59      3-36  (37)
 56 PRK06266 transcription initiat  94.7   0.037   8E-07   28.3   2.2   32   16-57    114-145 (178)
 57 PF12756 zf-C2H2_2:  C2H2 type   94.6   0.041 8.9E-07   24.8   2.1   23   19-41     50-72  (100)
 58 TIGR02098 MJ0042_CXXC MJ0042 f  94.4   0.027 5.8E-07   21.3   1.1   34   20-59      3-36  (38)
 59 PF13717 zinc_ribbon_4:  zinc-r  94.2    0.04 8.7E-07   20.8   1.3   33   20-58      3-35  (36)
 60 KOG2186|consensus               94.0   0.036 7.8E-07   29.9   1.3   38   20-60      4-41  (276)
 61 PF09986 DUF2225:  Uncharacteri  93.5   0.016 3.5E-07   30.4  -0.4   44   17-60      3-60  (214)
 62 COG2888 Predicted Zn-ribbon RN  93.2     0.1 2.2E-06   21.9   1.8   32   19-56     27-58  (61)
 63 KOG1146|consensus               93.2   0.058 1.3E-06   35.1   1.5   54   16-70   1281-1350(1406)
 64 COG5189 SFP1 Putative transcri  93.0   0.028 6.1E-07   31.3   0.1   24   16-39    395-418 (423)
 65 cd00729 rubredoxin_SM Rubredox  92.7   0.076 1.6E-06   19.7   1.0   25   19-56      2-26  (34)
 66 PRK00398 rpoP DNA-directed RNA  92.7    0.11 2.4E-06   20.5   1.6   31   18-59      2-32  (46)
 67 TIGR02300 FYDLN_acid conserved  92.5   0.054 1.2E-06   26.2   0.6   32   18-61      8-39  (129)
 68 smart00659 RPOLCX RNA polymera  92.3    0.12 2.7E-06   20.4   1.4   27   19-57      2-28  (44)
 69 KOG2593|consensus               92.2    0.16 3.5E-06   29.4   2.3   38   15-56    124-161 (436)
 70 PF09723 Zn-ribbon_8:  Zinc rib  92.1   0.066 1.4E-06   20.8   0.5   29   20-56      6-34  (42)
 71 KOG2893|consensus               91.6   0.062 1.3E-06   28.9   0.3   25   46-71      9-33  (341)
 72 KOG3408|consensus               91.6    0.22 4.7E-06   24.0   2.0   24   48-71     57-80  (129)
 73 PRK00464 nrdR transcriptional   91.2   0.036 7.7E-07   27.8  -0.8   14   48-61     28-41  (154)
 74 KOG2785|consensus               91.2    0.23 5.1E-06   28.4   2.2   24   47-70     67-90  (390)
 75 PF07754 DUF1610:  Domain of un  91.0   0.072 1.6E-06   18.3   0.1   11   46-56     14-24  (24)
 76 PF02892 zf-BED:  BED zinc fing  90.9    0.14 3.1E-06   19.9   0.9   20   49-68     17-40  (45)
 77 KOG4167|consensus               90.8    0.11 2.3E-06   32.2   0.7   24   48-71    792-815 (907)
 78 PF15269 zf-C2H2_7:  Zinc-finge  90.7    0.12 2.6E-06   20.5   0.6   21   49-69     21-41  (54)
 79 smart00734 ZnF_Rad18 Rad18-lik  90.7    0.15 3.2E-06   17.8   0.8   18   50-68      3-20  (26)
 80 PF04959 ARS2:  Arsenite-resist  90.5   0.068 1.5E-06   28.2  -0.2   25   46-70     75-99  (214)
 81 TIGR02605 CxxC_CxxC_SSSS putat  90.4   0.072 1.6E-06   21.5  -0.1   29   20-56      6-34  (52)
 82 COG5048 FOG: Zn-finger [Genera  90.4   0.057 1.2E-06   30.1  -0.6   49    3-52    301-355 (467)
 83 PF13451 zf-trcl:  Probable zin  90.1    0.62 1.3E-05   18.9   2.4   41   17-57      2-42  (49)
 84 COG1996 RPC10 DNA-directed RNA  90.0    0.19 4.1E-06   20.4   0.9   29   18-57      5-33  (49)
 85 KOG2482|consensus               89.5    0.14 3.1E-06   29.0   0.5   67    5-71    129-218 (423)
 86 PRK14890 putative Zn-ribbon RN  88.2    0.52 1.1E-05   19.9   1.6   32   19-56     25-56  (59)
 87 PF05191 ADK_lid:  Adenylate ki  87.9    0.14 3.1E-06   19.3  -0.1   32   20-60      2-33  (36)
 88 PF02176 zf-TRAF:  TRAF-type zi  87.1     1.3 2.9E-05   18.1   2.6   44   16-60      6-54  (60)
 89 PF10571 UPF0547:  Uncharacteri  86.9    0.14 3.1E-06   17.9  -0.3   10   50-59     16-25  (26)
 90 PHA00626 hypothetical protein   86.6    0.26 5.7E-06   20.5   0.3   17   46-62     21-37  (59)
 91 PF03604 DNA_RNApol_7kD:  DNA d  86.2    0.59 1.3E-05   17.2   1.1   27   20-58      1-27  (32)
 92 PF10013 DUF2256:  Uncharacteri  85.6    0.33 7.1E-06   19.0   0.3   16   50-65     10-25  (42)
 93 smart00614 ZnF_BED BED zinc fi  85.2     1.2 2.5E-05   17.8   1.9   22   19-40     18-44  (50)
 94 PRK03824 hypA hydrogenase nick  85.0    0.36 7.7E-06   23.7   0.4   15   18-32     69-83  (135)
 95 PF04780 DUF629:  Protein of un  84.7    0.91   2E-05   26.9   1.9   29   18-46     56-84  (466)
 96 smart00834 CxxC_CXXC_SSSS Puta  84.2    0.24 5.3E-06   18.7  -0.3   11   49-59      6-16  (41)
 97 PF04959 ARS2:  Arsenite-resist  84.0    0.93   2E-05   24.1   1.6   29   16-44     74-102 (214)
 98 PF12907 zf-met2:  Zinc-binding  83.9    0.28 6.1E-06   19.0  -0.2   27   20-46      2-31  (40)
 99 PF07282 OrfB_Zn_ribbon:  Putat  83.8    0.99 2.2E-05   19.2   1.5   24   45-68     43-66  (69)
100 PF09963 DUF2197:  Uncharacteri  83.4     1.9   4E-05   18.0   2.1   42   20-62      3-45  (56)
101 COG1675 TFA1 Transcription ini  83.3     1.9 4.2E-05   22.3   2.6   34   14-57    108-141 (176)
102 COG3364 Zn-ribbon containing p  83.0    0.92   2E-05   21.3   1.3   15   18-32      1-15  (112)
103 PLN02748 tRNA dimethylallyltra  83.0    0.57 1.2E-05   27.7   0.7   25   47-71    417-442 (468)
104 PF07975 C1_4:  TFIIH C1-like d  82.9    0.55 1.2E-05   19.2   0.5   21   48-68     21-41  (51)
105 COG4530 Uncharacterized protei  82.4    0.72 1.6E-05   22.0   0.8   13   47-59     25-37  (129)
106 COG3091 SprT Zn-dependent meta  82.2    0.61 1.3E-05   23.5   0.6   35   17-57    115-149 (156)
107 COG4338 Uncharacterized protei  81.7    0.56 1.2E-05   18.9   0.3   16   50-65     14-29  (54)
108 COG5236 Uncharacterized conser  81.6     1.7 3.7E-05   25.0   2.2   47   21-69    222-272 (493)
109 KOG2231|consensus               81.3       5 0.00011   25.2   4.1   19   51-69    185-203 (669)
110 smart00154 ZnF_AN1 AN1-like Zi  79.8    0.62 1.3E-05   17.8   0.1   12   48-59     12-23  (39)
111 COG3357 Predicted transcriptio  79.0     1.5 3.2E-05   20.2   1.1   28   18-56     57-84  (97)
112 KOG0717|consensus               78.9    0.75 1.6E-05   27.3   0.3   22   49-70    293-314 (508)
113 TIGR00100 hypA hydrogenase nic  78.6     1.1 2.3E-05   21.4   0.7   24   20-56     71-94  (115)
114 PF04423 Rad50_zn_hook:  Rad50   77.0    0.71 1.5E-05   18.8  -0.1   12   50-61     22-33  (54)
115 PF01428 zf-AN1:  AN1-like Zinc  76.9     0.6 1.3E-05   18.1  -0.3   13   47-59     12-24  (43)
116 KOG2231|consensus               75.4     2.5 5.5E-05   26.3   1.8   45   20-69    183-233 (669)
117 COG2331 Uncharacterized protei  74.9     2.7 5.9E-05   18.7   1.4   32   20-59     13-44  (82)
118 KOG4173|consensus               74.7     2.5 5.4E-05   22.6   1.4   19   21-39    108-126 (253)
119 PF12013 DUF3505:  Protein of u  74.6     3.9 8.4E-05   19.1   2.0   22   20-41     81-106 (109)
120 PRK12380 hydrogenase nickel in  74.1     1.8 3.8E-05   20.6   0.8   24   20-56     71-94  (113)
121 PLN02294 cytochrome c oxidase   74.0    0.98 2.1E-05   23.2  -0.1   16   46-61    139-154 (174)
122 KOG2785|consensus               73.8     4.7  0.0001   23.5   2.5   54   17-70    164-242 (390)
123 KOG1842|consensus               73.4     2.6 5.6E-05   25.1   1.4   23   47-69     14-36  (505)
124 KOG3507|consensus               73.3     3.8 8.3E-05   17.3   1.6   32   18-61     19-50  (62)
125 COG3677 Transposase and inacti  73.3     0.9 1.9E-05   22.2  -0.3   36   20-61     31-66  (129)
126 PF14353 CpXC:  CpXC protein     73.2    0.35 7.7E-06   23.2  -1.7   18   47-64     37-54  (128)
127 COG1326 Uncharacterized archae  72.5       5 0.00011   21.2   2.2   36   19-59      6-41  (201)
128 PF08790 zf-LYAR:  LYAR-type C2  72.2     1.3 2.8E-05   15.8   0.1   18   20-38      1-18  (28)
129 PF08274 PhnA_Zn_Ribbon:  PhnA   72.1     1.8   4E-05   15.6   0.5   10   47-56     18-27  (30)
130 cd00924 Cyt_c_Oxidase_Vb Cytoc  71.9     1.1 2.3E-05   20.9  -0.2   18   42-60     74-91  (97)
131 PRK09678 DNA-binding transcrip  71.5    0.85 1.9E-05   20.0  -0.5   15   46-60     25-41  (72)
132 PF07295 DUF1451:  Protein of u  71.3     2.4 5.2E-05   21.2   0.9   28   19-57    112-139 (146)
133 PRK11823 DNA repair protein Ra  70.4     3.1 6.7E-05   24.5   1.3   11   18-28      6-16  (446)
134 COG4306 Uncharacterized protei  70.4     1.4   3E-05   21.6  -0.0   49   12-60     31-80  (160)
135 TIGR00416 sms DNA repair prote  69.6     3.3 7.2E-05   24.5   1.3   10   19-28      7-16  (454)
136 PF10276 zf-CHCC:  Zinc-finger   69.2    0.91   2E-05   17.6  -0.6   12   47-58     28-39  (40)
137 KOG1280|consensus               68.6     6.2 0.00013   22.8   2.2   38   18-55     78-116 (381)
138 PRK00564 hypA hydrogenase nick  68.5     2.2 4.8E-05   20.4   0.5   11   20-30     72-82  (117)
139 PRK03681 hypA hydrogenase nick  68.3       2 4.3E-05   20.5   0.2   25   20-56     71-95  (114)
140 COG1571 Predicted DNA-binding   68.3     2.6 5.7E-05   24.8   0.7   29   21-61    352-380 (421)
141 PF05443 ROS_MUCR:  ROS/MUCR tr  67.4     2.8   6E-05   20.7   0.7   18   49-69     73-90  (132)
142 PLN03238 probable histone acet  67.2     4.2 9.2E-05   22.8   1.4   24   46-69     46-69  (290)
143 KOG0782|consensus               66.8     2.8   6E-05   26.0   0.7   49    6-61    240-289 (1004)
144 KOG2807|consensus               66.4       8 0.00017   22.3   2.3   22   48-69    345-366 (378)
145 COG0675 Transposase and inacti  65.6     3.7 8.1E-05   22.6   1.0   19   46-64    320-338 (364)
146 KOG2636|consensus               65.2     3.6 7.7E-05   24.5   0.9   26   42-67    395-421 (497)
147 PLN00104 MYST -like histone ac  64.5     5.9 0.00013   23.7   1.7   24   46-69    196-219 (450)
148 PTZ00064 histone acetyltransfe  63.7       6 0.00013   24.1   1.6   24   46-69    278-301 (552)
149 PF09845 DUF2072:  Zn-ribbon co  63.5     3.8 8.1E-05   20.2   0.7   15   19-33      1-15  (131)
150 PLN03239 histone acetyltransfe  63.4     6.2 0.00014   22.8   1.6   24   46-69    104-127 (351)
151 PF01155 HypA:  Hydrogenase exp  63.1       3 6.5E-05   19.8   0.3   25   20-57     71-95  (113)
152 PF10537 WAC_Acf1_DNA_bd:  ATP-  62.8     6.7 0.00014   18.4   1.4   10   18-27     29-38  (102)
153 COG1773 Rubredoxin [Energy pro  62.7     1.9   4E-05   18.0  -0.4    9   49-57      4-12  (55)
154 PF09416 UPF1_Zn_bind:  RNA hel  62.3      14 0.00031   18.8   2.6   43   15-57     10-69  (152)
155 PRK05978 hypothetical protein;  62.3     1.7 3.7E-05   21.8  -0.6   32   20-61     34-65  (148)
156 PF08209 Sgf11:  Sgf11 (transcr  62.2     1.6 3.5E-05   16.2  -0.5   12   48-59      4-15  (33)
157 KOG1994|consensus               62.0     3.1 6.8E-05   22.5   0.3   24   44-67    235-258 (268)
158 KOG2747|consensus               62.0     6.9 0.00015   23.0   1.6   24   46-69    156-179 (396)
159 KOG0978|consensus               61.9     1.7 3.7E-05   27.1  -0.7   20   49-68    679-698 (698)
160 PF06397 Desulfoferrod_N:  Desu  61.8     4.1 8.8E-05   15.4   0.5   11   47-57      5-15  (36)
161 TIGR00622 ssl1 transcription f  61.7     4.5 9.7E-05   19.4   0.8   24   47-70     80-103 (112)
162 PF04810 zf-Sec23_Sec24:  Sec23  61.6     1.8 3.9E-05   16.5  -0.5   15   43-57     19-33  (40)
163 KOG3362|consensus               61.4     1.6 3.5E-05   21.8  -0.7   24   48-71    129-152 (156)
164 PF03811 Zn_Tnp_IS1:  InsA N-te  61.2     3.1 6.6E-05   15.7   0.1   30   20-54      6-35  (36)
165 PF04606 Ogr_Delta:  Ogr/Delta-  61.1     1.5 3.2E-05   17.4  -0.8   16   45-60     22-39  (47)
166 PTZ00448 hypothetical protein;  60.0     4.9 0.00011   23.3   0.8   23   48-70    314-336 (373)
167 KOG2907|consensus               59.8     3.9 8.5E-05   19.6   0.4   41   19-61     74-115 (116)
168 PRK00762 hypA hydrogenase nick  59.5     3.8 8.1E-05   19.9   0.3   30   20-56     71-100 (124)
169 PF02748 PyrI_C:  Aspartate car  59.2     4.2   9E-05   16.6   0.4   17   45-61     32-48  (52)
170 COG5112 UFD2 U1-like Zn-finger  58.7      15 0.00032   17.6   2.1   21   49-69     56-76  (126)
171 PF14255 Cys_rich_CPXG:  Cystei  58.5     2.1 4.6E-05   17.5  -0.5   10   50-59      2-11  (52)
172 PF12230 PRP21_like_P:  Pre-mRN  58.4     3.3 7.1E-05   22.1   0.0   24   46-70    166-189 (229)
173 PTZ00043 cytochrome c oxidase   56.7     3.1 6.6E-05   22.6  -0.3   15   46-60    179-193 (268)
174 cd01121 Sms Sms (bacterial rad  56.3     7.2 0.00016   22.6   1.1    9   19-27     14-22  (372)
175 PF01194 RNA_pol_N:  RNA polyme  55.2     4.3 9.2E-05   17.2   0.1   14   48-61      4-17  (60)
176 COG1655 Uncharacterized protei  55.1     4.5 9.8E-05   22.0   0.2   17   46-62     17-33  (267)
177 TIGR01206 lysW lysine biosynth  55.0     2.5 5.4E-05   17.5  -0.6   11   49-59      3-13  (54)
178 TIGR00686 phnA alkylphosphonat  54.9     6.6 0.00014   18.7   0.7   12   48-59     19-30  (109)
179 smart00440 ZnF_C2C2 C2C2 Zinc   54.9     1.2 2.5E-05   17.1  -1.5   10   49-58     29-38  (40)
180 PF13824 zf-Mss51:  Zinc-finger  54.8     5.8 0.00013   16.5   0.5   14   44-57     10-23  (55)
181 smart00731 SprT SprT homologue  54.7     6.7 0.00014   19.4   0.7   32   19-58    112-143 (146)
182 COG5151 SSL1 RNA polymerase II  54.7     8.4 0.00018   22.1   1.2   46   22-70    365-410 (421)
183 PF11931 DUF3449:  Domain of un  54.5     4.1 8.9E-05   21.5   0.0   14   42-55     95-108 (196)
184 COG5188 PRP9 Splicing factor 3  54.5     8.4 0.00018   22.5   1.2   14   42-55    368-381 (470)
185 PF01844 HNH:  HNH endonuclease  54.0     1.6 3.5E-05   16.8  -1.2    7   52-58      2-8   (47)
186 PF13878 zf-C2H2_3:  zinc-finge  53.8      15 0.00032   14.1   1.6   22   19-40     13-36  (41)
187 PF08271 TF_Zn_Ribbon:  TFIIB z  53.4     5.1 0.00011   15.4   0.2    8   49-56      1-8   (43)
188 PRK10220 hypothetical protein;  52.9     7.9 0.00017   18.5   0.8   12   48-59     20-31  (111)
189 PRK05452 anaerobic nitric oxid  52.9     6.2 0.00013   23.6   0.5   38   16-56    422-466 (479)
190 PF11672 DUF3268:  Protein of u  52.8     8.2 0.00018   18.2   0.8   11   18-28      1-11  (102)
191 PF01215 COX5B:  Cytochrome c o  52.8     3.2 6.8E-05   20.6  -0.5   17   43-60    108-124 (136)
192 COG5319 Uncharacterized protei  52.4      14  0.0003   18.3   1.6   26   27-57     16-41  (142)
193 PRK11788 tetratricopeptide rep  52.1      28 0.00061   19.6   3.0    7   20-26    355-361 (389)
194 PF05180 zf-DNL:  DNL zinc fing  51.4     3.4 7.4E-05   17.9  -0.5   34   19-56      4-37  (66)
195 PRK08222 hydrogenase 4 subunit  51.2     7.3 0.00016   20.1   0.6   19   47-65    113-131 (181)
196 COG1997 RPL43A Ribosomal prote  50.5     4.7  0.0001   18.5  -0.1   33   17-60     33-65  (89)
197 COG5027 SAS2 Histone acetyltra  50.4      13 0.00029   21.6   1.5   24   46-69    156-179 (395)
198 TIGR00627 tfb4 transcription f  50.2     8.5 0.00018   21.5   0.8    7   50-56    271-277 (279)
199 KOG2071|consensus               50.1     7.5 0.00016   24.0   0.6   24   46-69    416-439 (579)
200 COG4640 Predicted membrane pro  50.0     8.8 0.00019   22.7   0.8   18   19-36     15-32  (465)
201 PF13240 zinc_ribbon_2:  zinc-r  49.8     3.5 7.5E-05   13.8  -0.5    6   51-56     16-21  (23)
202 PF01927 Mut7-C:  Mut7-C RNAse   49.6     4.6  0.0001   20.0  -0.3   39   20-58     92-134 (147)
203 COG4391 Uncharacterized protei  49.4       7 0.00015   16.7   0.3   43   12-59     17-59  (62)
204 PF06170 DUF983:  Protein of un  47.8     4.9 0.00011   18.3  -0.3   11   50-60     10-20  (86)
205 PRK12722 transcriptional activ  47.4      14  0.0003   19.5   1.2   28   20-56    135-162 (187)
206 PF10263 SprT-like:  SprT-like   47.2     4.4 9.5E-05   20.0  -0.6   31   19-58    123-153 (157)
207 PHA02942 putative transposase;  47.2     9.9 0.00021   22.1   0.7   15   46-60    340-354 (383)
208 PF06676 DUF1178:  Protein of u  46.7      21 0.00045   18.1   1.7    9   48-56     32-40  (148)
209 PF02146 SIR2:  Sir2 family;  I  46.7      24 0.00052   17.9   2.0   33   19-56    105-137 (178)
210 PRK12860 transcriptional activ  46.3      15 0.00032   19.4   1.2   27   20-55    135-161 (189)
211 PRK12387 formate hydrogenlyase  46.2      10 0.00022   19.5   0.6   18   47-64    113-130 (180)
212 COG5432 RAD18 RING-finger-cont  46.0     9.5 0.00021   21.7   0.5   27   24-57     42-68  (391)
213 COG1779 C4-type Zn-finger prot  46.0     3.7 8.1E-05   21.7  -0.9   40   18-60     13-55  (201)
214 PRK04016 DNA-directed RNA poly  45.8     8.3 0.00018   16.5   0.3   13   48-60      4-16  (62)
215 PF10083 DUF2321:  Uncharacteri  45.6     2.1 4.6E-05   21.7  -1.7   15   46-60     66-80  (158)
216 PF02891 zf-MIZ:  MIZ/SP-RING z  45.5      13 0.00029   14.9   0.8    8   49-56     42-49  (50)
217 PF05129 Elf1:  Transcription e  45.5     9.6 0.00021   17.1   0.4   12   45-56     19-30  (81)
218 PF14690 zf-ISL3:  zinc-finger   45.4     8.3 0.00018   14.8   0.2    9   48-56      2-10  (47)
219 PF01286 XPA_N:  XPA protein N-  45.3     9.8 0.00021   14.2   0.4   12   20-31      4-15  (34)
220 PF11789 zf-Nse:  Zinc-finger o  45.0     9.3  0.0002   15.9   0.3   20   46-65     22-41  (57)
221 KOG3352|consensus               44.8     5.5 0.00012   20.2  -0.4   14   47-60    132-145 (153)
222 PF10058 DUF2296:  Predicted in  44.6     9.6 0.00021   15.7   0.4   11   46-56     42-52  (54)
223 PF13821 DUF4187:  Domain of un  44.5     7.4 0.00016   16.1   0.0   21   46-66     25-45  (55)
224 PF05741 zf-nanos:  Nanos RNA b  44.4     9.1  0.0002   15.9   0.3   11   47-57     32-42  (55)
225 PF00301 Rubredoxin:  Rubredoxi  44.1      12 0.00027   14.9   0.6   35   20-56      2-42  (47)
226 COG0068 HypF Hydrogenase matur  43.9     5.9 0.00013   25.1  -0.4   14   21-34    125-138 (750)
227 PF13248 zf-ribbon_3:  zinc-rib  43.6     5.5 0.00012   13.6  -0.4    6   51-56     19-24  (26)
228 COG1198 PriA Primosomal protei  43.5      17 0.00036   23.3   1.3   12   46-57    473-484 (730)
229 smart00586 ZnF_DBF Zinc finger  43.5      24 0.00052   14.3   1.4   20   17-39      3-22  (49)
230 TIGR00319 desulf_FeS4 desulfof  43.3      11 0.00023   13.7   0.4   10   48-57      7-16  (34)
231 PHA02998 RNA polymerase subuni  42.9     3.8 8.3E-05   21.4  -1.1   37   18-59    142-182 (195)
232 cd00974 DSRD Desulforedoxin (D  42.9      11 0.00023   13.7   0.3    9   48-56      4-12  (34)
233 KOG2857|consensus               42.8     8.3 0.00018   19.4   0.0   21   48-68     17-37  (157)
234 PF11023 DUF2614:  Protein of u  42.3      11 0.00023   18.2   0.3   15   44-58     65-79  (114)
235 cd00730 rubredoxin Rubredoxin;  42.2      12 0.00026   15.2   0.4   34   20-56      2-42  (50)
236 COG4888 Uncharacterized Zn rib  42.1      10 0.00022   17.9   0.2   12   46-57     20-31  (104)
237 COG1656 Uncharacterized conser  42.1     9.5 0.00021   19.6   0.2   39   20-58     98-140 (165)
238 PRK01343 zinc-binding protein;  41.8     7.6 0.00016   16.3  -0.2   12   48-59      9-20  (57)
239 COG5152 Uncharacterized conser  41.6      15 0.00032   19.7   0.8   16   46-61    194-209 (259)
240 PRK11032 hypothetical protein;  41.1       9  0.0002   19.6   0.0   28   19-57    124-151 (160)
241 PF14369 zf-RING_3:  zinc-finge  40.6      14  0.0003   13.7   0.5   10   21-30     23-32  (35)
242 KOG4124|consensus               40.4     7.2 0.00016   22.7  -0.4   51   17-67    347-417 (442)
243 COG4896 Uncharacterized protei  39.3      37  0.0008   14.6   2.0    9   48-56     31-39  (68)
244 PF06524 NOA36:  NOA36 protein;  39.3      21 0.00046   20.0   1.2   16   47-62    208-223 (314)
245 COG1781 PyrI Aspartate carbamo  39.2     7.1 0.00015   19.8  -0.5   15   48-62    135-149 (153)
246 PRK04351 hypothetical protein;  39.1      16 0.00034   18.4   0.7   31   20-59    113-143 (149)
247 KOG3497|consensus               39.1      11 0.00024   16.1   0.1   14   48-61      4-17  (69)
248 COG1644 RPB10 DNA-directed RNA  38.4      12 0.00025   16.1   0.1   13   48-60      4-16  (63)
249 COG3880 Modulator of heat shoc  38.4      14 0.00031   19.2   0.5   32   19-61     74-105 (176)
250 PF01780 Ribosomal_L37ae:  Ribo  38.4     6.2 0.00014   18.2  -0.7   31   18-59     34-64  (90)
251 PF03884 DUF329:  Domain of unk  38.2      16 0.00034   15.3   0.5   12   49-60      3-14  (57)
252 PF04438 zf-HIT:  HIT zinc fing  38.2      11 0.00024   13.5   0.1   11   48-58     13-23  (30)
253 PF13453 zf-TFIIB:  Transcripti  37.8      30 0.00064   13.0   1.8   21   18-38     18-38  (41)
254 PF10164 DUF2367:  Uncharacteri  36.9      11 0.00024   17.6  -0.0   12   47-58     87-98  (98)
255 PF05864 Chordopox_RPO7:  Chord  36.8      14 0.00031   15.5   0.3   11   50-60      6-16  (63)
256 PF14149 YhfH:  YhfH-like prote  36.0      21 0.00046   13.6   0.7   11   50-60     15-25  (37)
257 PF07649 C1_3:  C1-like domain;  35.6      18  0.0004   12.6   0.5   12   46-57     13-24  (30)
258 PF14311 DUF4379:  Domain of un  35.2      13 0.00029   15.0   0.1   13   49-61     29-41  (55)
259 PF02591 DUF164:  Putative zinc  34.8      19 0.00042   14.6   0.5   33   20-57     23-55  (56)
260 PF14446 Prok-RING_1:  Prokaryo  34.8     5.7 0.00012   16.5  -1.0    9   50-58      7-15  (54)
261 COG5109 Uncharacterized conser  34.6      16 0.00034   21.1   0.3   18   42-59    370-387 (396)
262 PF08792 A2L_zn_ribbon:  A2L zi  34.1      23 0.00051   12.9   0.6   11   19-29     21-31  (33)
263 TIGR03826 YvyF flagellar opero  34.1      17 0.00036   18.1   0.3   11   50-60      5-15  (137)
264 KOG2817|consensus               34.0      37 0.00081   20.2   1.7   29   25-57    355-383 (394)
265 TIGR03831 YgiT_finger YgiT-typ  33.8      20 0.00042   13.5   0.5   11   20-30     33-43  (46)
266 TIGR00240 ATCase_reg aspartate  33.5     8.5 0.00018   19.5  -0.7   13   48-60    132-144 (150)
267 PF05876 Terminase_GpA:  Phage   33.0      15 0.00032   22.6   0.0   40   20-60    201-241 (557)
268 PF06220 zf-U1:  U1 zinc finger  32.8      37 0.00081   12.8   1.1   10   20-29      4-13  (38)
269 TIGR00595 priA primosomal prot  32.6      27 0.00058   21.2   1.0   10   47-56    252-261 (505)
270 PF03119 DNA_ligase_ZBD:  NAD-d  32.5      19 0.00041   12.6   0.3    9   50-58      1-9   (28)
271 PRK14873 primosome assembly pr  32.0      36 0.00078   21.6   1.5   10   47-56    421-430 (665)
272 PHA03082 DNA-dependent RNA pol  31.5      21 0.00045   15.1   0.3   11   50-60      6-16  (63)
273 PLN00032 DNA-directed RNA poly  31.5      18 0.00039   16.0   0.2   13   48-60      4-16  (71)
274 PF14787 zf-CCHC_5:  GAG-polypr  31.4     9.5 0.00021   14.4  -0.6   10   50-59      4-13  (36)
275 PRK00893 aspartate carbamoyltr  31.3      11 0.00024   19.2  -0.6   17   45-61    131-147 (152)
276 KOG4118|consensus               31.0      30 0.00065   15.0   0.8   26   19-44     38-63  (74)
277 PF09855 DUF2082:  Nucleic-acid  30.9      16 0.00035   15.7  -0.0    6   50-55      2-7   (64)
278 PF15135 UPF0515:  Uncharacteri  30.6      72  0.0016   17.9   2.3   13   49-61    156-168 (278)
279 COG1579 Zn-ribbon protein, pos  30.6      45 0.00096   18.4   1.6   15   45-59    218-232 (239)
280 smart00132 LIM Zinc-binding do  30.0      12 0.00027   13.2  -0.4   11   48-58     27-37  (39)
281 PF07535 zf-DBF:  DBF zinc fing  29.9      23  0.0005   14.3   0.4   12   18-29      4-15  (49)
282 PF14354 Lar_restr_allev:  Rest  29.8      22 0.00047   14.6   0.3    6   50-55      5-10  (61)
283 COG4957 Predicted transcriptio  29.3      54  0.0012   16.5   1.6   22   20-45     77-98  (148)
284 PF09332 Mcm10:  Mcm10 replicat  29.2      32 0.00069   20.0   0.9   39   19-57    252-294 (344)
285 PRK12496 hypothetical protein;  29.2      20 0.00043   18.3   0.1   13   48-60    127-139 (164)
286 PF01096 TFIIS_C:  Transcriptio  29.2      28 0.00061   13.1   0.5   10   20-29     29-38  (39)
287 TIGR01053 LSD1 zinc finger dom  28.9      41 0.00089   12.1   0.9   13   43-55     14-26  (31)
288 KOG4727|consensus               28.7      40 0.00086   17.7   1.1   22   19-40     75-96  (193)
289 PF05280 FlhC:  Flagellar trans  28.6      26 0.00056   18.2   0.5   27   20-55    135-161 (175)
290 KOG3214|consensus               27.3      24 0.00051   16.7   0.2   40   18-62     22-61  (109)
291 COG3024 Uncharacterized protei  27.2      19  0.0004   15.6  -0.1   10   49-58      8-17  (65)
292 PRK06260 threonine synthase; V  27.1      42 0.00091   19.6   1.2    9   20-28      4-12  (397)
293 KOG3456|consensus               27.0      29 0.00062   16.7   0.4   13   48-60    104-116 (120)
294 PRK00418 DNA gyrase inhibitor;  26.9      20 0.00043   15.4  -0.1   11   48-58      6-16  (62)
295 PF07503 zf-HYPF:  HypF finger;  26.9      18 0.00038   13.5  -0.2   12   48-59     21-32  (35)
296 PF14952 zf-tcix:  Putative tre  26.6      24 0.00052   14.0   0.1    7   50-56     13-19  (44)
297 KOG0402|consensus               26.3      18 0.00039   16.5  -0.3   11   48-58     36-46  (92)
298 PRK02935 hypothetical protein;  25.8      29 0.00064   16.6   0.3   14   44-57     66-79  (110)
299 PF01722 BolA:  BolA-like prote  25.6      46   0.001   14.7   1.0   24   46-69     27-50  (76)
300 smart00647 IBR In Between Ring  25.6      27 0.00058   14.1   0.2   17   45-61     37-53  (64)
301 KOG4602|consensus               25.5      20 0.00044   20.0  -0.2   10   48-57    268-277 (318)
302 TIGR01385 TFSII transcription   25.4      34 0.00074   19.4   0.6   35   19-58    258-296 (299)
303 PF13462 Thioredoxin_4:  Thiore  25.2      39 0.00084   16.4   0.8   18   49-66     22-39  (162)
304 PF02148 zf-UBP:  Zn-finger in   25.2      37 0.00079   14.1   0.6   15   17-31      9-23  (63)
305 PF14447 Prok-RING_4:  Prokaryo  25.0      21 0.00046   14.9  -0.1   16   45-60     36-51  (55)
306 COG1885 Uncharacterized protei  24.9      19 0.00041   17.2  -0.3   11   49-59     50-60  (115)
307 COG4311 SoxD Sarcosine oxidase  24.6      28 0.00062   16.3   0.2    9   48-56      3-11  (97)
308 TIGR00280 L37a ribosomal prote  24.6      40 0.00088   15.6   0.7   11   20-30     54-64  (91)
309 PF12760 Zn_Tnp_IS1595:  Transp  24.6      61  0.0013   12.5   2.6   39    8-56      7-45  (46)
310 cd01410 SIRT7 SIRT7: Eukaryoti  24.5      91   0.002   16.5   2.0   35   18-56     94-128 (206)
311 smart00661 RPOL9 RNA polymeras  24.5      44 0.00096   13.0   0.8   13   19-31     20-32  (52)
312 PF10122 Mu-like_Com:  Mu-like   24.4      45 0.00098   13.7   0.7   11   49-59      5-15  (51)
313 TIGR03830 CxxCG_CxxCG_HTH puta  24.2      86  0.0019   14.7   1.8   18   19-36     31-48  (127)
314 PF09082 DUF1922:  Domain of un  24.0      16 0.00035   15.9  -0.6    6   50-56     22-27  (68)
315 KOG0562|consensus               23.8      63  0.0014   17.0   1.3   23   47-69    152-174 (184)
316 TIGR00244 transcriptional regu  23.7      37 0.00079   17.3   0.5   16   20-35     29-44  (147)
317 PF10609 ParA:  ParA/MinD ATPas  23.4      40 0.00086   15.2   0.5   10   48-57     65-74  (81)
318 COG1545 Predicted nucleic-acid  23.2      20 0.00044   17.8  -0.5    9   50-58     31-39  (140)
319 COG1327 Predicted transcriptio  23.1      37  0.0008   17.4   0.4   15   20-34     29-43  (156)
320 cd04476 RPA1_DBD_C RPA1_DBD_C:  23.0      33 0.00072   17.2   0.3   11   47-57     50-60  (166)
321 COG1631 RPL42A Ribosomal prote  22.9      28 0.00061   16.2   0.0   11   49-59     69-79  (94)
322 PRK14892 putative transcriptio  22.9      36 0.00078   16.0   0.4   10   46-55     19-28  (99)
323 PTZ00255 60S ribosomal protein  22.9      46   0.001   15.4   0.7   11   20-30     55-65  (90)
324 PHA03019 hypothetical protein;  22.8      52  0.0011   14.3   0.8   12   49-60     21-32  (77)
325 KOG3134|consensus               22.6      68  0.0015   17.6   1.3   33   20-57      1-33  (225)
326 PF08273 Prim_Zn_Ribbon:  Zinc-  22.4      33 0.00072   13.2   0.2    8   49-56      4-11  (40)
327 PF10367 Vps39_2:  Vacuolar sor  22.3      23 0.00049   16.1  -0.4   11   50-60     80-90  (109)
328 PRK05580 primosome assembly pr  21.9      54  0.0012   20.8   1.0   10   47-56    420-429 (679)
329 PF10825 DUF2752:  Protein of u  21.9      32  0.0007   13.9   0.1    9   49-57     10-18  (52)
330 TIGR03829 YokU_near_AblA uncha  21.8      69  0.0015   14.8   1.1   17   20-36     36-52  (89)
331 PF04777 Evr1_Alr:  Erv1 / Alr   21.3      44 0.00094   15.1   0.5   15   47-61     35-49  (95)
332 COG3478 Predicted nucleic-acid  21.3      40 0.00087   14.6   0.3    6   50-55      6-11  (68)
333 PRK03976 rpl37ae 50S ribosomal  21.3      52  0.0011   15.3   0.7   11   20-30     55-65  (90)
334 PF14803 Nudix_N_2:  Nudix N-te  21.3      37 0.00081   12.5   0.2    7   51-57      3-9   (34)
335 TIGR03655 anti_R_Lar restricti  21.3      32  0.0007   13.8   0.0    6   50-55      3-8   (53)
336 PF03367 zf-ZPR1:  ZPR1 zinc-fi  21.3      30 0.00066   17.6  -0.1   13   47-59     29-41  (161)
337 PF14599 zinc_ribbon_6:  Zinc-r  20.6      29 0.00064   14.7  -0.2   10   20-29     31-40  (61)
338 TIGR00340 zpr1_rel ZPR1-relate  20.6      38 0.00082   17.4   0.2   12   48-59     28-39  (163)
339 PF01363 FYVE:  FYVE zinc finge  20.5      35 0.00077   14.3   0.1   10   50-59     11-20  (69)
340 PF12677 DUF3797:  Domain of un  20.4      36 0.00077   13.9   0.1    8   49-56     14-21  (49)
341 COG4847 Uncharacterized protei  20.3      49  0.0011   15.5   0.5   12   17-28      4-15  (103)
342 PF04032 Rpr2:  RNAse P Rpr2/Rp  20.2      12 0.00026   16.4  -1.5   13   18-30     45-57  (85)
343 KOG2932|consensus               20.1      73  0.0016   18.6   1.2   24   46-69    142-168 (389)
344 PF09943 DUF2175:  Uncharacteri  20.0      49  0.0011   15.7   0.5   10   19-28      2-11  (101)

No 1  
>KOG2462|consensus
Probab=99.86  E-value=1.8e-22  Score=104.19  Aligned_cols=66  Identities=39%  Similarity=0.677  Sum_probs=56.5

Q ss_pred             ChHHHHHHHhHhhCCCceecccccccccchhhHHHhHhhhcCCcCceeCChhhHhhhchHHHHHhhh
Q psy12265          3 KFTYLKVHNRVHLGLKPYGCEVCGRHFRQWGDLKYHKASLHSDVKAFQCEYCGKDFARKYQAHSYHQ   69 (71)
Q Consensus         3 ~~~~l~~h~~~~~~~~~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~C~~c~~~f~~~~~l~~h~~   69 (71)
                      -+=.|+-|+|+|+||+||.|..|+++|...++|..||+ +|.+.++|+|..|++.|+..+.|.+|..
T Consensus       199 RPWLLQGHiRTHTGEKPF~C~hC~kAFADRSNLRAHmQ-THS~~K~~qC~~C~KsFsl~SyLnKH~E  264 (279)
T KOG2462|consen  199 RPWLLQGHIRTHTGEKPFSCPHCGKAFADRSNLRAHMQ-THSDVKKHQCPRCGKSFALKSYLNKHSE  264 (279)
T ss_pred             chHHhhcccccccCCCCccCCcccchhcchHHHHHHHH-hhcCCccccCcchhhHHHHHHHHHHhhh
Confidence            33456678899999999999999999999999999988 7988889999999999999999988864


No 2  
>KOG2462|consensus
Probab=99.85  E-value=6.2e-22  Score=102.25  Aligned_cols=66  Identities=33%  Similarity=0.578  Sum_probs=61.9

Q ss_pred             ChHHHHHHHhHhhCCCceecccccccccchhhHHHhHhhhcCCcCceeCChhhHhhhchHHHHHhhhcC
Q psy12265          3 KFTYLKVHNRVHLGLKPYGCEVCGRHFRQWGDLKYHKASLHSDVKAFQCEYCGKDFARKYQAHSYHQIR   71 (71)
Q Consensus         3 ~~~~l~~h~~~~~~~~~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~C~~c~~~f~~~~~l~~h~~~~   71 (71)
                      +...|..|+++|+  -+.+|.+||+.|+.+.-|+.|++ .|+||+||.|+.|++.|+.+++|+-||+++
T Consensus       173 SmpALkMHirTH~--l~c~C~iCGKaFSRPWLLQGHiR-THTGEKPF~C~hC~kAFADRSNLRAHmQTH  238 (279)
T KOG2462|consen  173 SMPALKMHIRTHT--LPCECGICGKAFSRPWLLQGHIR-THTGEKPFSCPHCGKAFADRSNLRAHMQTH  238 (279)
T ss_pred             ehHHHhhHhhccC--CCcccccccccccchHHhhcccc-cccCCCCccCCcccchhcchHHHHHHHHhh
Confidence            4678899999985  78999999999999999999998 899999999999999999999999999875


No 3  
>KOG3623|consensus
Probab=99.73  E-value=1.4e-18  Score=99.34  Aligned_cols=70  Identities=34%  Similarity=0.586  Sum_probs=66.2

Q ss_pred             CcChHHHHHHHhHhhCCCceecccccccccchhhHHHhHhhhcCCcCceeCChhhHhhhchHHHHHhhhcC
Q psy12265          1 MEKFTYLKVHNRVHLGLKPYGCEVCGRHFRQWGDLKYHKASLHSDVKAFQCEYCGKDFARKYQAHSYHQIR   71 (71)
Q Consensus         1 f~~~~~l~~h~~~~~~~~~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~C~~c~~~f~~~~~l~~h~~~~   71 (71)
                      |.+.++|.+|.-.|+|.+||.|.+|.++|..+-.|+.|++ .|.|++||+|..|++.|+....+.+||-.|
T Consensus       904 FqKqSSLaRHKYEHsGqRPyqC~iCkKAFKHKHHLtEHkR-LHSGEKPfQCdKClKRFSHSGSYSQHMNHR  973 (1007)
T KOG3623|consen  904 FQKQSSLARHKYEHSGQRPYQCIICKKAFKHKHHLTEHKR-LHSGEKPFQCDKCLKRFSHSGSYSQHMNHR  973 (1007)
T ss_pred             HHhhHHHHHhhhhhcCCCCcccchhhHhhhhhhhhhhhhh-hccCCCcchhhhhhhhcccccchHhhhccc
Confidence            6678999999999999999999999999999999999998 899999999999999999999999998654


No 4  
>KOG3576|consensus
Probab=99.59  E-value=2.7e-16  Score=79.14  Aligned_cols=67  Identities=28%  Similarity=0.523  Sum_probs=60.7

Q ss_pred             cChHHHHHHHhHhhCCCceecccccccccchhhHHHhHhhhcCCcCceeCChhhHhhhchHHHHHhhh
Q psy12265          2 EKFTYLKVHNRVHLGLKPYGCEVCGRHFRQWGDLKYHKASLHSDVKAFQCEYCGKDFARKYQAHSYHQ   69 (71)
Q Consensus         2 ~~~~~l~~h~~~~~~~~~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~C~~c~~~f~~~~~l~~h~~   69 (71)
                      .-+.-|.+|++.|...+.+.|..||++|-..-+|++|++ .|+|.+||+|..|++.|.++-.|+.|.+
T Consensus       128 ~lQRmlnrh~kch~~vkr~lct~cgkgfndtfdlkrh~r-thtgvrpykc~~c~kaftqrcsleshl~  194 (267)
T KOG3576|consen  128 GLQRMLNRHLKCHSDVKRHLCTFCGKGFNDTFDLKRHTR-THTGVRPYKCSLCEKAFTQRCSLESHLK  194 (267)
T ss_pred             hHHHHHHHHhhhccHHHHHHHhhccCcccchhhhhhhhc-cccCccccchhhhhHHHHhhccHHHHHH
Confidence            334567889999999999999999999999999999998 8999999999999999999999999864


No 5  
>KOG3623|consensus
Probab=99.59  E-value=4.7e-16  Score=89.27  Aligned_cols=70  Identities=30%  Similarity=0.507  Sum_probs=61.8

Q ss_pred             CcChHHHHHHHhHhhC-------------CCceecccccccccchhhHHHhHhhhcCCcCceeCChhhHhhhchHHHHHh
Q psy12265          1 MEKFTYLKVHNRVHLG-------------LKPYGCEVCGRHFRQWGDLKYHKASLHSDVKAFQCEYCGKDFARKYQAHSY   67 (71)
Q Consensus         1 f~~~~~l~~h~~~~~~-------------~~~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~C~~c~~~f~~~~~l~~h   67 (71)
                      |-.++.|.+|+.+|..             -+.|+|..|+++|..+-.|+.|.+ +|.|++||.|+.|++.|+....+..|
T Consensus       250 FAyRtQLErhm~~hkpg~dqa~sltqsa~lRKFKCtECgKAFKfKHHLKEHlR-IHSGEKPfeCpnCkKRFSHSGSySSH  328 (1007)
T KOG3623|consen  250 FAYRTQLERHMQLHKPGGDQAISLTQSALLRKFKCTECGKAFKFKHHLKEHLR-IHSGEKPFECPNCKKRFSHSGSYSSH  328 (1007)
T ss_pred             hhhHHHHHHHHHhhcCCCcccccccchhhhccccccccchhhhhHHHHHhhhe-eecCCCCcCCcccccccccCCccccc
Confidence            4567889999988842             256999999999999999999998 99999999999999999999999999


Q ss_pred             hhcC
Q psy12265         68 HQIR   71 (71)
Q Consensus        68 ~~~~   71 (71)
                      |..+
T Consensus       329 mSSK  332 (1007)
T KOG3623|consen  329 MSSK  332 (1007)
T ss_pred             cccc
Confidence            8653


No 6  
>PHA00733 hypothetical protein
Probab=99.42  E-value=2e-13  Score=65.15  Aligned_cols=60  Identities=23%  Similarity=0.331  Sum_probs=50.2

Q ss_pred             HHHHHhHhhCCCceecccccccccchhhHHHhHhhhcCCcCceeCChhhHhhhchHHHHHhhhc
Q psy12265          7 LKVHNRVHLGLKPYGCEVCGRHFRQWGDLKYHKASLHSDVKAFQCEYCGKDFARKYQAHSYHQI   70 (71)
Q Consensus         7 l~~h~~~~~~~~~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~C~~c~~~f~~~~~l~~h~~~   70 (71)
                      |.+++..+ +++||.|..|++.|.....|..|++ .+  +.+|.|..|++.|.....|..|+..
T Consensus        62 l~~~~~~~-~~kPy~C~~Cgk~Fss~s~L~~H~r-~h--~~~~~C~~CgK~F~~~~sL~~H~~~  121 (128)
T PHA00733         62 LYKLLTSK-AVSPYVCPLCLMPFSSSVSLKQHIR-YT--EHSKVCPVCGKEFRNTDSTLDHVCK  121 (128)
T ss_pred             HHhhcccC-CCCCccCCCCCCcCCCHHHHHHHHh-cC--CcCccCCCCCCccCCHHHHHHHHHH
Confidence            44554443 5889999999999999999999987 45  4579999999999999999999864


No 7  
>PHA02768 hypothetical protein; Provisional
Probab=99.40  E-value=7.2e-14  Score=57.30  Aligned_cols=45  Identities=18%  Similarity=0.364  Sum_probs=40.1

Q ss_pred             ceecccccccccchhhHHHhHhhhcCCcCceeCChhhHhhhchHHHHH
Q psy12265         19 PYGCEVCGRHFRQWGDLKYHKASLHSDVKAFQCEYCGKDFARKYQAHS   66 (71)
Q Consensus        19 ~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~C~~c~~~f~~~~~l~~   66 (71)
                      -|.|+.||+.|+..++|..|++ .|+  ++++|..|++.|...+.|..
T Consensus         5 ~y~C~~CGK~Fs~~~~L~~H~r-~H~--k~~kc~~C~k~f~~~s~l~~   49 (55)
T PHA02768          5 GYECPICGEIYIKRKSMITHLR-KHN--TNLKLSNCKRISLRTGEYIE   49 (55)
T ss_pred             ccCcchhCCeeccHHHHHHHHH-hcC--CcccCCcccceecccceeEE
Confidence            3799999999999999999998 687  68999999999998877653


No 8  
>KOG1074|consensus
Probab=99.37  E-value=9.9e-14  Score=80.65  Aligned_cols=69  Identities=32%  Similarity=0.655  Sum_probs=58.9

Q ss_pred             cChHHHHHHHhHhhCCCceecccccccccchhhHHHhHhhhcCCcC----ceeCC---hhhHhhhchHHHHHhhhcC
Q psy12265          2 EKFTYLKVHNRVHLGLKPYGCEVCGRHFRQWGDLKYHKASLHSDVK----AFQCE---YCGKDFARKYQAHSYHQIR   71 (71)
Q Consensus         2 ~~~~~l~~h~~~~~~~~~~~c~~c~~~~~~~~~l~~h~~~~~~~~~----~~~C~---~c~~~f~~~~~l~~h~~~~   71 (71)
                      ..+++|+.|.++|+||+||+|.+|+.+|+.+++|+.|+. .|....    .+.|+   +|-+.|.+-..|..|++.+
T Consensus       616 SC~saLqmHyrtHtGERPFkCKiCgRAFtTkGNLkaH~~-vHka~p~~R~q~ScP~~~ic~~kftn~V~lpQhIriH  691 (958)
T KOG1074|consen  616 SCPSALQMHYRTHTGERPFKCKICGRAFTTKGNLKAHMS-VHKAKPPARVQFSCPSTFICQKKFTNAVTLPQHIRIH  691 (958)
T ss_pred             cchhhhhhhhhcccCcCccccccccchhccccchhhccc-ccccCccccccccCCchhhhcccccccccccceEEee
Confidence            456889999999999999999999999999999999987 675543    36788   8999999999999888753


No 9  
>KOG3576|consensus
Probab=99.31  E-value=9.8e-13  Score=66.54  Aligned_cols=70  Identities=30%  Similarity=0.533  Sum_probs=59.2

Q ss_pred             CcChHHHHHHHhHhhCCCceecccccccccchhhHHHhHhhhcCC----------cCceeCChhhHhhhchHHHHHhhhc
Q psy12265          1 MEKFTYLKVHNRVHLGLKPYGCEVCGRHFRQWGDLKYHKASLHSD----------VKAFQCEYCGKDFARKYQAHSYHQI   70 (71)
Q Consensus         1 f~~~~~l~~h~~~~~~~~~~~c~~c~~~~~~~~~l~~h~~~~~~~----------~~~~~C~~c~~~f~~~~~l~~h~~~   70 (71)
                      |-....|++|+++|++.+||.|..|+++|++..+|..|....|..          ++.|.|..||.+-.....+..|+++
T Consensus       155 fndtfdlkrh~rthtgvrpykc~~c~kaftqrcsleshl~kvhgv~~~yaykerr~kl~vcedcg~t~~~~e~~~~h~~~  234 (267)
T KOG3576|consen  155 FNDTFDLKRHTRTHTGVRPYKCSLCEKAFTQRCSLESHLKKVHGVQHQYAYKERRAKLYVCEDCGYTSERPEVYYLHLKL  234 (267)
T ss_pred             ccchhhhhhhhccccCccccchhhhhHHHHhhccHHHHHHHHcCchHHHHHHHhhhheeeecccCCCCCChhHHHHHHHh
Confidence            445578999999999999999999999999999999998766643          3568999999988888777777654


No 10 
>PF13465 zf-H2C2_2:  Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A ....
Probab=99.24  E-value=1e-11  Score=44.20  Aligned_cols=25  Identities=48%  Similarity=1.000  Sum_probs=16.2

Q ss_pred             HHHHHHhHhhCCCceeccccccccc
Q psy12265          6 YLKVHNRVHLGLKPYGCEVCGRHFR   30 (71)
Q Consensus         6 ~l~~h~~~~~~~~~~~c~~c~~~~~   30 (71)
                      +|..|+++|.+++||.|+.|++.|.
T Consensus         1 ~l~~H~~~H~~~k~~~C~~C~k~F~   25 (26)
T PF13465_consen    1 NLRRHMRTHTGEKPYKCPYCGKSFS   25 (26)
T ss_dssp             HHHHHHHHHSSSSSEEESSSSEEES
T ss_pred             CHHHHhhhcCCCCCCCCCCCcCeeC
Confidence            3566666666666666666666654


No 11 
>PF13465 zf-H2C2_2:  Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A ....
Probab=99.17  E-value=6.8e-12  Score=44.65  Aligned_cols=26  Identities=38%  Similarity=0.956  Sum_probs=23.1

Q ss_pred             hHHHhHhhhcCCcCceeCChhhHhhhc
Q psy12265         34 DLKYHKASLHSDVKAFQCEYCGKDFAR   60 (71)
Q Consensus        34 ~l~~h~~~~~~~~~~~~C~~c~~~f~~   60 (71)
                      +|.+|++ .|++++||.|+.|++.|.+
T Consensus         1 ~l~~H~~-~H~~~k~~~C~~C~k~F~~   26 (26)
T PF13465_consen    1 NLRRHMR-THTGEKPYKCPYCGKSFSN   26 (26)
T ss_dssp             HHHHHHH-HHSSSSSEEESSSSEEESS
T ss_pred             CHHHHhh-hcCCCCCCCCCCCcCeeCc
Confidence            4789998 7999999999999998863


No 12 
>KOG1074|consensus
Probab=99.17  E-value=1.9e-11  Score=71.52  Aligned_cols=51  Identities=25%  Similarity=0.565  Sum_probs=48.3

Q ss_pred             eecccccccccchhhHHHhHhhhcCCcCceeCChhhHhhhchHHHHHhhhcC
Q psy12265         20 YGCEVCGRHFRQWGDLKYHKASLHSDVKAFQCEYCGKDFARKYQAHSYHQIR   71 (71)
Q Consensus        20 ~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~C~~c~~~f~~~~~l~~h~~~~   71 (71)
                      ..|..|++.|...++|..|++ +|++++||.|..|++.|..+..|+.||.++
T Consensus       880 h~C~vCgk~FsSSsALqiH~r-THtg~KPF~C~fC~~aFttrgnLKvHMgtH  930 (958)
T KOG1074|consen  880 HVCNVCGKQFSSSAALEIHMR-THTGPKPFFCHFCEEAFTTRGNLKVHMGTH  930 (958)
T ss_pred             hhhccchhcccchHHHHHhhh-cCCCCCCccchhhhhhhhhhhhhhhhhccc
Confidence            789999999999999999998 899999999999999999999999998753


No 13 
>KOG3608|consensus
Probab=99.14  E-value=5.2e-11  Score=64.52  Aligned_cols=70  Identities=30%  Similarity=0.364  Sum_probs=60.5

Q ss_pred             CcChHHHHHHHhHhhCCCceecccccccccchhhHHHhHhhh-cCCcCceeCChhhHhhhchHHHHHhhhc
Q psy12265          1 MEKFTYLKVHNRVHLGLKPYGCEVCGRHFRQWGDLKYHKASL-HSDVKAFQCEYCGKDFARKYQAHSYHQI   70 (71)
Q Consensus         1 f~~~~~l~~h~~~~~~~~~~~c~~c~~~~~~~~~l~~h~~~~-~~~~~~~~C~~c~~~f~~~~~l~~h~~~   70 (71)
                      |+++..|..|.+.|++++...|..|+..|.....|..|.+.. -...++|.|..|-+.|+....|..|+..
T Consensus       189 ~~~k~~LreH~r~Hs~eKvvACp~Cg~~F~~~tkl~DH~rRqt~l~~n~fqC~~C~KrFaTeklL~~Hv~r  259 (467)
T KOG3608|consen  189 MGNKYRLREHIRTHSNEKVVACPHCGELFRTKTKLFDHLRRQTELNTNSFQCAQCFKRFATEKLLKSHVVR  259 (467)
T ss_pred             hccHHHHHHHHHhcCCCeEEecchHHHHhccccHHHHHHHhhhhhcCCchHHHHHHHHHhHHHHHHHHHHH
Confidence            467889999999999999999999999999999999998731 2246789999999999999999888754


No 14 
>KOG3608|consensus
Probab=99.10  E-value=1.9e-10  Score=62.41  Aligned_cols=63  Identities=27%  Similarity=0.441  Sum_probs=42.0

Q ss_pred             HHHHHHhHhhCCCceecccccccccchhhHHHhHhhhcCCcCceeCChhhHhhhchHHHHHhhhc
Q psy12265          6 YLKVHNRVHLGLKPYGCEVCGRHFRQWGDLKYHKASLHSDVKAFQCEYCGKDFARKYQAHSYHQI   70 (71)
Q Consensus         6 ~l~~h~~~~~~~~~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~C~~c~~~f~~~~~l~~h~~~   70 (71)
                      .|..|+..|.  ..|.|+.|+.+....++|..|++..|..++||+|..|...+.+.++|++|..+
T Consensus       252 lL~~Hv~rHv--n~ykCplCdmtc~~~ssL~~H~r~rHs~dkpfKCd~Cd~~c~~esdL~kH~~~  314 (467)
T KOG3608|consen  252 LLKSHVVRHV--NCYKCPLCDMTCSSASSLTTHIRYRHSKDKPFKCDECDTRCVRESDLAKHVQV  314 (467)
T ss_pred             HHHHHHHHhh--hcccccccccCCCChHHHHHHHHhhhccCCCccccchhhhhccHHHHHHHHHh
Confidence            3444444442  34677777777677777777776667777777777777777777777777654


No 15 
>PHA00732 hypothetical protein
Probab=99.01  E-value=1.7e-10  Score=50.99  Aligned_cols=46  Identities=22%  Similarity=0.426  Sum_probs=37.2

Q ss_pred             ceecccccccccchhhHHHhHhhhcCCcCceeCChhhHhhhchHHHHHhhhc
Q psy12265         19 PYGCEVCGRHFRQWGDLKYHKASLHSDVKAFQCEYCGKDFARKYQAHSYHQI   70 (71)
Q Consensus        19 ~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~C~~c~~~f~~~~~l~~h~~~   70 (71)
                      ||.|..|++.|....+|..|++..|.   ++.|+.|++.|.   .|..|+.+
T Consensus         1 py~C~~Cgk~F~s~s~Lk~H~r~~H~---~~~C~~CgKsF~---~l~~H~~~   46 (79)
T PHA00732          1 MFKCPICGFTTVTLFALKQHARRNHT---LTKCPVCNKSYR---RLNQHFYS   46 (79)
T ss_pred             CccCCCCCCccCCHHHHHHHhhcccC---CCccCCCCCEeC---Chhhhhcc
Confidence            68899999999999999999863354   358999999998   47777654


No 16 
>PHA00616 hypothetical protein
Probab=98.88  E-value=7.2e-10  Score=43.62  Aligned_cols=35  Identities=26%  Similarity=0.413  Sum_probs=31.5

Q ss_pred             ceecccccccccchhhHHHhHhhhcCCcCceeCChh
Q psy12265         19 PYGCEVCGRHFRQWGDLKYHKASLHSDVKAFQCEYC   54 (71)
Q Consensus        19 ~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~C~~c   54 (71)
                      ||.|..||+.|...+++..|++ .+++++++.|+.-
T Consensus         1 pYqC~~CG~~F~~~s~l~~H~r-~~hg~~~~~~~~~   35 (44)
T PHA00616          1 MYQCLRCGGIFRKKKEVIEHLL-SVHKQNKLTLEYF   35 (44)
T ss_pred             CCccchhhHHHhhHHHHHHHHH-HhcCCCccceeEE
Confidence            6899999999999999999998 7889999988753


No 17 
>PHA00733 hypothetical protein
Probab=98.72  E-value=4.8e-09  Score=50.26  Aligned_cols=65  Identities=14%  Similarity=0.033  Sum_probs=46.0

Q ss_pred             HHHHHHhHhhCCCceecccccccccchhhHHHhH--h--hhcCCcCceeCChhhHhhhchHHHHHhhhc
Q psy12265          6 YLKVHNRVHLGLKPYGCEVCGRHFRQWGDLKYHK--A--SLHSDVKAFQCEYCGKDFARKYQAHSYHQI   70 (71)
Q Consensus         6 ~l~~h~~~~~~~~~~~c~~c~~~~~~~~~l~~h~--~--~~~~~~~~~~C~~c~~~f~~~~~l~~h~~~   70 (71)
                      .|..+-......+++.|.+|...+..+..+..+.  .  ..+.+.+||.|+.|++.|.....|..|++.
T Consensus        27 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~l~~~~~~~~~kPy~C~~Cgk~Fss~s~L~~H~r~   95 (128)
T PHA00733         27 ELKRYHSLTPEQKRLIRAVVKTLIYNPQLLDESSYLYKLLTSKAVSPYVCPLCLMPFSSSVSLKQHIRY   95 (128)
T ss_pred             HhhhhhcCChhhhhHHHHHHhhhccChhhhcchHHHHhhcccCCCCCccCCCCCCcCCCHHHHHHHHhc
Confidence            3443333333467799999998877766665541  1  123457899999999999999999999873


No 18 
>KOG3993|consensus
Probab=98.67  E-value=1.5e-08  Score=56.26  Aligned_cols=66  Identities=24%  Similarity=0.407  Sum_probs=49.7

Q ss_pred             hHHHHHHHhHhhCCCceecccccccccchhhHHHhHhhhcC--------Cc-------------------------Ccee
Q psy12265          4 FTYLKVHNRVHLGLKPYGCEVCGRHFRQWGDLKYHKASLHS--------DV-------------------------KAFQ   50 (71)
Q Consensus         4 ~~~l~~h~~~~~~~~~~~c~~c~~~~~~~~~l~~h~~~~~~--------~~-------------------------~~~~   50 (71)
                      ...|.+|.-...-...|.|.+|++.|.-.++|..|.+ .|.        +.                         --|.
T Consensus       280 ~F~LAQHrC~RIV~vEYrCPEC~KVFsCPANLASHRR-WHKPR~eaa~a~~~P~k~~~~~rae~~ea~rsg~dss~gi~~  358 (500)
T KOG3993|consen  280 AFALAQHRCPRIVHVEYRCPECDKVFSCPANLASHRR-WHKPRPEAAKAGSPPPKQAVETRAEVQEAERSGDDSSSGIFS  358 (500)
T ss_pred             HHHHhhccCCeeEEeeecCCcccccccCchhhhhhhc-ccCCchhhhhcCCCChhhhhhhhhhhhhccccCCcccCceee
Confidence            3445555433333456999999999999999999987 341        11                         1388


Q ss_pred             CChhhHhhhchHHHHHhhhc
Q psy12265         51 CEYCGKDFARKYQAHSYHQI   70 (71)
Q Consensus        51 C~~c~~~f~~~~~l~~h~~~   70 (71)
                      |..|++.|.+...|..|+-+
T Consensus       359 C~~C~KkFrRqAYLrKHqlt  378 (500)
T KOG3993|consen  359 CHTCGKKFRRQAYLRKHQLT  378 (500)
T ss_pred             cHHhhhhhHHHHHHHHhHHh
Confidence            99999999999999999643


No 19 
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning]
Probab=98.65  E-value=1e-08  Score=55.27  Aligned_cols=53  Identities=30%  Similarity=0.654  Sum_probs=44.8

Q ss_pred             CCceeccc--ccccccchhhHHHhHhhhc------------------CCcCceeCChhhHhhhchHHHHHhhh
Q psy12265         17 LKPYGCEV--CGRHFRQWGDLKYHKASLH------------------SDVKAFQCEYCGKDFARKYQAHSYHQ   69 (71)
Q Consensus        17 ~~~~~c~~--c~~~~~~~~~l~~h~~~~~------------------~~~~~~~C~~c~~~f~~~~~l~~h~~   69 (71)
                      ++||+|+.  |.+.|.....|+-|+...|                  ...+||+|++|++.+.+...|..|+.
T Consensus       347 ~KpykCpV~gC~K~YknqnGLKYH~lhGH~~~~~~~~p~p~~~~~F~~~~KPYrCevC~KRYKNlNGLKYHr~  419 (423)
T COG5189         347 GKPYKCPVEGCNKKYKNQNGLKYHMLHGHQNQKLHENPSPEKMNIFSAKDKPYRCEVCDKRYKNLNGLKYHRK  419 (423)
T ss_pred             CceecCCCCCchhhhccccchhhhhhccccCcccCCCCCccccccccccCCceeccccchhhccCccceeccc
Confidence            59999986  9999999999999986333                  12378999999999999999998875


No 20 
>PF05605 zf-Di19:  Drought induced 19 protein (Di19), zinc-binding;  InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins. Di19 has been found to be strongly expressed in both the roots and leaves of Arabidopsis thaliana during progressive drought [], whilst RING finger proteins are thought to play a role in spermatogenesis. The precise function is unknown.
Probab=98.61  E-value=8.6e-08  Score=39.55  Aligned_cols=49  Identities=18%  Similarity=0.302  Sum_probs=39.1

Q ss_pred             ceecccccccccchhhHHHhHhhhcCCc-CceeCChhhHhhhchHHHHHhhhc
Q psy12265         19 PYGCEVCGRHFRQWGDLKYHKASLHSDV-KAFQCEYCGKDFARKYQAHSYHQI   70 (71)
Q Consensus        19 ~~~c~~c~~~~~~~~~l~~h~~~~~~~~-~~~~C~~c~~~f~~~~~l~~h~~~   70 (71)
                      .|.|+.|++ ..+...|..|....|..+ +.+.|++|...+..  +|..|+..
T Consensus         2 ~f~CP~C~~-~~~~~~L~~H~~~~H~~~~~~v~CPiC~~~~~~--~l~~Hl~~   51 (54)
T PF05605_consen    2 SFTCPYCGK-GFSESSLVEHCEDEHRSESKNVVCPICSSRVTD--NLIRHLNS   51 (54)
T ss_pred             CcCCCCCCC-ccCHHHHHHHHHhHCcCCCCCccCCCchhhhhh--HHHHHHHH
Confidence            488999999 566788999987677764 57899999987553  78888864


No 21 
>PLN03086 PRLI-interacting factor K; Provisional
Probab=98.59  E-value=1e-07  Score=54.89  Aligned_cols=50  Identities=22%  Similarity=0.552  Sum_probs=32.5

Q ss_pred             HHHHHHHhHhhCCCceecccccccccchhhHHHhHhhhcCCcCceeCChhhHhhh
Q psy12265          5 TYLKVHNRVHLGLKPYGCEVCGRHFRQWGDLKYHKASLHSDVKAFQCEYCGKDFA   59 (71)
Q Consensus         5 ~~l~~h~~~~~~~~~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~C~~c~~~f~   59 (71)
                      ..|..|+.++.  +++.|. |+..+ ....|..|+. .+.+.+++.|..|+..+.
T Consensus       466 s~LekH~~~~H--kpv~Cp-Cg~~~-~R~~L~~H~~-thCp~Kpi~C~fC~~~v~  515 (567)
T PLN03086        466 GEMEKHMKVFH--EPLQCP-CGVVL-EKEQMVQHQA-STCPLRLITCRFCGDMVQ  515 (567)
T ss_pred             HHHHHHHHhcC--CCccCC-CCCCc-chhHHHhhhh-ccCCCCceeCCCCCCccc
Confidence            45666766653  667777 77543 4567777765 566777777777776663


No 22 
>PF00096 zf-C2H2:  Zinc finger, C2H2 type;  InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger: #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C], where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter []. This entry represents the classical C2H2 zinc finger domain.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0005622 intracellular; PDB: 2D9H_A 2EPC_A 1SP1_A 1VA3_A 2WBT_B 2ELR_A 2YTP_A 2YTT_A 1VA1_A 2ELO_A ....
Probab=98.56  E-value=1.6e-08  Score=34.70  Aligned_cols=21  Identities=29%  Similarity=0.727  Sum_probs=13.3

Q ss_pred             eeCChhhHhhhchHHHHHhhh
Q psy12265         49 FQCEYCGKDFARKYQAHSYHQ   69 (71)
Q Consensus        49 ~~C~~c~~~f~~~~~l~~h~~   69 (71)
                      |.|+.|++.|.....|..|++
T Consensus         1 y~C~~C~~~f~~~~~l~~H~~   21 (23)
T PF00096_consen    1 YKCPICGKSFSSKSNLKRHMR   21 (23)
T ss_dssp             EEETTTTEEESSHHHHHHHHH
T ss_pred             CCCCCCCCccCCHHHHHHHHh
Confidence            456666666666666666665


No 23 
>PHA00616 hypothetical protein
Probab=98.47  E-value=9.3e-08  Score=37.68  Aligned_cols=23  Identities=26%  Similarity=0.432  Sum_probs=21.4

Q ss_pred             ceeCChhhHhhhchHHHHHhhhc
Q psy12265         48 AFQCEYCGKDFARKYQAHSYHQI   70 (71)
Q Consensus        48 ~~~C~~c~~~f~~~~~l~~h~~~   70 (71)
                      ||+|+.||..|.+.++|..|++.
T Consensus         1 pYqC~~CG~~F~~~s~l~~H~r~   23 (44)
T PHA00616          1 MYQCLRCGGIFRKKKEVIEHLLS   23 (44)
T ss_pred             CCccchhhHHHhhHHHHHHHHHH
Confidence            68999999999999999999875


No 24 
>PLN03086 PRLI-interacting factor K; Provisional
Probab=98.40  E-value=5e-07  Score=52.22  Aligned_cols=62  Identities=16%  Similarity=0.392  Sum_probs=49.6

Q ss_pred             hHHHHHHHhHhhCCCceeccccccccc----------chhhHHHhHhhhcCCcCceeCChhhHhhhchHHHHHhh
Q psy12265          4 FTYLKVHNRVHLGLKPYGCEVCGRHFR----------QWGDLKYHKASLHSDVKAFQCEYCGKDFARKYQAHSYH   68 (71)
Q Consensus         4 ~~~l~~h~~~~~~~~~~~c~~c~~~~~----------~~~~l~~h~~~~~~~~~~~~C~~c~~~f~~~~~l~~h~   68 (71)
                      +..|..|+.+|.+++++.|..|+..+.          ....|..|.. . .|.+++.|..||+.+..+ ++..|+
T Consensus       489 R~~L~~H~~thCp~Kpi~C~fC~~~v~~g~~~~d~~d~~s~Lt~HE~-~-CG~rt~~C~~Cgk~Vrlr-dm~~H~  560 (567)
T PLN03086        489 KEQMVQHQASTCPLRLITCRFCGDMVQAGGSAMDVRDRLRGMSEHES-I-CGSRTAPCDSCGRSVMLK-EMDIHQ  560 (567)
T ss_pred             hhHHHhhhhccCCCCceeCCCCCCccccCccccchhhhhhhHHHHHH-h-cCCcceEccccCCeeeeh-hHHHHH
Confidence            467889999999999999999999884          2357889976 3 589999999999887654 455554


No 25 
>PF13912 zf-C2H2_6:  C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B.
Probab=98.37  E-value=1.1e-07  Score=33.76  Aligned_cols=21  Identities=29%  Similarity=0.710  Sum_probs=10.6

Q ss_pred             eeCChhhHhhhchHHHHHhhh
Q psy12265         49 FQCEYCGKDFARKYQAHSYHQ   69 (71)
Q Consensus        49 ~~C~~c~~~f~~~~~l~~h~~   69 (71)
                      |.|..|++.|.....|..|++
T Consensus         2 ~~C~~C~~~F~~~~~l~~H~~   22 (27)
T PF13912_consen    2 FECDECGKTFSSLSALREHKR   22 (27)
T ss_dssp             EEETTTTEEESSHHHHHHHHC
T ss_pred             CCCCccCCccCChhHHHHHhH
Confidence            445555555555555555543


No 26 
>PF00096 zf-C2H2:  Zinc finger, C2H2 type;  InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger: #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C], where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter []. This entry represents the classical C2H2 zinc finger domain.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0005622 intracellular; PDB: 2D9H_A 2EPC_A 1SP1_A 1VA3_A 2WBT_B 2ELR_A 2YTP_A 2YTT_A 1VA1_A 2ELO_A ....
Probab=98.33  E-value=3.9e-07  Score=31.12  Aligned_cols=21  Identities=38%  Similarity=0.903  Sum_probs=19.8

Q ss_pred             eecccccccccchhhHHHhHh
Q psy12265         20 YGCEVCGRHFRQWGDLKYHKA   40 (71)
Q Consensus        20 ~~c~~c~~~~~~~~~l~~h~~   40 (71)
                      |.|..|++.|..+..|..|++
T Consensus         1 y~C~~C~~~f~~~~~l~~H~~   21 (23)
T PF00096_consen    1 YKCPICGKSFSSKSNLKRHMR   21 (23)
T ss_dssp             EEETTTTEEESSHHHHHHHHH
T ss_pred             CCCCCCCCccCCHHHHHHHHh
Confidence            689999999999999999987


No 27 
>PHA02768 hypothetical protein; Provisional
Probab=98.31  E-value=3.4e-07  Score=37.73  Aligned_cols=34  Identities=21%  Similarity=0.127  Sum_probs=29.3

Q ss_pred             CcChHHHHHHHhHhhCCCceecccccccccchhhHH
Q psy12265          1 MEKFTYLKVHNRVHLGLKPYGCEVCGRHFRQWGDLK   36 (71)
Q Consensus         1 f~~~~~l~~h~~~~~~~~~~~c~~c~~~~~~~~~l~   36 (71)
                      |....+|..|+++|.  +++.|..|++.|...+.|.
T Consensus        15 Fs~~~~L~~H~r~H~--k~~kc~~C~k~f~~~s~l~   48 (55)
T PHA02768         15 YIKRKSMITHLRKHN--TNLKLSNCKRISLRTGEYI   48 (55)
T ss_pred             eccHHHHHHHHHhcC--CcccCCcccceecccceeE
Confidence            667889999999998  7999999999998777654


No 28 
>PF12756 zf-C2H2_2:  C2H2 type zinc-finger (2 copies); PDB: 2DMI_A.
Probab=98.30  E-value=2.6e-07  Score=42.06  Aligned_cols=23  Identities=26%  Similarity=0.665  Sum_probs=18.1

Q ss_pred             ceeCChhhHhhhchHHHHHhhhc
Q psy12265         48 AFQCEYCGKDFARKYQAHSYHQI   70 (71)
Q Consensus        48 ~~~C~~c~~~f~~~~~l~~h~~~   70 (71)
                      .+.|..|++.|.....|..|++.
T Consensus        50 ~~~C~~C~~~f~s~~~l~~Hm~~   72 (100)
T PF12756_consen   50 SFRCPYCNKTFRSREALQEHMRS   72 (100)
T ss_dssp             SEEBSSSS-EESSHHHHHHHHHH
T ss_pred             CCCCCccCCCCcCHHHHHHHHcC
Confidence            57888888888888888888864


No 29 
>PF13894 zf-C2H2_4:  C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A ....
Probab=98.29  E-value=2.8e-07  Score=31.54  Aligned_cols=22  Identities=36%  Similarity=0.727  Sum_probs=13.5

Q ss_pred             eeCChhhHhhhchHHHHHhhhc
Q psy12265         49 FQCEYCGKDFARKYQAHSYHQI   70 (71)
Q Consensus        49 ~~C~~c~~~f~~~~~l~~h~~~   70 (71)
                      |.|+.|++.|.....|..|+..
T Consensus         1 ~~C~~C~~~~~~~~~l~~H~~~   22 (24)
T PF13894_consen    1 FQCPICGKSFRSKSELRQHMRT   22 (24)
T ss_dssp             EE-SSTS-EESSHHHHHHHHHH
T ss_pred             CCCcCCCCcCCcHHHHHHHHHh
Confidence            4677777777777777777653


No 30 
>PF13912 zf-C2H2_6:  C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B.
Probab=98.07  E-value=3.9e-06  Score=29.66  Aligned_cols=24  Identities=38%  Similarity=0.938  Sum_probs=21.7

Q ss_pred             ceecccccccccchhhHHHhHhhhc
Q psy12265         19 PYGCEVCGRHFRQWGDLKYHKASLH   43 (71)
Q Consensus        19 ~~~c~~c~~~~~~~~~l~~h~~~~~   43 (71)
                      ||.|..|++.|.+..+|..|++ .|
T Consensus         1 ~~~C~~C~~~F~~~~~l~~H~~-~h   24 (27)
T PF13912_consen    1 PFECDECGKTFSSLSALREHKR-SH   24 (27)
T ss_dssp             SEEETTTTEEESSHHHHHHHHC-TT
T ss_pred             CCCCCccCCccCChhHHHHHhH-Hh
Confidence            6899999999999999999986 44


No 31 
>PF13894 zf-C2H2_4:  C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A ....
Probab=98.05  E-value=5.8e-06  Score=28.08  Aligned_cols=22  Identities=32%  Similarity=0.921  Sum_probs=18.2

Q ss_pred             eecccccccccchhhHHHhHhh
Q psy12265         20 YGCEVCGRHFRQWGDLKYHKAS   41 (71)
Q Consensus        20 ~~c~~c~~~~~~~~~l~~h~~~   41 (71)
                      |.|+.|+..|.+...|..|+..
T Consensus         1 ~~C~~C~~~~~~~~~l~~H~~~   22 (24)
T PF13894_consen    1 FQCPICGKSFRSKSELRQHMRT   22 (24)
T ss_dssp             EE-SSTS-EESSHHHHHHHHHH
T ss_pred             CCCcCCCCcCCcHHHHHHHHHh
Confidence            6899999999999999999873


No 32 
>PRK04860 hypothetical protein; Provisional
Probab=97.98  E-value=3.6e-06  Score=41.86  Aligned_cols=39  Identities=23%  Similarity=0.621  Sum_probs=32.6

Q ss_pred             ceecccccccccchhhHHHhHhhhcCCcCceeCChhhHhhhchH
Q psy12265         19 PYGCEVCGRHFRQWGDLKYHKASLHSDVKAFQCEYCGKDFARKY   62 (71)
Q Consensus        19 ~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~C~~c~~~f~~~~   62 (71)
                      +|.|. |+.   ....+.+|.+ +++++++|.|..|+..|....
T Consensus       119 ~Y~C~-C~~---~~~~~rrH~r-i~~g~~~YrC~~C~~~l~~~~  157 (160)
T PRK04860        119 PYRCK-CQE---HQLTVRRHNR-VVRGEAVYRCRRCGETLVFKG  157 (160)
T ss_pred             EEEcC-CCC---eeCHHHHHHH-HhcCCccEECCCCCceeEEec
Confidence            59998 987   5677788987 899999999999998876543


No 33 
>smart00355 ZnF_C2H2 zinc finger.
Probab=97.95  E-value=3.9e-06  Score=28.94  Aligned_cols=20  Identities=30%  Similarity=0.555  Sum_probs=12.0

Q ss_pred             eCChhhHhhhchHHHHHhhh
Q psy12265         50 QCEYCGKDFARKYQAHSYHQ   69 (71)
Q Consensus        50 ~C~~c~~~f~~~~~l~~h~~   69 (71)
                      .|..|++.|.....|..|++
T Consensus         2 ~C~~C~~~f~~~~~l~~H~~   21 (26)
T smart00355        2 RCPECGKVFKSKSALKEHMR   21 (26)
T ss_pred             CCCCCcchhCCHHHHHHHHH
Confidence            45566666666666666654


No 34 
>PF12171 zf-C2H2_jaz:  Zinc-finger double-stranded RNA-binding;  InterPro: IPR022755  This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length. The mammalian members of this group occur multiple times along the protein, joined by flexible linkers, and are referred to as JAZ - dsRNA-binding ZF protein - zinc-fingers. The JAZ proteins are expressed in all tissues tested and localise in the nucleus, particularly the nucleolus []. JAZ preferentially binds to double-stranded (ds) RNA or RNA/DNA hybrids rather than DNA. In addition to binding double-stranded RNA, these zinc-fingers are required for nucleolar localisation.   This entry represents the multiple-adjacent-C2H2 zinc finger, JAZ. ; PDB: 4DGW_A 1ZR9_A.
Probab=97.82  E-value=2.6e-06  Score=30.26  Aligned_cols=22  Identities=27%  Similarity=0.538  Sum_probs=13.9

Q ss_pred             eeCChhhHhhhchHHHHHhhhc
Q psy12265         49 FQCEYCGKDFARKYQAHSYHQI   70 (71)
Q Consensus        49 ~~C~~c~~~f~~~~~l~~h~~~   70 (71)
                      |.|..|++.|.+...+..|++.
T Consensus         2 ~~C~~C~k~f~~~~~~~~H~~s   23 (27)
T PF12171_consen    2 FYCDACDKYFSSENQLKQHMKS   23 (27)
T ss_dssp             CBBTTTTBBBSSHHHHHCCTTS
T ss_pred             CCcccCCCCcCCHHHHHHHHcc
Confidence            4566666666666666666653


No 35 
>PF12874 zf-met:  Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A.
Probab=97.80  E-value=4.1e-06  Score=29.05  Aligned_cols=19  Identities=26%  Similarity=0.705  Sum_probs=9.2

Q ss_pred             ecccccccccchhhHHHhH
Q psy12265         21 GCEVCGRHFRQWGDLKYHK   39 (71)
Q Consensus        21 ~c~~c~~~~~~~~~l~~h~   39 (71)
                      .|..|+..|.+...+..|+
T Consensus         2 ~C~~C~~~f~s~~~~~~H~   20 (25)
T PF12874_consen    2 YCDICNKSFSSENSLRQHL   20 (25)
T ss_dssp             EETTTTEEESSHHHHHHHH
T ss_pred             CCCCCCCCcCCHHHHHHHH
Confidence            4444555555444444443


No 36 
>smart00355 ZnF_C2H2 zinc finger.
Probab=97.60  E-value=6.8e-05  Score=25.63  Aligned_cols=24  Identities=38%  Similarity=0.764  Sum_probs=20.7

Q ss_pred             eecccccccccchhhHHHhHhhhcC
Q psy12265         20 YGCEVCGRHFRQWGDLKYHKASLHS   44 (71)
Q Consensus        20 ~~c~~c~~~~~~~~~l~~h~~~~~~   44 (71)
                      |.|..|++.|.....+..|++ .|.
T Consensus         1 ~~C~~C~~~f~~~~~l~~H~~-~H~   24 (26)
T smart00355        1 YRCPECGKVFKSKSALKEHMR-THX   24 (26)
T ss_pred             CCCCCCcchhCCHHHHHHHHH-Hhc
Confidence            579999999999999999987 553


No 37 
>PF09237 GAGA:  GAGA factor;  InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  Members of this entry bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 1YUI_A 1YUJ_A.
Probab=97.59  E-value=2.2e-05  Score=31.82  Aligned_cols=26  Identities=15%  Similarity=0.321  Sum_probs=16.5

Q ss_pred             CcCceeCChhhHhhhchHHHHHhhhc
Q psy12265         45 DVKAFQCEYCGKDFARKYQAHSYHQI   70 (71)
Q Consensus        45 ~~~~~~C~~c~~~f~~~~~l~~h~~~   70 (71)
                      .+.|-.|++|+..+.+..+|.+|+.+
T Consensus        21 S~~PatCP~C~a~~~~srnLrRHle~   46 (54)
T PF09237_consen   21 SEQPATCPICGAVIRQSRNLRRHLEI   46 (54)
T ss_dssp             TS--EE-TTT--EESSHHHHHHHHHH
T ss_pred             cCCCCCCCcchhhccchhhHHHHHHH
Confidence            45677888888888888888888754


No 38 
>PF09237 GAGA:  GAGA factor;  InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  Members of this entry bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 1YUI_A 1YUJ_A.
Probab=97.58  E-value=3.7e-05  Score=31.15  Aligned_cols=32  Identities=28%  Similarity=0.487  Sum_probs=21.7

Q ss_pred             hCCCceecccccccccchhhHHHhHhhhcCCcC
Q psy12265         15 LGLKPYGCEVCGRHFRQWGDLKYHKASLHSDVK   47 (71)
Q Consensus        15 ~~~~~~~c~~c~~~~~~~~~l~~h~~~~~~~~~   47 (71)
                      ..+.|..|+.|+..+.+..+|.+|+. ...+.+
T Consensus        20 ~S~~PatCP~C~a~~~~srnLrRHle-~~H~~k   51 (54)
T PF09237_consen   20 QSEQPATCPICGAVIRQSRNLRRHLE-IRHFKK   51 (54)
T ss_dssp             TTS--EE-TTT--EESSHHHHHHHHH-HHTTTS
T ss_pred             ccCCCCCCCcchhhccchhhHHHHHH-HHhccc
Confidence            45678999999999999999999997 444444


No 39 
>KOG3993|consensus
Probab=97.58  E-value=9.5e-06  Score=45.58  Aligned_cols=50  Identities=20%  Similarity=0.380  Sum_probs=41.0

Q ss_pred             eecccccccccchhhHHHhHhhhcCCcCceeCChhhHhhhchHHHHHhhhc
Q psy12265         20 YGCEVCGRHFRQWGDLKYHKASLHSDVKAFQCEYCGKDFARKYQAHSYHQI   70 (71)
Q Consensus        20 ~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~C~~c~~~f~~~~~l~~h~~~   70 (71)
                      |.|..|.-.|...-.|.+|.= ....-..|+|+.|++.|+=.++|..|++-
T Consensus       268 yiCqLCK~kYeD~F~LAQHrC-~RIV~vEYrCPEC~KVFsCPANLASHRRW  317 (500)
T KOG3993|consen  268 YICQLCKEKYEDAFALAQHRC-PRIVHVEYRCPECDKVFSCPANLASHRRW  317 (500)
T ss_pred             HHHHHHHHhhhhHHHHhhccC-CeeEEeeecCCcccccccCchhhhhhhcc
Confidence            899999988988888888842 22234569999999999999999999874


No 40 
>PHA00732 hypothetical protein
Probab=97.56  E-value=2.9e-05  Score=34.43  Aligned_cols=22  Identities=18%  Similarity=0.478  Sum_probs=20.7

Q ss_pred             ceeCChhhHhhhchHHHHHhhh
Q psy12265         48 AFQCEYCGKDFARKYQAHSYHQ   69 (71)
Q Consensus        48 ~~~C~~c~~~f~~~~~l~~h~~   69 (71)
                      ||.|..|++.|.....|..|++
T Consensus         1 py~C~~Cgk~F~s~s~Lk~H~r   22 (79)
T PHA00732          1 MFKCPICGFTTVTLFALKQHAR   22 (79)
T ss_pred             CccCCCCCCccCCHHHHHHHhh
Confidence            5889999999999999999986


No 41 
>PF13913 zf-C2HC_2:  zinc-finger of a C2HC-type
Probab=97.54  E-value=3.2e-05  Score=26.98  Aligned_cols=20  Identities=20%  Similarity=0.599  Sum_probs=12.8

Q ss_pred             eeCChhhHhhhchHHHHHhhh
Q psy12265         49 FQCEYCGKDFARKYQAHSYHQ   69 (71)
Q Consensus        49 ~~C~~c~~~f~~~~~l~~h~~   69 (71)
                      ..|+.||+.| ....|..|++
T Consensus         3 ~~C~~CgR~F-~~~~l~~H~~   22 (25)
T PF13913_consen    3 VPCPICGRKF-NPDRLEKHEK   22 (25)
T ss_pred             CcCCCCCCEE-CHHHHHHHHH
Confidence            3567777777 5666666654


No 42 
>PF12874 zf-met:  Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A.
Probab=97.35  E-value=0.00019  Score=24.71  Aligned_cols=22  Identities=23%  Similarity=0.569  Sum_probs=20.2

Q ss_pred             eeCChhhHhhhchHHHHHhhhc
Q psy12265         49 FQCEYCGKDFARKYQAHSYHQI   70 (71)
Q Consensus        49 ~~C~~c~~~f~~~~~l~~h~~~   70 (71)
                      |.|..|+..|.....++.|++.
T Consensus         1 ~~C~~C~~~f~s~~~~~~H~~s   22 (25)
T PF12874_consen    1 FYCDICNKSFSSENSLRQHLRS   22 (25)
T ss_dssp             EEETTTTEEESSHHHHHHHHTT
T ss_pred             CCCCCCCCCcCCHHHHHHHHCc
Confidence            6799999999999999999875


No 43 
>PF13909 zf-H2C2_5:  C2H2-type zinc-finger domain; PDB: 1X5W_A.
Probab=97.17  E-value=0.00016  Score=24.69  Aligned_cols=21  Identities=14%  Similarity=0.331  Sum_probs=10.9

Q ss_pred             eeCChhhHhhhchHHHHHhhhc
Q psy12265         49 FQCEYCGKDFARKYQAHSYHQI   70 (71)
Q Consensus        49 ~~C~~c~~~f~~~~~l~~h~~~   70 (71)
                      |+|+.|+.... ...|..|++.
T Consensus         1 y~C~~C~y~t~-~~~l~~H~~~   21 (24)
T PF13909_consen    1 YKCPHCSYSTS-KSNLKRHLKR   21 (24)
T ss_dssp             EE-SSSS-EES-HHHHHHHHHH
T ss_pred             CCCCCCCCcCC-HHHHHHHHHh
Confidence            45666665555 5566666543


No 44 
>smart00451 ZnF_U1 U1-like zinc finger. Family of C2H2-type zinc fingers, present in matrin, U1 small nuclear ribonucleoprotein C and other RNA-binding proteins.
Probab=97.03  E-value=0.00022  Score=26.47  Aligned_cols=20  Identities=20%  Similarity=0.489  Sum_probs=10.2

Q ss_pred             eecccccccccchhhHHHhH
Q psy12265         20 YGCEVCGRHFRQWGDLKYHK   39 (71)
Q Consensus        20 ~~c~~c~~~~~~~~~l~~h~   39 (71)
                      |.|..|+..|.....+..|+
T Consensus         4 ~~C~~C~~~~~~~~~~~~H~   23 (35)
T smart00451        4 FYCKLCNVTFTDEISVEAHL   23 (35)
T ss_pred             eEccccCCccCCHHHHHHHH
Confidence            45555555555554444443


No 45 
>PRK04860 hypothetical protein; Provisional
Probab=96.46  E-value=0.0025  Score=31.94  Aligned_cols=29  Identities=34%  Similarity=0.575  Sum_probs=24.8

Q ss_pred             HHHHHHHhHhhCCCceecccccccccchh
Q psy12265          5 TYLKVHNRVHLGLKPYGCEVCGRHFRQWG   33 (71)
Q Consensus         5 ~~l~~h~~~~~~~~~~~c~~c~~~~~~~~   33 (71)
                      ..+.+|.+++.++++|.|..|++.|....
T Consensus       129 ~~~rrH~ri~~g~~~YrC~~C~~~l~~~~  157 (160)
T PRK04860        129 LTVRRHNRVVRGEAVYRCRRCGETLVFKG  157 (160)
T ss_pred             CHHHHHHHHhcCCccEECCCCCceeEEec
Confidence            46788999999999999999998876543


No 46 
>COG4049 Uncharacterized protein containing archaeal-type C2H2 Zn-finger [General function prediction only]
Probab=96.31  E-value=0.004  Score=25.79  Aligned_cols=26  Identities=19%  Similarity=0.367  Sum_probs=19.5

Q ss_pred             cCCcCceeCChhhHhhhchHHHHHhh
Q psy12265         43 HSDVKAFQCEYCGKDFARKYQAHSYH   68 (71)
Q Consensus        43 ~~~~~~~~C~~c~~~f~~~~~l~~h~   68 (71)
                      ..|+.-++|+-|+..|....++.+|.
T Consensus        12 RDGE~~lrCPRC~~~FR~~K~Y~RHV   37 (65)
T COG4049          12 RDGEEFLRCPRCGMVFRRRKDYIRHV   37 (65)
T ss_pred             cCCceeeeCCchhHHHHHhHHHHHHh
Confidence            34666778888888888887777774


No 47 
>cd00350 rubredoxin_like Rubredoxin_like; nonheme iron binding domain containing a [Fe(SCys)4] center. The family includes rubredoxins, a small electron transfer protein, and a slightly smaller modular rubredoxin domain present in rubrerythrin and nigerythrin and detected either N- or C-terminal to such proteins as flavin reductase, NAD(P)H-nitrite reductase, and ferredoxin-thioredoxin reductase. In rubredoxin, the iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), but iron can also be replaced by cobalt, nickel or zinc and believed to be involved in electron transfer.  Rubrerythrins and nigerythrins are small homodimeric proteins, generally consisting of 2 domains: a rubredoxin domain C-terminal to a non-sulfur, oxo-bridged diiron site in the N-terminal rubrerythrin domain.  Rubrerythrins and nigerythrins have putative peroxide activity.
Probab=95.99  E-value=0.0043  Score=22.93  Aligned_cols=24  Identities=33%  Similarity=0.836  Sum_probs=16.4

Q ss_pred             eecccccccccchhhHHHhHhhhcCCcCceeCChhhH
Q psy12265         20 YGCEVCGRHFRQWGDLKYHKASLHSDVKAFQCEYCGK   56 (71)
Q Consensus        20 ~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~C~~c~~   56 (71)
                      |.|..||..+...             ..++.|+.|+.
T Consensus         2 ~~C~~CGy~y~~~-------------~~~~~CP~Cg~   25 (33)
T cd00350           2 YVCPVCGYIYDGE-------------EAPWVCPVCGA   25 (33)
T ss_pred             EECCCCCCEECCC-------------cCCCcCcCCCC
Confidence            6788888554321             25788999975


No 48 
>KOG1146|consensus
Probab=95.86  E-value=0.004  Score=39.90  Aligned_cols=56  Identities=23%  Similarity=0.344  Sum_probs=45.1

Q ss_pred             hhCCCceecccccccccchhhHHHhHhhhc------------------------CCcCceeCChhhHhhhchHHHHHhhh
Q psy12265         14 HLGLKPYGCEVCGRHFRQWGDLKYHKASLH------------------------SDVKAFQCEYCGKDFARKYQAHSYHQ   69 (71)
Q Consensus        14 ~~~~~~~~c~~c~~~~~~~~~l~~h~~~~~------------------------~~~~~~~C~~c~~~f~~~~~l~~h~~   69 (71)
                      +...+.++|..|+..|...+.|..|++..|                        .+-++|.|..|...+..+..|.+|+.
T Consensus       460 ~S~~kt~~cpkc~~~yk~a~~L~vhmRskhp~~~~~~c~~gq~~~~~arg~~~~~~~~p~~C~~C~~stttng~Lsihlq  539 (1406)
T KOG1146|consen  460 HSFFKTLKCPKCNWHYKLAQTLGVHMRSKHPESQSAYCKAGQNHPRLARGEVYRCPGKPYPCRACNYSTTTNGNLSIHLQ  539 (1406)
T ss_pred             ecccccccCCccchhhhhHHHhhhcccccccccchhHhHhccccccccccccccCCCCcccceeeeeeeecchHHHHHHH
Confidence            334478999999999999999999998522                        12346889999999999999999975


No 49 
>COG5048 FOG: Zn-finger [General function prediction only]
Probab=95.54  E-value=0.0024  Score=35.49  Aligned_cols=53  Identities=30%  Similarity=0.468  Sum_probs=42.3

Q ss_pred             CceecccccccccchhhHHHhHhh-hcCCc--CceeCC--hhhHhhhchHHHHHhhhc
Q psy12265         18 KPYGCEVCGRHFRQWGDLKYHKAS-LHSDV--KAFQCE--YCGKDFARKYQAHSYHQI   70 (71)
Q Consensus        18 ~~~~c~~c~~~~~~~~~l~~h~~~-~~~~~--~~~~C~--~c~~~f~~~~~l~~h~~~   70 (71)
                      .++.|..|...|.....+..|.+. .|.++  +++.|+  .|++.|.....+..|..+
T Consensus       288 ~~~~~~~~~~~~s~~~~l~~~~~~~~h~~~~~~~~~~p~~~~~~~~~~~~~~~~~~~~  345 (467)
T COG5048         288 LPIKSKQCNISFSRSSPLTRHLRSVNHSGESLKPFSCPYSLCGKLFSRNDALKRHILL  345 (467)
T ss_pred             cCCCCccccCCccccccccccccccccccccCCceeeeccCCCccccccccccCCccc
Confidence            367888888888888888888763 58888  888888  699888888887777543


No 50 
>KOG2893|consensus
Probab=95.39  E-value=0.0049  Score=32.89  Aligned_cols=42  Identities=26%  Similarity=0.396  Sum_probs=30.1

Q ss_pred             ecccccccccchhhHHHhHhhhcCCcCceeCChhhHhhhchHHHHHh
Q psy12265         21 GCEVCGRHFRQWGDLKYHKASLHSDVKAFQCEYCGKDFARKYQAHSY   67 (71)
Q Consensus        21 ~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~C~~c~~~f~~~~~l~~h   67 (71)
                      .|..|..-|....-|++|+.     .+.|+|-+|-+..-.--.|.+|
T Consensus        12 wcwycnrefddekiliqhqk-----akhfkchichkkl~sgpglsih   53 (341)
T KOG2893|consen   12 WCWYCNREFDDEKILIQHQK-----AKHFKCHICHKKLFSGPGLSIH   53 (341)
T ss_pred             eeeecccccchhhhhhhhhh-----hccceeeeehhhhccCCCceee
Confidence            57789999999888888876     5678999997654433344433


No 51 
>TIGR00373 conserved hypothetical protein TIGR00373. This family of proteins is, so far, restricted to archaeal genomes. The family appears to be distantly related to the N-terminal region of the eukaryotic transcription initiation factor IIE alpha chain.
Probab=95.33  E-value=0.022  Score=28.52  Aligned_cols=33  Identities=18%  Similarity=0.284  Sum_probs=25.2

Q ss_pred             hCCCceecccccccccchhhHHHhHhhhcCCcCceeCChhhHh
Q psy12265         15 LGLKPYGCEVCGRHFRQWGDLKYHKASLHSDVKAFQCEYCGKD   57 (71)
Q Consensus        15 ~~~~~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~C~~c~~~   57 (71)
                      ....-|.|+.|+..|+...++.          .-|.|+.||..
T Consensus       105 ~~~~~Y~Cp~c~~r~tf~eA~~----------~~F~Cp~Cg~~  137 (158)
T TIGR00373       105 TNNMFFICPNMCVRFTFNEAME----------LNFTCPRCGAM  137 (158)
T ss_pred             cCCCeEECCCCCcEeeHHHHHH----------cCCcCCCCCCE
Confidence            3445699999999988776653          25899999864


No 52 
>PF09538 FYDLN_acid:  Protein of unknown function (FYDLN_acid);  InterPro: IPR012644 Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues. The function of members of this family is unknown.
Probab=95.27  E-value=0.0067  Score=28.55  Aligned_cols=32  Identities=25%  Similarity=0.697  Sum_probs=21.9

Q ss_pred             CceecccccccccchhhHHHhHhhhcCCcCceeCChhhHhhhch
Q psy12265         18 KPYGCEVCGRHFRQWGDLKYHKASLHSDVKAFQCEYCGKDFARK   61 (71)
Q Consensus        18 ~~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~C~~c~~~f~~~   61 (71)
                      ....|..||..|--            .+..|..|++||..|.-.
T Consensus         8 tKR~Cp~CG~kFYD------------Lnk~PivCP~CG~~~~~~   39 (108)
T PF09538_consen    8 TKRTCPSCGAKFYD------------LNKDPIVCPKCGTEFPPE   39 (108)
T ss_pred             CcccCCCCcchhcc------------CCCCCccCCCCCCccCcc
Confidence            34688889877632            223577899999877644


No 53 
>COG1592 Rubrerythrin [Energy production and conversion]
Probab=95.13  E-value=0.011  Score=29.82  Aligned_cols=25  Identities=36%  Similarity=0.793  Sum_probs=19.4

Q ss_pred             CceecccccccccchhhHHHhHhhhcCCcCceeCChhhH
Q psy12265         18 KPYGCEVCGRHFRQWGDLKYHKASLHSDVKAFQCEYCGK   56 (71)
Q Consensus        18 ~~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~C~~c~~   56 (71)
                      +.|.|..||..              +-++.|..||+||.
T Consensus       133 ~~~vC~vCGy~--------------~~ge~P~~CPiCga  157 (166)
T COG1592         133 KVWVCPVCGYT--------------HEGEAPEVCPICGA  157 (166)
T ss_pred             CEEEcCCCCCc--------------ccCCCCCcCCCCCC
Confidence            36999999733              44588899999983


No 54 
>smart00531 TFIIE Transcription initiation factor IIE.
Probab=95.12  E-value=0.049  Score=26.91  Aligned_cols=38  Identities=21%  Similarity=0.519  Sum_probs=25.5

Q ss_pred             CCCceecccccccccchhhHHHhHhhhcCCcCceeCChhhHhh
Q psy12265         16 GLKPYGCEVCGRHFRQWGDLKYHKASLHSDVKAFQCEYCGKDF   58 (71)
Q Consensus        16 ~~~~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~C~~c~~~f   58 (71)
                      ...-|.|+.|+..|+....+..    ... ...|.|+.||...
T Consensus        96 ~~~~Y~Cp~C~~~y~~~ea~~~----~d~-~~~f~Cp~Cg~~l  133 (147)
T smart00531       96 NNAYYKCPNCQSKYTFLEANQL----LDM-DGTFTCPRCGEEL  133 (147)
T ss_pred             CCcEEECcCCCCEeeHHHHHHh----cCC-CCcEECCCCCCEE
Confidence            3456999999999886544322    122 3349999999754


No 55 
>PF13719 zinc_ribbon_5:  zinc-ribbon domain
Probab=94.70  E-value=0.022  Score=21.58  Aligned_cols=34  Identities=29%  Similarity=0.604  Sum_probs=23.3

Q ss_pred             eecccccccccchhhHHHhHhhhcCCcCceeCChhhHhhh
Q psy12265         20 YGCEVCGRHFRQWGDLKYHKASLHSDVKAFQCEYCGKDFA   59 (71)
Q Consensus        20 ~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~C~~c~~~f~   59 (71)
                      ..|+.|+..|.-..+-      ...+....+|+.|+..|.
T Consensus         3 i~CP~C~~~f~v~~~~------l~~~~~~vrC~~C~~~f~   36 (37)
T PF13719_consen    3 ITCPNCQTRFRVPDDK------LPAGGRKVRCPKCGHVFR   36 (37)
T ss_pred             EECCCCCceEEcCHHH------cccCCcEEECCCCCcEee
Confidence            4788999888766542      233345679999987764


No 56 
>PRK06266 transcription initiation factor E subunit alpha; Validated
Probab=94.67  E-value=0.037  Score=28.29  Aligned_cols=32  Identities=22%  Similarity=0.455  Sum_probs=24.1

Q ss_pred             CCCceecccccccccchhhHHHhHhhhcCCcCceeCChhhHh
Q psy12265         16 GLKPYGCEVCGRHFRQWGDLKYHKASLHSDVKAFQCEYCGKD   57 (71)
Q Consensus        16 ~~~~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~C~~c~~~   57 (71)
                      ...-|.|+.|+..|+...++.          .-|.|+.||..
T Consensus       114 ~~~~Y~Cp~C~~rytf~eA~~----------~~F~Cp~Cg~~  145 (178)
T PRK06266        114 NNMFFFCPNCHIRFTFDEAME----------YGFRCPQCGEM  145 (178)
T ss_pred             CCCEEECCCCCcEEeHHHHhh----------cCCcCCCCCCC
Confidence            345699999999988766532          25899999864


No 57 
>PF12756 zf-C2H2_2:  C2H2 type zinc-finger (2 copies); PDB: 2DMI_A.
Probab=94.61  E-value=0.041  Score=24.76  Aligned_cols=23  Identities=30%  Similarity=0.680  Sum_probs=20.4

Q ss_pred             ceecccccccccchhhHHHhHhh
Q psy12265         19 PYGCEVCGRHFRQWGDLKYHKAS   41 (71)
Q Consensus        19 ~~~c~~c~~~~~~~~~l~~h~~~   41 (71)
                      .+.|..|+..|.+...|..|+..
T Consensus        50 ~~~C~~C~~~f~s~~~l~~Hm~~   72 (100)
T PF12756_consen   50 SFRCPYCNKTFRSREALQEHMRS   72 (100)
T ss_dssp             SEEBSSSS-EESSHHHHHHHHHH
T ss_pred             CCCCCccCCCCcCHHHHHHHHcC
Confidence            59999999999999999999984


No 58 
>TIGR02098 MJ0042_CXXC MJ0042 family finger-like domain. This domain contains a CXXCX(19)CXXC motif suggestive of both zinc fingers and thioredoxin, usually found at the N-terminus of prokaryotic proteins. One partially characterized gene, agmX, is among a large set in Myxococcus whose interruption affects adventurous gliding motility.
Probab=94.40  E-value=0.027  Score=21.25  Aligned_cols=34  Identities=21%  Similarity=0.453  Sum_probs=22.2

Q ss_pred             eecccccccccchhhHHHhHhhhcCCcCceeCChhhHhhh
Q psy12265         20 YGCEVCGRHFRQWGDLKYHKASLHSDVKAFQCEYCGKDFA   59 (71)
Q Consensus        20 ~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~C~~c~~~f~   59 (71)
                      ..|+.|+..|.-..+..      ........|+.|+..|.
T Consensus         3 ~~CP~C~~~~~v~~~~~------~~~~~~v~C~~C~~~~~   36 (38)
T TIGR02098         3 IQCPNCKTSFRVVDSQL------GANGGKVRCGKCGHVWY   36 (38)
T ss_pred             EECCCCCCEEEeCHHHc------CCCCCEEECCCCCCEEE
Confidence            57899998876654421      22223578999987664


No 59 
>PF13717 zinc_ribbon_4:  zinc-ribbon domain
Probab=94.18  E-value=0.04  Score=20.75  Aligned_cols=33  Identities=18%  Similarity=0.528  Sum_probs=22.7

Q ss_pred             eecccccccccchhhHHHhHhhhcCCcCceeCChhhHhh
Q psy12265         20 YGCEVCGRHFRQWGDLKYHKASLHSDVKAFQCEYCGKDF   58 (71)
Q Consensus        20 ~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~C~~c~~~f   58 (71)
                      ..|+.|+..|.-....      ........+|+.|+..|
T Consensus         3 i~Cp~C~~~y~i~d~~------ip~~g~~v~C~~C~~~f   35 (36)
T PF13717_consen    3 ITCPNCQAKYEIDDEK------IPPKGRKVRCSKCGHVF   35 (36)
T ss_pred             EECCCCCCEEeCCHHH------CCCCCcEEECCCCCCEe
Confidence            5788898888766542      23334467899998766


No 60 
>KOG2186|consensus
Probab=93.96  E-value=0.036  Score=29.86  Aligned_cols=38  Identities=32%  Similarity=0.749  Sum_probs=17.0

Q ss_pred             eecccccccccchhhHHHhHhhhcCCcCceeCChhhHhhhc
Q psy12265         20 YGCEVCGRHFRQWGDLKYHKASLHSDVKAFQCEYCGKDFAR   60 (71)
Q Consensus        20 ~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~C~~c~~~f~~   60 (71)
                      |.|..||.... +..+.+|+. ...+ ..|.|.-|+..|..
T Consensus         4 FtCnvCgEsvK-Kp~vekH~s-rCrn-~~fSCIDC~k~F~~   41 (276)
T KOG2186|consen    4 FTCNVCGESVK-KPQVEKHMS-RCRN-AYFSCIDCGKTFER   41 (276)
T ss_pred             Eehhhhhhhcc-ccchHHHHH-hccC-CeeEEeeccccccc
Confidence            44555554432 233444543 2333 34555555555544


No 61 
>PF09986 DUF2225:  Uncharacterized protein conserved in bacteria (DUF2225);  InterPro: IPR018708 This conserved bacterial family has no known function.
Probab=93.54  E-value=0.016  Score=30.37  Aligned_cols=44  Identities=23%  Similarity=0.366  Sum_probs=27.0

Q ss_pred             CCceecccccccccchhhHHHhHhh---------hcCCcCc-----eeCChhhHhhhc
Q psy12265         17 LKPYGCEVCGRHFRQWGDLKYHKAS---------LHSDVKA-----FQCEYCGKDFAR   60 (71)
Q Consensus        17 ~~~~~c~~c~~~~~~~~~l~~h~~~---------~~~~~~~-----~~C~~c~~~f~~   60 (71)
                      ++...|+.|+..|..+.-.....+.         ...+..|     ..|+.||..+..
T Consensus         3 ~k~~~CPvC~~~F~~~~vrs~~~r~~~~d~D~~~~Y~~vnP~~Y~V~vCP~CgyA~~~   60 (214)
T PF09986_consen    3 DKKITCPVCGKEFKTKKVRSGKIRVIRRDSDFCPRYKGVNPLFYEVWVCPHCGYAAFE   60 (214)
T ss_pred             CCceECCCCCCeeeeeEEEcCCceEeeecCCCccccCCCCCeeeeEEECCCCCCcccc
Confidence            4678999999998766443332221         1122333     479999976553


No 62 
>COG2888 Predicted Zn-ribbon RNA-binding protein with a function in translation [Translation, ribosomal structure and biogenesis]
Probab=93.24  E-value=0.1  Score=21.95  Aligned_cols=32  Identities=19%  Similarity=0.392  Sum_probs=19.0

Q ss_pred             ceecccccccccchhhHHHhHhhhcCCcCceeCChhhH
Q psy12265         19 PYGCEVCGRHFRQWGDLKYHKASLHSDVKAFQCEYCGK   56 (71)
Q Consensus        19 ~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~C~~c~~   56 (71)
                      .|.|+.||........-      -.....+|.|+.||.
T Consensus        27 ~F~CPnCGe~~I~Rc~~------CRk~g~~Y~Cp~CGF   58 (61)
T COG2888          27 KFPCPNCGEVEIYRCAK------CRKLGNPYRCPKCGF   58 (61)
T ss_pred             EeeCCCCCceeeehhhh------HHHcCCceECCCcCc
Confidence            47888888554433221      122356889988874


No 63 
>KOG1146|consensus
Probab=93.16  E-value=0.058  Score=35.13  Aligned_cols=54  Identities=17%  Similarity=0.208  Sum_probs=42.0

Q ss_pred             CCCceecccccccccchhhHHHhHhh----------------hcCCcCceeCChhhHhhhchHHHHHhhhc
Q psy12265         16 GLKPYGCEVCGRHFRQWGDLKYHKAS----------------LHSDVKAFQCEYCGKDFARKYQAHSYHQI   70 (71)
Q Consensus        16 ~~~~~~c~~c~~~~~~~~~l~~h~~~----------------~~~~~~~~~C~~c~~~f~~~~~l~~h~~~   70 (71)
                      .+.+|.|..|...|.....+..|.+.                .+....+| |..|...|+....|++|++.
T Consensus      1281 ~~~~~~~~~~~~~~~~~~~l~~~~~k~~~~~~~~~~~~~~~l~~~d~~~~-c~~c~~~~~~~~alqihm~~ 1350 (1406)
T KOG1146|consen 1281 VTHRYLCRQCKMAFDGEAPLTAHQRKFCFAGRGSGGSMPPPLRVPDCTYH-CLACEVLLSGREALQIHMRS 1350 (1406)
T ss_pred             cchhHHHHHHHhhhcchhHHHHHHHHHHhccCccccCCCCcccCcccccc-chHHHhhcchhHHHHHHHHH
Confidence            34678999999999999888888753                11222345 99999999999999999874


No 64 
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning]
Probab=93.04  E-value=0.028  Score=31.33  Aligned_cols=24  Identities=46%  Similarity=1.081  Sum_probs=21.1

Q ss_pred             CCCceecccccccccchhhHHHhH
Q psy12265         16 GLKPYGCEVCGRHFRQWGDLKYHK   39 (71)
Q Consensus        16 ~~~~~~c~~c~~~~~~~~~l~~h~   39 (71)
                      ..+||.|+.|++.|.....|+-|.
T Consensus       395 ~~KPYrCevC~KRYKNlNGLKYHr  418 (423)
T COG5189         395 KDKPYRCEVCDKRYKNLNGLKYHR  418 (423)
T ss_pred             cCCceeccccchhhccCccceecc
Confidence            459999999999999988888885


No 65 
>cd00729 rubredoxin_SM Rubredoxin, Small Modular nonheme iron binding domain containing a [Fe(SCys)4] center, present in rubrerythrin and nigerythrin and detected either N- or C-terminal to such proteins as flavin reductase, NAD(P)H-nitrite reductase, and ferredoxin-thioredoxin reductase. In rubredoxin, the iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), and  believed to be involved in electron transfer. Rubrerythrins and nigerythrins are small homodimeric proteins, generally consisting of 2 domains: a rubredoxin domain C-terminal to a non-sulfur, oxo-bridged diiron site in the N-terminal rubrerythrin domain. Rubrerythrins and nigerythrins have putative peroxide activity.
Probab=92.72  E-value=0.076  Score=19.73  Aligned_cols=25  Identities=28%  Similarity=0.708  Sum_probs=16.5

Q ss_pred             ceecccccccccchhhHHHhHhhhcCCcCceeCChhhH
Q psy12265         19 PYGCEVCGRHFRQWGDLKYHKASLHSDVKAFQCEYCGK   56 (71)
Q Consensus        19 ~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~C~~c~~   56 (71)
                      .|.|..||..+..             .+.|..|+.|+.
T Consensus         2 ~~~C~~CG~i~~g-------------~~~p~~CP~Cg~   26 (34)
T cd00729           2 VWVCPVCGYIHEG-------------EEAPEKCPICGA   26 (34)
T ss_pred             eEECCCCCCEeEC-------------CcCCCcCcCCCC
Confidence            4788999855321             124668999975


No 66 
>PRK00398 rpoP DNA-directed RNA polymerase subunit P; Provisional
Probab=92.69  E-value=0.11  Score=20.48  Aligned_cols=31  Identities=29%  Similarity=0.665  Sum_probs=20.2

Q ss_pred             CceecccccccccchhhHHHhHhhhcCCcCceeCChhhHhhh
Q psy12265         18 KPYGCEVCGRHFRQWGDLKYHKASLHSDVKAFQCEYCGKDFA   59 (71)
Q Consensus        18 ~~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~C~~c~~~f~   59 (71)
                      ..|.|..|+..+.....           ...+.|+.||..+.
T Consensus         2 ~~y~C~~CG~~~~~~~~-----------~~~~~Cp~CG~~~~   32 (46)
T PRK00398          2 AEYKCARCGREVELDEY-----------GTGVRCPYCGYRIL   32 (46)
T ss_pred             CEEECCCCCCEEEECCC-----------CCceECCCCCCeEE
Confidence            35889999877653211           11678999986543


No 67 
>TIGR02300 FYDLN_acid conserved hypothetical protein TIGR02300. Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues. The function of members of this family is unknown.
Probab=92.54  E-value=0.054  Score=26.24  Aligned_cols=32  Identities=19%  Similarity=0.362  Sum_probs=21.2

Q ss_pred             CceecccccccccchhhHHHhHhhhcCCcCceeCChhhHhhhch
Q psy12265         18 KPYGCEVCGRHFRQWGDLKYHKASLHSDVKAFQCEYCGKDFARK   61 (71)
Q Consensus        18 ~~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~C~~c~~~f~~~   61 (71)
                      ....|..|+..|-            -.+..|..|++||..|.-.
T Consensus         8 tKr~Cp~cg~kFY------------DLnk~p~vcP~cg~~~~~~   39 (129)
T TIGR02300         8 TKRICPNTGSKFY------------DLNRRPAVSPYTGEQFPPE   39 (129)
T ss_pred             ccccCCCcCcccc------------ccCCCCccCCCcCCccCcc
Confidence            3467888887763            2224577889998876544


No 68 
>smart00659 RPOLCX RNA polymerase subunit CX. present in RNA polymerase I, II and III
Probab=92.28  E-value=0.12  Score=20.36  Aligned_cols=27  Identities=30%  Similarity=0.624  Sum_probs=18.5

Q ss_pred             ceecccccccccchhhHHHhHhhhcCCcCceeCChhhHh
Q psy12265         19 PYGCEVCGRHFRQWGDLKYHKASLHSDVKAFQCEYCGKD   57 (71)
Q Consensus        19 ~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~C~~c~~~   57 (71)
                      .|.|..|+..+...            ...+.+|+.||..
T Consensus         2 ~Y~C~~Cg~~~~~~------------~~~~irC~~CG~r   28 (44)
T smart00659        2 IYICGECGRENEIK------------SKDVVRCRECGYR   28 (44)
T ss_pred             EEECCCCCCEeecC------------CCCceECCCCCce
Confidence            47899998766532            2345789999864


No 69 
>KOG2593|consensus
Probab=92.20  E-value=0.16  Score=29.43  Aligned_cols=38  Identities=26%  Similarity=0.707  Sum_probs=26.7

Q ss_pred             hCCCceecccccccccchhhHHHhHhhhcCCcCceeCChhhH
Q psy12265         15 LGLKPYGCEVCGRHFRQWGDLKYHKASLHSDVKAFQCEYCGK   56 (71)
Q Consensus        15 ~~~~~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~C~~c~~   56 (71)
                      +...-|.|+.|.+.|+....+..    .....-.|.|..|+-
T Consensus       124 t~~~~Y~Cp~C~kkyt~Lea~~L----~~~~~~~F~C~~C~g  161 (436)
T KOG2593|consen  124 TNVAGYVCPNCQKKYTSLEALQL----LDNETGEFHCENCGG  161 (436)
T ss_pred             cccccccCCccccchhhhHHHHh----hcccCceEEEecCCC
Confidence            34566999999999987766542    233344699998863


No 70 
>PF09723 Zn-ribbon_8:  Zinc ribbon domain;  InterPro: IPR013429  This entry represents a region of about 41 amino acids found in a number of small proteins in a wide range of bacteria. The region usually begins with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One protein in this entry has been noted as a putative regulatory protein, designated FmdB []. Most proteins in this entry have a C-terminal region containing highly degenerate sequence.
Probab=92.07  E-value=0.066  Score=20.81  Aligned_cols=29  Identities=31%  Similarity=0.815  Sum_probs=19.8

Q ss_pred             eecccccccccchhhHHHhHhhhcCCcCceeCChhhH
Q psy12265         20 YGCEVCGRHFRQWGDLKYHKASLHSDVKAFQCEYCGK   56 (71)
Q Consensus        20 ~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~C~~c~~   56 (71)
                      |.|..|+..|.....       ... ..+..|+.||.
T Consensus         6 y~C~~Cg~~fe~~~~-------~~~-~~~~~CP~Cg~   34 (42)
T PF09723_consen    6 YRCEECGHEFEVLQS-------ISE-DDPVPCPECGS   34 (42)
T ss_pred             EEeCCCCCEEEEEEE-------cCC-CCCCcCCCCCC
Confidence            789999988864332       122 44568999986


No 71 
>KOG2893|consensus
Probab=91.63  E-value=0.062  Score=28.92  Aligned_cols=25  Identities=20%  Similarity=0.525  Sum_probs=21.7

Q ss_pred             cCceeCChhhHhhhchHHHHHhhhcC
Q psy12265         46 VKAFQCEYCGKDFARKYQAHSYHQIR   71 (71)
Q Consensus        46 ~~~~~C~~c~~~f~~~~~l~~h~~~~   71 (71)
                      .++| |.+|++.|.....|.+|++.+
T Consensus         9 ~kpw-cwycnrefddekiliqhqkak   33 (341)
T KOG2893|consen    9 DKPW-CWYCNREFDDEKILIQHQKAK   33 (341)
T ss_pred             CCce-eeecccccchhhhhhhhhhhc
Confidence            4566 899999999999999999864


No 72 
>KOG3408|consensus
Probab=91.60  E-value=0.22  Score=24.05  Aligned_cols=24  Identities=17%  Similarity=0.397  Sum_probs=20.0

Q ss_pred             ceeCChhhHhhhchHHHHHhhhcC
Q psy12265         48 AFQCEYCGKDFARKYQAHSYHQIR   71 (71)
Q Consensus        48 ~~~C~~c~~~f~~~~~l~~h~~~~   71 (71)
                      .|.|..|.+.|.....|..|.+.+
T Consensus        57 qfyCi~CaRyFi~~~~l~~H~ktK   80 (129)
T KOG3408|consen   57 QFYCIECARYFIDAKALKTHFKTK   80 (129)
T ss_pred             eeehhhhhhhhcchHHHHHHHhcc
Confidence            478999999999999999887753


No 73 
>PRK00464 nrdR transcriptional regulator NrdR; Validated
Probab=91.25  E-value=0.036  Score=27.76  Aligned_cols=14  Identities=36%  Similarity=0.702  Sum_probs=10.4

Q ss_pred             ceeCChhhHhhhch
Q psy12265         48 AFQCEYCGKDFARK   61 (71)
Q Consensus        48 ~~~C~~c~~~f~~~   61 (71)
                      .++|+.||.+|...
T Consensus        28 ~~~c~~c~~~f~~~   41 (154)
T PRK00464         28 RRECLACGKRFTTF   41 (154)
T ss_pred             eeeccccCCcceEe
Confidence            37888888888643


No 74 
>KOG2785|consensus
Probab=91.16  E-value=0.23  Score=28.37  Aligned_cols=24  Identities=25%  Similarity=0.411  Sum_probs=17.3

Q ss_pred             CceeCChhhHhhhchHHHHHhhhc
Q psy12265         47 KAFQCEYCGKDFARKYQAHSYHQI   70 (71)
Q Consensus        47 ~~~~C~~c~~~f~~~~~l~~h~~~   70 (71)
                      .++.|..|.+.|...-....|++.
T Consensus        67 ~~~~c~~c~k~~~s~~a~~~hl~S   90 (390)
T KOG2785|consen   67 SVVYCEACNKSFASPKAHENHLKS   90 (390)
T ss_pred             cceehHHhhccccChhhHHHHHHH
Confidence            456778888888777777777654


No 75 
>PF07754 DUF1610:  Domain of unknown function (DUF1610);  InterPro: IPR011668 This domain is found in archaeal species. It is likely to bind zinc via its four well-conserved cysteine residues.
Probab=90.98  E-value=0.072  Score=18.32  Aligned_cols=11  Identities=36%  Similarity=0.905  Sum_probs=7.6

Q ss_pred             cCceeCChhhH
Q psy12265         46 VKAFQCEYCGK   56 (71)
Q Consensus        46 ~~~~~C~~c~~   56 (71)
                      ..+|.|+.||+
T Consensus        14 ~v~f~CPnCG~   24 (24)
T PF07754_consen   14 AVPFPCPNCGF   24 (24)
T ss_pred             CceEeCCCCCC
Confidence            34688888873


No 76 
>PF02892 zf-BED:  BED zinc finger;  InterPro: IPR003656 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents predicted BED-type zinc finger domains. The BED finger which was named after the Drosophila proteins BEAF and DREF, is found in one or more copies in cellular regulatory factors and transposases from plants, animals and fungi. The BED finger is an about 50 to 60 amino acid residues domain that contains a characteristic motif with two highly conserved aromatic positions, as well as a shared pattern of cysteines and histidines that is predicted to form a zinc finger. As diverse BED fingers are able to bind DNA, it has been suggested that DNA-binding is the general function of this domain []. Some proteins known to contain a BED domain include animal, plant and fungi AC1 and Hobo-like transposases; Caenorhabditis elegans Dpy-20 protein, a predicted cuticular gene transcriptional regulator; Drosophila BEAF (boundary element-associated factor), thought to be involved in chromatin insulation; Drosophila DREF, a transcriptional regulator for S-phase genes; and tobacco 3AF1 and tomato E4/E8-BP1, light- and ethylene-regulated DNA binding proteins that contain two BED fingers. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003677 DNA binding; PDB: 2DJR_A 2CT5_A.
Probab=90.88  E-value=0.14  Score=19.87  Aligned_cols=20  Identities=25%  Similarity=0.516  Sum_probs=8.1

Q ss_pred             eeCChhhHhhhch----HHHHHhh
Q psy12265         49 FQCEYCGKDFARK----YQAHSYH   68 (71)
Q Consensus        49 ~~C~~c~~~f~~~----~~l~~h~   68 (71)
                      ..|..|++.+...    +.|..|+
T Consensus        17 a~C~~C~~~~~~~~~~ts~l~~HL   40 (45)
T PF02892_consen   17 AKCKYCGKVIKYSSGGTSNLKRHL   40 (45)
T ss_dssp             EEETTTTEE-----SSTHHHHHHH
T ss_pred             EEeCCCCeEEeeCCCcHHHHHHhh
Confidence            4455555444332    4455554


No 77 
>KOG4167|consensus
Probab=90.79  E-value=0.11  Score=32.21  Aligned_cols=24  Identities=25%  Similarity=0.510  Sum_probs=21.0

Q ss_pred             ceeCChhhHhhhchHHHHHhhhcC
Q psy12265         48 AFQCEYCGKDFARKYQAHSYHQIR   71 (71)
Q Consensus        48 ~~~C~~c~~~f~~~~~l~~h~~~~   71 (71)
                      -|.|..|++.|-....+.-||+++
T Consensus       792 iFpCreC~kvF~KiKSrNAHMK~H  815 (907)
T KOG4167|consen  792 IFPCRECGKVFFKIKSRNAHMKTH  815 (907)
T ss_pred             eeehHHHHHHHHHHhhhhHHHHHH
Confidence            389999999999999999998864


No 78 
>PF15269 zf-C2H2_7:  Zinc-finger
Probab=90.69  E-value=0.12  Score=20.51  Aligned_cols=21  Identities=14%  Similarity=0.295  Sum_probs=15.2

Q ss_pred             eeCChhhHhhhchHHHHHhhh
Q psy12265         49 FQCEYCGKDFARKYQAHSYHQ   69 (71)
Q Consensus        49 ~~C~~c~~~f~~~~~l~~h~~   69 (71)
                      |+|-.|+.+...++.|-.||+
T Consensus        21 ykcfqcpftc~~kshl~nhmk   41 (54)
T PF15269_consen   21 YKCFQCPFTCNEKSHLFNHMK   41 (54)
T ss_pred             ceeecCCcccchHHHHHHHHH
Confidence            467777777777777777775


No 79 
>smart00734 ZnF_Rad18 Rad18-like CCHC zinc finger. Yeast Rad18p functions with Rad5p in error-free post-replicative DNA repair. This zinc finger is likely to bind nucleic-acids.
Probab=90.66  E-value=0.15  Score=17.76  Aligned_cols=18  Identities=22%  Similarity=0.375  Sum_probs=9.3

Q ss_pred             eCChhhHhhhchHHHHHhh
Q psy12265         50 QCEYCGKDFARKYQAHSYH   68 (71)
Q Consensus        50 ~C~~c~~~f~~~~~l~~h~   68 (71)
                      .|++|++.+ ....+..|.
T Consensus         3 ~CPiC~~~v-~~~~in~HL   20 (26)
T smart00734        3 QCPVCFREV-PENLINSHL   20 (26)
T ss_pred             cCCCCcCcc-cHHHHHHHH
Confidence            466666555 334444443


No 80 
>PF04959 ARS2:  Arsenite-resistance protein 2;  InterPro: IPR007042 This entry represents Arsenite-resistance protein 2 (also known as Serrate RNA effector molecule homolog) which is thought to play a role in arsenite resistance [], although does not directly confer arsenite resistance but rather modulates arsenic sensitivity []. Arsenite is a carcinogenic compound which can act as a comutagen by inhibiting DNA repair. It is also involved in cell cycle progression at S phase. ; PDB: 3AX1_A.
Probab=90.55  E-value=0.068  Score=28.18  Aligned_cols=25  Identities=20%  Similarity=0.299  Sum_probs=14.7

Q ss_pred             cCceeCChhhHhhhchHHHHHhhhc
Q psy12265         46 VKAFQCEYCGKDFARKYQAHSYHQI   70 (71)
Q Consensus        46 ~~~~~C~~c~~~f~~~~~l~~h~~~   70 (71)
                      +..|.|+.|++.|.-..-+..|+..
T Consensus        75 ~~K~~C~lc~KlFkg~eFV~KHI~n   99 (214)
T PF04959_consen   75 EDKWRCPLCGKLFKGPEFVRKHIFN   99 (214)
T ss_dssp             SEEEEE-SSS-EESSHHHHHHHHHH
T ss_pred             CCEECCCCCCcccCChHHHHHHHhh
Confidence            3446777777777766666666643


No 81 
>TIGR02605 CxxC_CxxC_SSSS putative regulatory protein, FmdB family. This model represents a region of about 50 amino acids found in a number of small proteins in a wide range of bacteria. The region begins usually with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One member of this family is has been noted as a putative regulatory protein, designated FmdB (PubMed:8841393). Most members of this family have a C-terminal region containing highly degenerate sequence, such as SSTSESTKSSGSSGSSGSSESKASGSTEKSTSSTTAAAAV in Mycobacterium tuberculosis and VAVGGSAPAPSPAPRAGGGGGGCCGGGCCG in Streptomyces avermitilis. These low complexity regions, which are not included in the model, resemble low-complexity C-terminal regions of some heterocycle-containing bacteriocin precursors.
Probab=90.39  E-value=0.072  Score=21.47  Aligned_cols=29  Identities=28%  Similarity=0.732  Sum_probs=19.1

Q ss_pred             eecccccccccchhhHHHhHhhhcCCcCceeCChhhH
Q psy12265         20 YGCEVCGRHFRQWGDLKYHKASLHSDVKAFQCEYCGK   56 (71)
Q Consensus        20 ~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~C~~c~~   56 (71)
                      |.|..|+..|.....       ... ..+-.|+.||.
T Consensus         6 y~C~~Cg~~fe~~~~-------~~~-~~~~~CP~Cg~   34 (52)
T TIGR02605         6 YRCTACGHRFEVLQK-------MSD-DPLATCPECGG   34 (52)
T ss_pred             EEeCCCCCEeEEEEe-------cCC-CCCCCCCCCCC
Confidence            789999988874422       121 34457999985


No 82 
>COG5048 FOG: Zn-finger [General function prediction only]
Probab=90.38  E-value=0.057  Score=30.14  Aligned_cols=49  Identities=33%  Similarity=0.593  Sum_probs=39.0

Q ss_pred             ChHHHHHHHh--HhhCC--Cceecc--cccccccchhhHHHhHhhhcCCcCceeCC
Q psy12265          3 KFTYLKVHNR--VHLGL--KPYGCE--VCGRHFRQWGDLKYHKASLHSDVKAFQCE   52 (71)
Q Consensus         3 ~~~~l~~h~~--~~~~~--~~~~c~--~c~~~~~~~~~l~~h~~~~~~~~~~~~C~   52 (71)
                      ....+..|.+  .|.++  +++.|.  .|++.|.....+..|.. .|.+..++.+.
T Consensus       301 ~~~~l~~~~~~~~h~~~~~~~~~~p~~~~~~~~~~~~~~~~~~~-~~~~~~~~~~~  355 (467)
T COG5048         301 RSSPLTRHLRSVNHSGESLKPFSCPYSLCGKLFSRNDALKRHIL-LHTSISPAKEK  355 (467)
T ss_pred             ccccccccccccccccccCCceeeeccCCCccccccccccCCcc-cccCCCccccc
Confidence            3455667777  78889  999999  79999999999999987 67777666553


No 83 
>PF13451 zf-trcl:  Probable zinc-binding domain
Probab=90.09  E-value=0.62  Score=18.90  Aligned_cols=41  Identities=22%  Similarity=0.319  Sum_probs=23.1

Q ss_pred             CCceecccccccccchhhHHHhHhhhcCCcCceeCChhhHh
Q psy12265         17 LKPYGCEVCGRHFRQWGDLKYHKASLHSDVKAFQCEYCGKD   57 (71)
Q Consensus        17 ~~~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~C~~c~~~   57 (71)
                      ++++.|..||..|.-.+.=+..-....-...|-+|+.|-..
T Consensus         2 Dk~l~C~dCg~~FvfTa~EQ~fy~eKgf~n~p~RC~~CR~~   42 (49)
T PF13451_consen    2 DKTLTCKDCGAEFVFTAGEQKFYAEKGFDNEPKRCPSCRQA   42 (49)
T ss_pred             CeeEEcccCCCeEEEehhHHHHHHhcCCcCCCccCHHHHHH
Confidence            46789999998776543322111101112346788888643


No 84 
>COG1996 RPC10 DNA-directed RNA polymerase, subunit RPC10 (contains C4-type Zn-finger) [Transcription]
Probab=89.99  E-value=0.19  Score=20.38  Aligned_cols=29  Identities=31%  Similarity=0.943  Sum_probs=19.3

Q ss_pred             CceecccccccccchhhHHHhHhhhcCCcCceeCChhhHh
Q psy12265         18 KPYGCEVCGRHFRQWGDLKYHKASLHSDVKAFQCEYCGKD   57 (71)
Q Consensus        18 ~~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~C~~c~~~   57 (71)
                      ..|.|..|+..+..           -......+|+.||..
T Consensus         5 ~~Y~C~~Cg~~~~~-----------~~~~~~irCp~Cg~r   33 (49)
T COG1996           5 MEYKCARCGREVEL-----------DQETRGIRCPYCGSR   33 (49)
T ss_pred             EEEEhhhcCCeeeh-----------hhccCceeCCCCCcE
Confidence            45899999988721           112345689999854


No 85 
>KOG2482|consensus
Probab=89.53  E-value=0.14  Score=28.97  Aligned_cols=67  Identities=16%  Similarity=0.317  Sum_probs=41.4

Q ss_pred             HHHHHHHhHhhC-CCceeccccccccc-chhhHHHhHhhhcC---Cc------------------CceeCChhhHhhhch
Q psy12265          5 TYLKVHNRVHLG-LKPYGCEVCGRHFR-QWGDLKYHKASLHS---DV------------------KAFQCEYCGKDFARK   61 (71)
Q Consensus         5 ~~l~~h~~~~~~-~~~~~c~~c~~~~~-~~~~l~~h~~~~~~---~~------------------~~~~C~~c~~~f~~~   61 (71)
                      ..|.++++...+ .....|-.|..-+. ..+.+..|+...|.   |.                  ..+.|.+|.+.|..+
T Consensus       129 eaLeqqQ~Eredt~fslqClFCn~e~lgnRs~~l~Hlf~~H~lniGlpDniVyvnelLehLkekL~r~~CLyCekifrdk  208 (423)
T KOG2482|consen  129 EALEQQQKEREDTIFSLQCLFCNNEGLGNRSEILEHLFHVHGLNIGLPDNIVYVNELLEHLKEKLERLRCLYCEKIFRDK  208 (423)
T ss_pred             HHHHHHHHHhcCCeeeeEEEEecchhcccHHHHHHHHHHHhhhccCCCcceeeHHHHHHHHHHHHhhheeeeeccccCCc
Confidence            345555554422 23467888875433 33555555532221   11                  125899999999999


Q ss_pred             HHHHHhhhcC
Q psy12265         62 YQAHSYHQIR   71 (71)
Q Consensus        62 ~~l~~h~~~~   71 (71)
                      ..|..||+-|
T Consensus       209 ntLkeHMrkK  218 (423)
T KOG2482|consen  209 NTLKEHMRKK  218 (423)
T ss_pred             HHHHHHHHhc
Confidence            9999999754


No 86 
>PRK14890 putative Zn-ribbon RNA-binding protein; Provisional
Probab=88.18  E-value=0.52  Score=19.87  Aligned_cols=32  Identities=19%  Similarity=0.504  Sum_probs=16.9

Q ss_pred             ceecccccccccchhhHHHhHhhhcCCcCceeCChhhH
Q psy12265         19 PYGCEVCGRHFRQWGDLKYHKASLHSDVKAFQCEYCGK   56 (71)
Q Consensus        19 ~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~C~~c~~   56 (71)
                      .|.|+.||........-      -.....+|.|+.||.
T Consensus        25 ~F~CPnCG~~~I~RC~~------CRk~~~~Y~CP~CGF   56 (59)
T PRK14890         25 KFLCPNCGEVIIYRCEK------CRKQSNPYTCPKCGF   56 (59)
T ss_pred             EeeCCCCCCeeEeechh------HHhcCCceECCCCCC
Confidence            47777777542222111      112245788888874


No 87 
>PF05191 ADK_lid:  Adenylate kinase, active site lid;  InterPro: IPR007862 Adenylate kinases (ADK; 2.7.4.3 from EC) are phosphotransferases that catalyse the Mg-dependent reversible conversion of ATP and AMP to two molecules of ADP, an essential reaction for many processes in living cells. In large variants of adenylate kinase, the AMP and ATP substrates are buried in a domain that undergoes conformational changes from an open to a closed state when bound to substrate; the ligand is then contained within a highly specific environment required for catalysis. Adenylate kinase is a 3-domain protein consisting of a large central CORE domain flanked by a LID domain on one side and the AMP-binding NMPbind domain on the other []. The LID domain binds ATP and covers the phosphates at the active site. The substrates first bind the CORE domain, followed by closure of the active site by the LID and NMPbind domains. Comparisons of adenylate kinases have revealed a particular divergence in the active site lid. In some organisms, particularly the Gram-positive bacteria, residues in the lid domain have been mutated to cysteines and these cysteine residues (two CX(n)C motifs) are responsible for the binding of a zinc ion. The bound zinc ion in the lid domain is clearly structurally homologous to Zinc-finger domains. However, it is unclear whether the adenylate kinase lid is a novel zinc-finger DNA/RNA binding domain, or that the lid bound zinc serves a purely structural function [].; GO: 0004017 adenylate kinase activity; PDB: 3BE4_A 2OSB_B 2ORI_A 2EU8_A 3DL0_A 1P3J_A 2QAJ_A 2OO7_A 2P3S_A 3DKV_A ....
Probab=87.89  E-value=0.14  Score=19.28  Aligned_cols=32  Identities=22%  Similarity=0.585  Sum_probs=17.0

Q ss_pred             eecccccccccchhhHHHhHhhhcCCcCceeCChhhHhhhc
Q psy12265         20 YGCEVCGRHFRQWGDLKYHKASLHSDVKAFQCEYCGKDFAR   60 (71)
Q Consensus        20 ~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~C~~c~~~f~~   60 (71)
                      ..|..|+..|-        .. ..+....-.|..||..+.+
T Consensus         2 r~C~~Cg~~Yh--------~~-~~pP~~~~~Cd~cg~~L~q   33 (36)
T PF05191_consen    2 RICPKCGRIYH--------IE-FNPPKVEGVCDNCGGELVQ   33 (36)
T ss_dssp             EEETTTTEEEE--------TT-TB--SSTTBCTTTTEBEBE
T ss_pred             cCcCCCCCccc--------cc-cCCCCCCCccCCCCCeeEe
Confidence            35777777653        22 2333444567777765443


No 88 
>PF02176 zf-TRAF:  TRAF-type zinc finger; PDB: 2EOD_A 2YUC_A 3HCU_A 3HCS_B 3HCT_A.
Probab=87.06  E-value=1.3  Score=18.08  Aligned_cols=44  Identities=20%  Similarity=0.492  Sum_probs=24.3

Q ss_pred             CCCceeccc-ccccccchhhHHHhHhhhcCCcCceeCCh----hhHhhhc
Q psy12265         16 GLKPYGCEV-CGRHFRQWGDLKYHKASLHSDVKAFQCEY----CGKDFAR   60 (71)
Q Consensus        16 ~~~~~~c~~-c~~~~~~~~~l~~h~~~~~~~~~~~~C~~----c~~~f~~   60 (71)
                      ...+..|+. |...-.....|..|.. ..-...+..|++    |+..+..
T Consensus         6 ~~~~v~C~~~cc~~~i~r~~l~~H~~-~~C~~~~v~C~~~~~GC~~~~~~   54 (60)
T PF02176_consen    6 PFRPVPCPNGCCNEMIPRKELDDHLE-NECPKRPVPCPYSPYGCKERVPR   54 (60)
T ss_dssp             TTSEEE-TT--S-BEEECCCHHHHHH-TTSTTSEEE-SS----S--EEEH
T ss_pred             CCCEeeCCCCCcccceeHHHHHHHHH-ccCCCCcEECCCCCCCCCCccch
Confidence            345667776 3333344678889976 344566788998    8776543


No 89 
>PF10571 UPF0547:  Uncharacterised protein family UPF0547;  InterPro: IPR018886  This domain may well be a type of zinc-finger as it carries two pairs of highly conserved cysteine residues though with no accompanying histidines. Several members are annotated as putative helicases. 
Probab=86.89  E-value=0.14  Score=17.85  Aligned_cols=10  Identities=50%  Similarity=1.129  Sum_probs=7.5

Q ss_pred             eCChhhHhhh
Q psy12265         50 QCEYCGKDFA   59 (71)
Q Consensus        50 ~C~~c~~~f~   59 (71)
                      .|+.||..|.
T Consensus        16 ~Cp~CG~~F~   25 (26)
T PF10571_consen   16 FCPHCGYDFE   25 (26)
T ss_pred             cCCCCCCCCc
Confidence            6888887774


No 90 
>PHA00626 hypothetical protein
Probab=86.59  E-value=0.26  Score=20.51  Aligned_cols=17  Identities=18%  Similarity=0.477  Sum_probs=13.3

Q ss_pred             cCceeCChhhHhhhchH
Q psy12265         46 VKAFQCEYCGKDFARKY   62 (71)
Q Consensus        46 ~~~~~C~~c~~~f~~~~   62 (71)
                      ...|.|+.||..|...+
T Consensus        21 snrYkCkdCGY~ft~~~   37 (59)
T PHA00626         21 SDDYVCCDCGYNDSKDA   37 (59)
T ss_pred             CcceEcCCCCCeechhh
Confidence            56799999998877543


No 91 
>PF03604 DNA_RNApol_7kD:  DNA directed RNA polymerase, 7 kDa subunit;  InterPro: IPR006591 DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Each class of RNA polymerase is assembled from 9 to 15 different polypeptides. Rbp10 (RNA polymerase CX) is a domain found in RNA polymerase subunit 10; present in RNA polymerase I, II and III.; GO: 0003677 DNA binding, 0003899 DNA-directed RNA polymerase activity, 0006351 transcription, DNA-dependent; PDB: 2PMZ_Z 3HKZ_X 2NVX_L 3S1Q_L 2JA6_L 3S17_L 3HOW_L 3HOV_L 3PO2_L 3HOZ_L ....
Probab=86.20  E-value=0.59  Score=17.15  Aligned_cols=27  Identities=26%  Similarity=0.698  Sum_probs=15.0

Q ss_pred             eecccccccccchhhHHHhHhhhcCCcCceeCChhhHhh
Q psy12265         20 YGCEVCGRHFRQWGDLKYHKASLHSDVKAFQCEYCGKDF   58 (71)
Q Consensus        20 ~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~C~~c~~~f   58 (71)
                      |.|..|+..+..           . ...+.+|+.||...
T Consensus         1 Y~C~~Cg~~~~~-----------~-~~~~irC~~CG~RI   27 (32)
T PF03604_consen    1 YICGECGAEVEL-----------K-PGDPIRCPECGHRI   27 (32)
T ss_dssp             EBESSSSSSE-B-----------S-TSSTSSBSSSS-SE
T ss_pred             CCCCcCCCeeEc-----------C-CCCcEECCcCCCeE
Confidence            567777765431           1 12356888888643


No 92 
>PF10013 DUF2256:  Uncharacterized protein conserved in bacteria (DUF2256);  InterPro: IPR017136 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function.
Probab=85.55  E-value=0.33  Score=19.01  Aligned_cols=16  Identities=25%  Similarity=0.663  Sum_probs=11.9

Q ss_pred             eCChhhHhhhchHHHH
Q psy12265         50 QCEYCGKDFARKYQAH   65 (71)
Q Consensus        50 ~C~~c~~~f~~~~~l~   65 (71)
                      .|+.|++.|..+..++
T Consensus        10 ~C~~C~rpf~WRKKW~   25 (42)
T PF10013_consen   10 ICPVCGRPFTWRKKWA   25 (42)
T ss_pred             cCcccCCcchHHHHHH
Confidence            5888888888766554


No 93 
>smart00614 ZnF_BED BED zinc finger. DNA-binding domain in chromatin-boundary-element-binding proteins and transposases
Probab=85.23  E-value=1.2  Score=17.82  Aligned_cols=22  Identities=23%  Similarity=0.600  Sum_probs=16.1

Q ss_pred             ceecccccccccch-----hhHHHhHh
Q psy12265         19 PYGCEVCGRHFRQW-----GDLKYHKA   40 (71)
Q Consensus        19 ~~~c~~c~~~~~~~-----~~l~~h~~   40 (71)
                      --.|..|++.++..     +.|.+|+.
T Consensus        18 ~a~C~~C~~~l~~~~~~gTs~L~rHl~   44 (50)
T smart00614       18 RAKCKYCGKKLSRSSKGGTSNLRRHLR   44 (50)
T ss_pred             EEEecCCCCEeeeCCCCCcHHHHHHHH
Confidence            36788899877554     57888875


No 94 
>PRK03824 hypA hydrogenase nickel incorporation protein; Provisional
Probab=84.99  E-value=0.36  Score=23.67  Aligned_cols=15  Identities=20%  Similarity=0.523  Sum_probs=11.6

Q ss_pred             Cceecccccccccch
Q psy12265         18 KPYGCEVCGRHFRQW   32 (71)
Q Consensus        18 ~~~~c~~c~~~~~~~   32 (71)
                      ..+.|..|+..|...
T Consensus        69 ~~~~C~~CG~~~~~~   83 (135)
T PRK03824         69 AVLKCRNCGNEWSLK   83 (135)
T ss_pred             eEEECCCCCCEEecc
Confidence            348999999887654


No 95 
>PF04780 DUF629:  Protein of unknown function (DUF629);  InterPro: IPR006865 This domain represents a region of several plant proteins of unknown function. A C2H2 zinc finger is predicted in this region in some family members, but the spacing between the cysteine residues is not conserved throughout the family.
Probab=84.67  E-value=0.91  Score=26.91  Aligned_cols=29  Identities=17%  Similarity=0.298  Sum_probs=24.7

Q ss_pred             CceecccccccccchhhHHHhHhhhcCCc
Q psy12265         18 KPYGCEVCGRHFRQWGDLKYHKASLHSDV   46 (71)
Q Consensus        18 ~~~~c~~c~~~~~~~~~l~~h~~~~~~~~   46 (71)
                      +-|.|+.|.+.|.....+..|+...|.+.
T Consensus        56 rFWiCp~CskkF~d~~~~~~H~~~eH~~~   84 (466)
T PF04780_consen   56 RFWICPRCSKKFSDAESCLSHMEQEHPAG   84 (466)
T ss_pred             eEeeCCcccceeCCHHHHHHHHHHhhhhh
Confidence            34899999999999999999998667654


No 96 
>smart00834 CxxC_CXXC_SSSS Putative regulatory protein. CxxC_CXXC_SSSS represents a region of about 41 amino acids found in a number of small proteins in a wide range of bacteria. The region usually begins with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One protein in this entry has been noted as a putative regulatory protein, designated FmdB. Most proteins in this entry have a C-terminal region containing highly degenerate sequence.
Probab=84.20  E-value=0.24  Score=18.70  Aligned_cols=11  Identities=45%  Similarity=1.349  Sum_probs=7.9

Q ss_pred             eeCChhhHhhh
Q psy12265         49 FQCEYCGKDFA   59 (71)
Q Consensus        49 ~~C~~c~~~f~   59 (71)
                      |+|..||..|.
T Consensus         6 y~C~~Cg~~fe   16 (41)
T smart00834        6 YRCEDCGHTFE   16 (41)
T ss_pred             EEcCCCCCEEE
Confidence            67888877664


No 97 
>PF04959 ARS2:  Arsenite-resistance protein 2;  InterPro: IPR007042 This entry represents Arsenite-resistance protein 2 (also known as Serrate RNA effector molecule homolog) which is thought to play a role in arsenite resistance [], although does not directly confer arsenite resistance but rather modulates arsenic sensitivity []. Arsenite is a carcinogenic compound which can act as a comutagen by inhibiting DNA repair. It is also involved in cell cycle progression at S phase. ; PDB: 3AX1_A.
Probab=83.97  E-value=0.93  Score=24.10  Aligned_cols=29  Identities=21%  Similarity=0.456  Sum_probs=21.6

Q ss_pred             CCCceecccccccccchhhHHHhHhhhcC
Q psy12265         16 GLKPYGCEVCGRHFRQWGDLKYHKASLHS   44 (71)
Q Consensus        16 ~~~~~~c~~c~~~~~~~~~l~~h~~~~~~   44 (71)
                      .+..|.|..|++.|.-...+..|+..-|.
T Consensus        74 ~~~K~~C~lc~KlFkg~eFV~KHI~nKH~  102 (214)
T PF04959_consen   74 DEDKWRCPLCGKLFKGPEFVRKHIFNKHP  102 (214)
T ss_dssp             SSEEEEE-SSS-EESSHHHHHHHHHHH-H
T ss_pred             cCCEECCCCCCcccCChHHHHHHHhhcCH
Confidence            34569999999999999999999875453


No 98 
>PF12907 zf-met2:  Zinc-binding
Probab=83.90  E-value=0.28  Score=19.01  Aligned_cols=27  Identities=30%  Similarity=0.491  Sum_probs=15.6

Q ss_pred             eecccccccccch---hhHHHhHhhhcCCc
Q psy12265         20 YGCEVCGRHFRQW---GDLKYHKASLHSDV   46 (71)
Q Consensus        20 ~~c~~c~~~~~~~---~~l~~h~~~~~~~~   46 (71)
                      +.|.+|...|...   ..|..|-..-|+..
T Consensus         2 i~C~iC~qtF~~t~~~~~L~eH~enKHpK~   31 (40)
T PF12907_consen    2 IICKICRQTFMQTTNEPQLKEHAENKHPKN   31 (40)
T ss_pred             cCcHHhhHHHHhcCCHHHHHHHHHccCCCC
Confidence            4677787555433   44777765445443


No 99 
>PF07282 OrfB_Zn_ribbon:  Putative transposase DNA-binding domain;  InterPro: IPR010095 This entry represents a region of a sequence similarity between a family of putative transposases of Thermoanaerobacter tengcongensis, smaller related proteins from Bacillus anthracis, putative transposes described by IPR001959 from INTERPRO, and other proteins. More information about these proteins can be found at Protein of the Month: Transposase [].
Probab=83.84  E-value=0.99  Score=19.17  Aligned_cols=24  Identities=25%  Similarity=0.529  Sum_probs=15.8

Q ss_pred             CcCceeCChhhHhhhchHHHHHhh
Q psy12265         45 DVKAFQCEYCGKDFARKYQAHSYH   68 (71)
Q Consensus        45 ~~~~~~C~~c~~~f~~~~~l~~h~   68 (71)
                      ....|.|+.||........-...+
T Consensus        43 ~~r~~~C~~Cg~~~~rD~naA~NI   66 (69)
T PF07282_consen   43 SGRVFTCPNCGFEMDRDVNAARNI   66 (69)
T ss_pred             ccceEEcCCCCCEECcHHHHHHHH
Confidence            345789999998766554444443


No 100
>PF09963 DUF2197:  Uncharacterized protein conserved in bacteria (DUF2197);  InterPro: IPR019241  This family represents various hypothetical bacterial proteins with no known function. 
Probab=83.39  E-value=1.9  Score=18.05  Aligned_cols=42  Identities=10%  Similarity=0.320  Sum_probs=22.9

Q ss_pred             eecccccccccchh-hHHHhHhhhcCCcCceeCChhhHhhhchH
Q psy12265         20 YGCEVCGRHFRQWG-DLKYHKASLHSDVKAFQCEYCGKDFARKY   62 (71)
Q Consensus        20 ~~c~~c~~~~~~~~-~l~~h~~~~~~~~~~~~C~~c~~~f~~~~   62 (71)
                      ..|..|++.+.-.. .+..-.. ..-.-..|-|..|......+.
T Consensus         3 vkC~lCdk~~~Id~~~~~aKrL-rnrPi~tYmC~eC~~RI~~~t   45 (56)
T PF09963_consen    3 VKCILCDKKEEIDEDTPEAKRL-RNRPIHTYMCDECKERIREET   45 (56)
T ss_pred             eEEEecCCEEEeccCCHHHHHh-hcCCCcceeChhHHHHHhHHH
Confidence            36778887654332 2222212 233455689999977655443


No 101
>COG1675 TFA1 Transcription initiation factor IIE, alpha subunit [Transcription]
Probab=83.34  E-value=1.9  Score=22.26  Aligned_cols=34  Identities=24%  Similarity=0.515  Sum_probs=22.4

Q ss_pred             hhCCCceecccccccccchhhHHHhHhhhcCCcCceeCChhhHh
Q psy12265         14 HLGLKPYGCEVCGRHFRQWGDLKYHKASLHSDVKAFQCEYCGKD   57 (71)
Q Consensus        14 ~~~~~~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~C~~c~~~   57 (71)
                      ..+..-|.|+.|...++...+.       ..   -|.|+.||..
T Consensus       108 ~~~~~~y~C~~~~~r~sfdeA~-------~~---~F~Cp~Cg~~  141 (176)
T COG1675         108 ETENNYYVCPNCHVKYSFDEAM-------EL---GFTCPKCGED  141 (176)
T ss_pred             hccCCceeCCCCCCcccHHHHH-------Hh---CCCCCCCCch
Confidence            3455669998887776654432       22   2899999864


No 102
>COG3364 Zn-ribbon containing protein [General function prediction only]
Probab=83.01  E-value=0.92  Score=21.31  Aligned_cols=15  Identities=33%  Similarity=0.722  Sum_probs=12.0

Q ss_pred             Cceecccccccccch
Q psy12265         18 KPYGCEVCGRHFRQW   32 (71)
Q Consensus        18 ~~~~c~~c~~~~~~~   32 (71)
                      .|+.|.-||..|..-
T Consensus         1 MpH~CtrCG~vf~~g   15 (112)
T COG3364           1 MPHQCTRCGEVFDDG   15 (112)
T ss_pred             CCceecccccccccc
Confidence            478899999988764


No 103
>PLN02748 tRNA dimethylallyltransferase
Probab=82.96  E-value=0.57  Score=27.69  Aligned_cols=25  Identities=24%  Similarity=0.404  Sum_probs=20.6

Q ss_pred             CceeCChhhH-hhhchHHHHHhhhcC
Q psy12265         47 KAFQCEYCGK-DFARKYQAHSYHQIR   71 (71)
Q Consensus        47 ~~~~C~~c~~-~f~~~~~l~~h~~~~   71 (71)
                      +.|.|..|+. .+.....++.|++.|
T Consensus       417 ~~~~Ce~C~~~~~~G~~eW~~Hlksr  442 (468)
T PLN02748        417 TQYVCEACGNKVLRGAHEWEQHKQGR  442 (468)
T ss_pred             ccccccCCCCcccCCHHHHHHHhcch
Confidence            4578999997 799999999998754


No 104
>PF07975 C1_4:  TFIIH C1-like domain;  InterPro: IPR004595 All proteins in this domain for which functions are known are components of the TFIIH complex which is involved in the initiation of transcription and nucleotide excision repair. It includes the yeast transcription factor Ssl1 (Suppressor of stem-loop protein 1) that is essential for translation initiation and affects UV resistance. The C-terminal region is essential for transcription activity. This regions binds three zinc atoms through two independent domain. The first contains a C4 zinc finger motif, whereas the second is characterised by a CX(2)CX(2-4)FCADCD motif. The solution structure of the second C-terminal domain revealed homology with the regulatory domain of protein kinase C [].; GO: 0006281 DNA repair, 0005634 nucleus; PDB: 1Z60_A.
Probab=82.91  E-value=0.55  Score=19.19  Aligned_cols=21  Identities=14%  Similarity=0.460  Sum_probs=7.2

Q ss_pred             ceeCChhhHhhhchHHHHHhh
Q psy12265         48 AFQCEYCGKDFARKYQAHSYH   68 (71)
Q Consensus        48 ~~~C~~c~~~f~~~~~l~~h~   68 (71)
                      .|+|+.|...|-..-++-.|.
T Consensus        21 ~y~C~~C~~~FC~dCD~fiHE   41 (51)
T PF07975_consen   21 RYRCPKCKNHFCIDCDVFIHE   41 (51)
T ss_dssp             EE--TTTT--B-HHHHHTTTT
T ss_pred             eEECCCCCCccccCcChhhhc
Confidence            455555555444444444443


No 105
>COG4530 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=82.45  E-value=0.72  Score=21.96  Aligned_cols=13  Identities=23%  Similarity=0.588  Sum_probs=7.5

Q ss_pred             CceeCChhhHhhh
Q psy12265         47 KAFQCEYCGKDFA   59 (71)
Q Consensus        47 ~~~~C~~c~~~f~   59 (71)
                      .|..|++||++|+
T Consensus        25 dPiVsPytG~s~P   37 (129)
T COG4530          25 DPIVSPYTGKSYP   37 (129)
T ss_pred             CccccCcccccch
Confidence            3555666666654


No 106
>COG3091 SprT Zn-dependent metalloprotease, SprT family [General function prediction only]
Probab=82.22  E-value=0.61  Score=23.46  Aligned_cols=35  Identities=26%  Similarity=0.786  Sum_probs=21.9

Q ss_pred             CCceecccccccccchhhHHHhHhhhcCCcCceeCChhhHh
Q psy12265         17 LKPYGCEVCGRHFRQWGDLKYHKASLHSDVKAFQCEYCGKD   57 (71)
Q Consensus        17 ~~~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~C~~c~~~   57 (71)
                      .-+|.|. |+..|...-   +|-. .-.|+ .|.|..|+-.
T Consensus       115 ~~~Y~C~-C~q~~l~~R---Rhn~-~~~g~-~YrC~~C~gk  149 (156)
T COG3091         115 TYPYRCQ-CQQHYLRIR---RHNT-VRRGE-VYRCGKCGGK  149 (156)
T ss_pred             ceeEEee-cCCccchhh---hccc-ccccc-eEEeccCCce
Confidence            3469999 998765432   2221 23345 8999999753


No 107
>COG4338 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=81.68  E-value=0.56  Score=18.93  Aligned_cols=16  Identities=19%  Similarity=0.515  Sum_probs=11.9

Q ss_pred             eCChhhHhhhchHHHH
Q psy12265         50 QCEYCGKDFARKYQAH   65 (71)
Q Consensus        50 ~C~~c~~~f~~~~~l~   65 (71)
                      .|+.|++.|+.+..++
T Consensus        14 ICpvCqRPFsWRkKW~   29 (54)
T COG4338          14 ICPVCQRPFSWRKKWA   29 (54)
T ss_pred             hhhhhcCchHHHHHHH
Confidence            5888888888766554


No 108
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only]
Probab=81.56  E-value=1.7  Score=25.00  Aligned_cols=47  Identities=17%  Similarity=0.215  Sum_probs=25.7

Q ss_pred             ecccccccccchhhHHHhHhhhcCCcCceeCChh----hHhhhchHHHHHhhh
Q psy12265         21 GCEVCGRHFRQWGDLKYHKASLHSDVKAFQCEYC----GKDFARKYQAHSYHQ   69 (71)
Q Consensus        21 ~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~C~~c----~~~f~~~~~l~~h~~   69 (71)
                      .|..|...|-....|..|++..|  ++-+.|..-    ...|..-.+|..|.+
T Consensus       222 ~C~FC~~~FYdDDEL~~HcR~~H--E~ChICD~v~p~~~QYFK~Y~~Le~HF~  272 (493)
T COG5236         222 LCIFCKIYFYDDDELRRHCRLRH--EACHICDMVGPIRYQYFKSYEDLEAHFR  272 (493)
T ss_pred             hhhhccceecChHHHHHHHHhhh--hhhhhhhccCccchhhhhCHHHHHHHhh
Confidence            56777777777777777776222  322333221    234566666666643


No 109
>KOG2231|consensus
Probab=81.35  E-value=5  Score=25.16  Aligned_cols=19  Identities=16%  Similarity=0.483  Sum_probs=10.2

Q ss_pred             CChhhHhhhchHHHHHhhh
Q psy12265         51 CEYCGKDFARKYQAHSYHQ   69 (71)
Q Consensus        51 C~~c~~~f~~~~~l~~h~~   69 (71)
                      |..|...|-....|..|++
T Consensus       185 C~~C~~~fld~~el~rH~~  203 (669)
T KOG2231|consen  185 CKFCHERFLDDDELYRHLR  203 (669)
T ss_pred             chhhhhhhccHHHHHHhhc
Confidence            4555555555555555544


No 110
>smart00154 ZnF_AN1 AN1-like Zinc finger. Zinc finger at the C-terminus of An1, a ubiquitin-like protein in Xenopus laevis.
Probab=79.84  E-value=0.62  Score=17.82  Aligned_cols=12  Identities=42%  Similarity=1.140  Sum_probs=9.3

Q ss_pred             ceeCChhhHhhh
Q psy12265         48 AFQCEYCGKDFA   59 (71)
Q Consensus        48 ~~~C~~c~~~f~   59 (71)
                      ||.|..|+..|-
T Consensus        12 ~f~C~~C~~~FC   23 (39)
T smart00154       12 GFKCRHCGNLFC   23 (39)
T ss_pred             CeECCccCCccc
Confidence            788888887764


No 111
>COG3357 Predicted transcriptional regulator containing an HTH domain fused to a Zn-ribbon [Transcription]
Probab=78.96  E-value=1.5  Score=20.23  Aligned_cols=28  Identities=32%  Similarity=0.745  Sum_probs=17.4

Q ss_pred             CceecccccccccchhhHHHhHhhhcCCcCceeCChhhH
Q psy12265         18 KPYGCEVCGRHFRQWGDLKYHKASLHSDVKAFQCEYCGK   56 (71)
Q Consensus        18 ~~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~C~~c~~   56 (71)
                      .|-.|..||..|..           -...+|-+|+.|..
T Consensus        57 ~Pa~CkkCGfef~~-----------~~ik~pSRCP~CKS   84 (97)
T COG3357          57 RPARCKKCGFEFRD-----------DKIKKPSRCPKCKS   84 (97)
T ss_pred             cChhhcccCccccc-----------cccCCcccCCcchh
Confidence            56788888876643           11234667887754


No 112
>KOG0717|consensus
Probab=78.91  E-value=0.75  Score=27.25  Aligned_cols=22  Identities=23%  Similarity=0.455  Sum_probs=17.7

Q ss_pred             eeCChhhHhhhchHHHHHhhhc
Q psy12265         49 FQCEYCGKDFARKYQAHSYHQI   70 (71)
Q Consensus        49 ~~C~~c~~~f~~~~~l~~h~~~   70 (71)
                      +-|.+|.++|.+.-.|..|...
T Consensus       293 lyC~vCnKsFKseKq~kNHEnS  314 (508)
T KOG0717|consen  293 LYCVVCNKSFKSEKQLKNHENS  314 (508)
T ss_pred             eEEeeccccccchHHHHhhHHH
Confidence            5688888888888888888654


No 113
>TIGR00100 hypA hydrogenase nickel insertion protein HypA. In Hpylori, hypA mutant abolished hydrogenase activity and decrease in urease activity. Nickel supplementation in media restored urease activity and partial hydrogenase activity. HypA probably involved in inserting Ni in enzymes.
Probab=78.57  E-value=1.1  Score=21.42  Aligned_cols=24  Identities=21%  Similarity=0.533  Sum_probs=15.8

Q ss_pred             eecccccccccchhhHHHhHhhhcCCcCceeCChhhH
Q psy12265         20 YGCEVCGRHFRQWGDLKYHKASLHSDVKAFQCEYCGK   56 (71)
Q Consensus        20 ~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~C~~c~~   56 (71)
                      ..|..|+..|....             ..+.||.||.
T Consensus        71 ~~C~~Cg~~~~~~~-------------~~~~CP~Cgs   94 (115)
T TIGR00100        71 CECEDCSEEVSPEI-------------DLYRCPKCHG   94 (115)
T ss_pred             EEcccCCCEEecCC-------------cCccCcCCcC
Confidence            78888886665321             1357888874


No 114
>PF04423 Rad50_zn_hook:  Rad50 zinc hook motif;  InterPro: IPR007517 The Mre11 complex (Mre11 Rad50 Nbs1) is central to chromosomal maintenance and functions in homologous recombination, telomere maintenance and sister chromatid association. The Rad50 coiled-coil region contains a dimer interface at the apex of the coiled coils in which pairs of conserved Cys-X-X-Cys motifs form interlocking hooks that bind one Zn ion. This alignment includes the zinc hook motif and a short stretch of coiled-coil on either side.; GO: 0004518 nuclease activity, 0005524 ATP binding, 0008270 zinc ion binding, 0006281 DNA repair; PDB: 1L8D_B.
Probab=77.01  E-value=0.71  Score=18.79  Aligned_cols=12  Identities=25%  Similarity=0.888  Sum_probs=6.1

Q ss_pred             eCChhhHhhhch
Q psy12265         50 QCEYCGKDFARK   61 (71)
Q Consensus        50 ~C~~c~~~f~~~   61 (71)
                      .||.|++.|...
T Consensus        22 ~CPlC~r~l~~e   33 (54)
T PF04423_consen   22 CCPLCGRPLDEE   33 (54)
T ss_dssp             E-TTT--EE-HH
T ss_pred             cCCCCCCCCCHH
Confidence            799999877644


No 115
>PF01428 zf-AN1:  AN1-like Zinc finger;  InterPro: IPR000058 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents the AN1-type zinc finger domain, which has a dimetal (zinc)-bound alpha/beta fold. This domain was first identified as a zinc finger at the C terminus of AN1 Q91889 from SWISSPROT, a ubiquitin-like protein in Xenopus laevis []. The AN1-type zinc finger contains six conserved cysteines and two histidines that could potentially coordinate 2 zinc atoms. Certain stress-associated proteins (SAP) contain AN1 domain, often in combination with A20 zinc finger domains (SAP8) or C2H2 domains (SAP16) []. For example, the human protein Znf216 has an A20 zinc-finger at the N terminus and an AN1 zinc-finger at the C terminus, acting to negatively regulate the NFkappaB activation pathway and to interact with components of the immune response like RIP, IKKgamma and TRAF6. The interact of Znf216 with IKK-gamma and RIP is mediated by the A20 zinc-finger domain, while its interaction with TRAF6 is mediated by the AN1 zinc-finger domain; therefore, both zinc-finger domains are involved in regulating the immune response []. The AN1 zinc finger domain is also found in proteins containing a ubiquitin-like domain, which are involved in the ubiquitination pathway []. Proteins containing an AN1-type zinc finger include:   Ascidian posterior end mark 6 (pem-6) protein []. Human AWP1 protein (associated with PRK1), which is expressed during early embryogenesis []. Human immunoglobulin mu binding protein 2 (SMUBP-2), mutations in which cause muscular atrophy with respiratory distress type 1 [].   More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 1WFP_A 1WYS_A 1WG2_A 1WFH_A 1X4W_A 1WFE_A 1WFL_A 1X4V_A.
Probab=76.89  E-value=0.6  Score=18.13  Aligned_cols=13  Identities=46%  Similarity=1.191  Sum_probs=7.6

Q ss_pred             CceeCChhhHhhh
Q psy12265         47 KAFQCEYCGKDFA   59 (71)
Q Consensus        47 ~~~~C~~c~~~f~   59 (71)
                      .|+.|..|+..|-
T Consensus        12 ~~~~C~~C~~~FC   24 (43)
T PF01428_consen   12 LPFKCKHCGKSFC   24 (43)
T ss_dssp             SHEE-TTTS-EE-
T ss_pred             CCeECCCCCcccC
Confidence            5788888887764


No 116
>KOG2231|consensus
Probab=75.41  E-value=2.5  Score=26.31  Aligned_cols=45  Identities=16%  Similarity=0.296  Sum_probs=30.7

Q ss_pred             eecccccccccchhhHHHhHhhhcCCcCceeCChh------hHhhhchHHHHHhhh
Q psy12265         20 YGCEVCGRHFRQWGDLKYHKASLHSDVKAFQCEYC------GKDFARKYQAHSYHQ   69 (71)
Q Consensus        20 ~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~C~~c------~~~f~~~~~l~~h~~   69 (71)
                      -.|..|...|.....+.+|++. +    -|.|..|      +..|....+|+.|-+
T Consensus       183 p~C~~C~~~fld~~el~rH~~~-~----h~~chfC~~~~~~neyy~~~~dLe~HfR  233 (669)
T KOG2231|consen  183 PLCKFCHERFLDDDELYRHLRF-D----HEFCHFCDYKTGQNEYYNDYDDLEEHFR  233 (669)
T ss_pred             ccchhhhhhhccHHHHHHhhcc-c----eeheeecCcccccchhcccchHHHHHhh
Confidence            4677788888888888887762 2    2334444      456788888888865


No 117
>COG2331 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=74.86  E-value=2.7  Score=18.73  Aligned_cols=32  Identities=31%  Similarity=0.710  Sum_probs=19.9

Q ss_pred             eecccccccccchhhHHHhHhhhcCCcCceeCChhhHhhh
Q psy12265         20 YGCEVCGRHFRQWGDLKYHKASLHSDVKAFQCEYCGKDFA   59 (71)
Q Consensus        20 ~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~C~~c~~~f~   59 (71)
                      |.|..|+..|.    +.+++.    ....-.|+.|+..+.
T Consensus        13 Y~c~~cg~~~d----vvq~~~----ddplt~ce~c~a~~k   44 (82)
T COG2331          13 YECTECGNRFD----VVQAMT----DDPLTTCEECGARLK   44 (82)
T ss_pred             EeecccchHHH----HHHhcc----cCccccChhhChHHH
Confidence            89999987754    333332    333346888886544


No 118
>KOG4173|consensus
Probab=74.69  E-value=2.5  Score=22.58  Aligned_cols=19  Identities=32%  Similarity=0.516  Sum_probs=8.8

Q ss_pred             ecccccccccchhhHHHhH
Q psy12265         21 GCEVCGRHFRQWGDLKYHK   39 (71)
Q Consensus        21 ~c~~c~~~~~~~~~l~~h~   39 (71)
                      .|..|.+.|.+.--|..|+
T Consensus       108 sCs~C~r~~Pt~hLLd~HI  126 (253)
T KOG4173|consen  108 SCSFCKRAFPTGHLLDAHI  126 (253)
T ss_pred             hhHHHHHhCCchhhhhHHH
Confidence            4455555554444444443


No 119
>PF12013 DUF3505:  Protein of unknown function (DUF3505);  InterPro: IPR022698  This family of proteins is functionally uncharacterised. This protein is found in eukaryotes. Proteins in this family are typically between 247 to 1018 amino acids in length. This region contains two segments that are likely to be C2H2 zinc binding domains. 
Probab=74.60  E-value=3.9  Score=19.11  Aligned_cols=22  Identities=27%  Similarity=0.507  Sum_probs=15.6

Q ss_pred             eec----ccccccccchhhHHHhHhh
Q psy12265         20 YGC----EVCGRHFRQWGDLKYHKAS   41 (71)
Q Consensus        20 ~~c----~~c~~~~~~~~~l~~h~~~   41 (71)
                      |.|    ..|+....+...+..|.+.
T Consensus        81 ~~C~~~~~~C~y~~~~~~~m~~H~~~  106 (109)
T PF12013_consen   81 YRCQCDPPHCGYITRSKKTMRKHWRK  106 (109)
T ss_pred             eeeecCCCCCCcEeccHHHHHHHHHH
Confidence            677    7777777777777777653


No 120
>PRK12380 hydrogenase nickel incorporation protein HybF; Provisional
Probab=74.12  E-value=1.8  Score=20.61  Aligned_cols=24  Identities=21%  Similarity=0.339  Sum_probs=15.3

Q ss_pred             eecccccccccchhhHHHhHhhhcCCcCceeCChhhH
Q psy12265         20 YGCEVCGRHFRQWGDLKYHKASLHSDVKAFQCEYCGK   56 (71)
Q Consensus        20 ~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~C~~c~~   56 (71)
                      ..|..|+..|...             ...+.||.||.
T Consensus        71 ~~C~~Cg~~~~~~-------------~~~~~CP~Cgs   94 (113)
T PRK12380         71 AWCWDCSQVVEIH-------------QHDAQCPHCHG   94 (113)
T ss_pred             EEcccCCCEEecC-------------CcCccCcCCCC
Confidence            7888888655422             12346888874


No 121
>PLN02294 cytochrome c oxidase subunit Vb
Probab=73.96  E-value=0.98  Score=23.18  Aligned_cols=16  Identities=31%  Similarity=0.723  Sum_probs=12.4

Q ss_pred             cCceeCChhhHhhhch
Q psy12265         46 VKAFQCEYCGKDFARK   61 (71)
Q Consensus        46 ~~~~~C~~c~~~f~~~   61 (71)
                      .+|.+|+.||..|.-+
T Consensus       139 Gkp~RCpeCG~~fkL~  154 (174)
T PLN02294        139 GKSFECPVCTQYFELE  154 (174)
T ss_pred             CCceeCCCCCCEEEEE
Confidence            3688999999887643


No 122
>KOG2785|consensus
Probab=73.79  E-value=4.7  Score=23.46  Aligned_cols=54  Identities=19%  Similarity=0.354  Sum_probs=39.2

Q ss_pred             CCceecccccccccchhhHHHhHhhhcCCc----------------------CceeCChhh---HhhhchHHHHHhhhc
Q psy12265         17 LKPYGCEVCGRHFRQWGDLKYHKASLHSDV----------------------KAFQCEYCG---KDFARKYQAHSYHQI   70 (71)
Q Consensus        17 ~~~~~c~~c~~~~~~~~~l~~h~~~~~~~~----------------------~~~~C~~c~---~~f~~~~~l~~h~~~   70 (71)
                      ..|-.|-.|++.+.+-..-..||...|.--                      .-+.|..|.   +.|..-...+.||..
T Consensus       164 ~~Pt~CLfC~~~~k~~e~~~~HM~~~HgffIPdreYL~D~~GLl~YLgeKV~~~~~CL~CN~~~~~f~sleavr~HM~~  242 (390)
T KOG2785|consen  164 LIPTDCLFCDKKSKSLEENLKHMFKEHGFFIPDREYLTDEKGLLKYLGEKVGIGFICLFCNELGRPFSSLEAVRAHMRD  242 (390)
T ss_pred             cCCcceeecCCCcccHHHHHHHHhhccCCcCCchHhhhchhHHHHHHHHHhccCceEEEeccccCcccccHHHHHHHhh
Confidence            356678889988888777778886444211                      125788888   889999899999864


No 123
>KOG1842|consensus
Probab=73.37  E-value=2.6  Score=25.07  Aligned_cols=23  Identities=17%  Similarity=0.332  Sum_probs=19.7

Q ss_pred             CceeCChhhHhhhchHHHHHhhh
Q psy12265         47 KAFQCEYCGKDFARKYQAHSYHQ   69 (71)
Q Consensus        47 ~~~~C~~c~~~f~~~~~l~~h~~   69 (71)
                      .-|.|+.|...|.+-..|.-|..
T Consensus        14 egflCPiC~~dl~~~~~L~~H~d   36 (505)
T KOG1842|consen   14 EGFLCPICLLDLPNLSALNDHLD   36 (505)
T ss_pred             hcccCchHhhhhhhHHHHHHHHh
Confidence            45899999999999999988853


No 124
>KOG3507|consensus
Probab=73.32  E-value=3.8  Score=17.30  Aligned_cols=32  Identities=25%  Similarity=0.497  Sum_probs=20.5

Q ss_pred             CceecccccccccchhhHHHhHhhhcCCcCceeCChhhHhhhch
Q psy12265         18 KPYGCEVCGRHFRQWGDLKYHKASLHSDVKAFQCEYCGKDFARK   61 (71)
Q Consensus        18 ~~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~C~~c~~~f~~~   61 (71)
                      ..|.|..|+.--.            -...-+++|..||.....+
T Consensus        19 miYiCgdC~~en~------------lk~~D~irCReCG~RIlyK   50 (62)
T KOG3507|consen   19 MIYICGDCGQENT------------LKRGDVIRCRECGYRILYK   50 (62)
T ss_pred             EEEEecccccccc------------ccCCCcEehhhcchHHHHH
Confidence            3489999974311            1123478999999876544


No 125
>COG3677 Transposase and inactivated derivatives [DNA replication, recombination, and repair]
Probab=73.30  E-value=0.9  Score=22.17  Aligned_cols=36  Identities=17%  Similarity=0.464  Sum_probs=21.3

Q ss_pred             eecccccccccchhhHHHhHhhhcCCcCceeCChhhHhhhch
Q psy12265         20 YGCEVCGRHFRQWGDLKYHKASLHSDVKAFQCEYCGKDFARK   61 (71)
Q Consensus        20 ~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~C~~c~~~f~~~   61 (71)
                      -.|+.|+......     .-. .-.+...|.|..|+++|...
T Consensus        31 ~~cP~C~s~~~~k-----~g~-~~~~~qRyrC~~C~~tf~~~   66 (129)
T COG3677          31 VNCPRCKSSNVVK-----IGG-IRRGHQRYKCKSCGSTFTVE   66 (129)
T ss_pred             CcCCCCCccceee-----ECC-ccccccccccCCcCcceeee
Confidence            5677776443111     101 12235679999999988754


No 126
>PF14353 CpXC:  CpXC protein
Probab=73.21  E-value=0.35  Score=23.22  Aligned_cols=18  Identities=33%  Similarity=0.831  Sum_probs=12.9

Q ss_pred             CceeCChhhHhhhchHHH
Q psy12265         47 KAFQCEYCGKDFARKYQA   64 (71)
Q Consensus        47 ~~~~C~~c~~~f~~~~~l   64 (71)
                      -.+.|+.||..|.-...+
T Consensus        37 ~~~~CP~Cg~~~~~~~p~   54 (128)
T PF14353_consen   37 FSFTCPSCGHKFRLEYPL   54 (128)
T ss_pred             CEEECCCCCCceecCCCE
Confidence            458999999887654443


No 127
>COG1326 Uncharacterized archaeal Zn-finger protein [General function prediction only]
Probab=72.54  E-value=5  Score=21.19  Aligned_cols=36  Identities=19%  Similarity=0.365  Sum_probs=20.5

Q ss_pred             ceecccccccccchhhHHHhHhhhcCCcCceeCChhhHhhh
Q psy12265         19 PYGCEVCGRHFRQWGDLKYHKASLHSDVKAFQCEYCGKDFA   59 (71)
Q Consensus        19 ~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~C~~c~~~f~   59 (71)
                      -+.|+.|+ .-.....+.   + ....+..++|..||..+.
T Consensus         6 y~~Cp~Cg-~eev~hEVi---k-~~g~~~lvrC~eCG~V~~   41 (201)
T COG1326           6 YIECPSCG-SEEVSHEVI---K-ERGREPLVRCEECGTVHP   41 (201)
T ss_pred             EEECCCCC-cchhhHHHH---H-hcCCceEEEccCCCcEee
Confidence            46899998 211111111   1 234456789999997663


No 128
>PF08790 zf-LYAR:  LYAR-type C2HC zinc finger ;  InterPro: IPR014898 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This C2HC zinc finger domain is found in LYAR proteins such as Q08288 from SWISSPROT, which are involved in cell growth regulation.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 1WJV_A.
Probab=72.21  E-value=1.3  Score=15.81  Aligned_cols=18  Identities=28%  Similarity=0.741  Sum_probs=10.2

Q ss_pred             eecccccccccchhhHHHh
Q psy12265         20 YGCEVCGRHFRQWGDLKYH   38 (71)
Q Consensus        20 ~~c~~c~~~~~~~~~l~~h   38 (71)
                      +.|..|++.|.. .....|
T Consensus         1 ~sCiDC~~~F~~-~~y~~H   18 (28)
T PF08790_consen    1 FSCIDCSKDFDG-DSYKSH   18 (28)
T ss_dssp             EEETTTTEEEEG-GGTTT-
T ss_pred             CeeecCCCCcCc-CCcCCC
Confidence            467788888843 333334


No 129
>PF08274 PhnA_Zn_Ribbon:  PhnA Zinc-Ribbon ;  InterPro: IPR013987 The PhnA protein family includes the uncharacterised Escherichia coli protein PhnA and its homologues. The E. coli phnA gene is part of a large operon associated with alkylphosphonate uptake and carbon-phosphorus bond cleavage []. The protein is not related to the characterised phosphonoacetate hydrolase designated PhnA []. This entry represents the N-terminal domain of PhnA, which is predicted to form a zinc-ribbon.; PDB: 2AKL_A.
Probab=72.13  E-value=1.8  Score=15.63  Aligned_cols=10  Identities=30%  Similarity=0.916  Sum_probs=6.2

Q ss_pred             CceeCChhhH
Q psy12265         47 KAFQCEYCGK   56 (71)
Q Consensus        47 ~~~~C~~c~~   56 (71)
                      ..+.|+.|+.
T Consensus        18 ~~~vCp~C~~   27 (30)
T PF08274_consen   18 ELLVCPECGH   27 (30)
T ss_dssp             SSEEETTTTE
T ss_pred             CEEeCCcccc
Confidence            3567777763


No 130
>cd00924 Cyt_c_Oxidase_Vb Cytochrome c oxidase subunit Vb.  Cytochrome c oxidase (CcO), the terminal oxidase in the respiratory chains of eukaryotes and most bacteria, is a multi-chain transmembrane protein located in the inner membrane of mitochondria and the cell membrane of prokaryotes.  It catalyzes the reduction of O2 and simultaneously pumps protons across the membrane.  The number of subunits varies from three to five in bacteria and up to 13 in mammalian mitochondria. Subunits I, II, and III of mammalian CcO are encoded within the mitochondrial genome and the remaining 10 subunits are encoded within the nuclear genome.  Found only in eukaryotes, subunit Vb is one of three mammalian subunits that lacks a transmembrane region.  Subunit Vb is located on the matrix side of the membrane and binds the regulatory subunit of protein kinase A.  The abnormally extended conformation is stable only in the CcO assembly.
Probab=71.90  E-value=1.1  Score=20.88  Aligned_cols=18  Identities=33%  Similarity=0.645  Sum_probs=13.4

Q ss_pred             hcCCcCceeCChhhHhhhc
Q psy12265         42 LHSDVKAFQCEYCGKDFAR   60 (71)
Q Consensus        42 ~~~~~~~~~C~~c~~~f~~   60 (71)
                      .+.+ ++.+|+.||.-|.-
T Consensus        74 l~~g-~~~rC~eCG~~fkL   91 (97)
T cd00924          74 LEKG-KPKRCPECGHVFKL   91 (97)
T ss_pred             EeCC-CceeCCCCCcEEEE
Confidence            3444 68999999988763


No 131
>PRK09678 DNA-binding transcriptional regulator; Provisional
Probab=71.47  E-value=0.85  Score=20.02  Aligned_cols=15  Identities=27%  Similarity=0.678  Sum_probs=8.5

Q ss_pred             cCceeCC--hhhHhhhc
Q psy12265         46 VKAFQCE--YCGKDFAR   60 (71)
Q Consensus        46 ~~~~~C~--~c~~~f~~   60 (71)
                      +..++|.  .||..|..
T Consensus        25 ~~Y~qC~N~eCg~tF~t   41 (72)
T PRK09678         25 ERYHQCQNVNCSATFIT   41 (72)
T ss_pred             eeeeecCCCCCCCEEEE
Confidence            4445665  66666643


No 132
>PF07295 DUF1451:  Protein of unknown function (DUF1451);  InterPro: IPR009912 This family consists of several hypothetical bacterial proteins of around 160 residues in length. Members of this family contain four highly conserved cysteine resides toward the C-terminal region of the protein. The function of this family is unknown.
Probab=71.29  E-value=2.4  Score=21.22  Aligned_cols=28  Identities=29%  Similarity=0.666  Sum_probs=17.5

Q ss_pred             ceecccccccccchhhHHHhHhhhcCCcCceeCChhhHh
Q psy12265         19 PYGCEVCGRHFRQWGDLKYHKASLHSDVKAFQCEYCGKD   57 (71)
Q Consensus        19 ~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~C~~c~~~   57 (71)
                      .+.|..|+.....          .+++. .-.|+.|+..
T Consensus       112 ~l~C~~Cg~~~~~----------~~~~~-l~~Cp~C~~~  139 (146)
T PF07295_consen  112 TLVCENCGHEVEL----------THPER-LPPCPKCGHT  139 (146)
T ss_pred             eEecccCCCEEEe----------cCCCc-CCCCCCCCCC
Confidence            3899999865321          23333 3479999753


No 133
>PRK11823 DNA repair protein RadA; Provisional
Probab=70.41  E-value=3.1  Score=24.52  Aligned_cols=11  Identities=36%  Similarity=1.032  Sum_probs=8.1

Q ss_pred             Cceeccccccc
Q psy12265         18 KPYGCEVCGRH   28 (71)
Q Consensus        18 ~~~~c~~c~~~   28 (71)
                      ..|.|..||..
T Consensus         6 ~~y~C~~Cg~~   16 (446)
T PRK11823          6 TAYVCQECGAE   16 (446)
T ss_pred             CeEECCcCCCC
Confidence            35899999854


No 134
>COG4306 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=70.41  E-value=1.4  Score=21.57  Aligned_cols=49  Identities=16%  Similarity=0.180  Sum_probs=24.3

Q ss_pred             hHhhCCCc-eecccccccccchhhHHHhHhhhcCCcCceeCChhhHhhhc
Q psy12265         12 RVHLGLKP-YGCEVCGRHFRQWGDLKYHKASLHSDVKAFQCEYCGKDFAR   60 (71)
Q Consensus        12 ~~~~~~~~-~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~C~~c~~~f~~   60 (71)
                      -.+.++.. -.|+.|..+..-...+..-....+.-+.|--|-.||+.|+.
T Consensus        31 cskcgeati~qcp~csasirgd~~vegvlglg~dye~psfchncgs~fpw   80 (160)
T COG4306          31 CSKCGEATITQCPICSASIRGDYYVEGVLGLGGDYEPPSFCHNCGSRFPW   80 (160)
T ss_pred             HhhhchHHHhcCCccCCcccccceeeeeeccCCCCCCcchhhcCCCCCCc
Confidence            34444433 56777765443332222211111223456668888888774


No 135
>TIGR00416 sms DNA repair protein RadA. The gene protuct codes for a probable ATP-dependent protease involved in both DNA repair and degradation of proteins, peptides, glycopeptides. Also known as sms. Residues 11-28 of the SEED alignment contain a putative Zn binding domain. Residues 110-117 of the seed contain a putative ATP binding site both documented in Haemophilus and in Listeria monocytogenes. for E.coli see ( J. BACTERIOL. 178:5045-5048(1996)).
Probab=69.58  E-value=3.3  Score=24.50  Aligned_cols=10  Identities=30%  Similarity=1.009  Sum_probs=7.2

Q ss_pred             ceeccccccc
Q psy12265         19 PYGCEVCGRH   28 (71)
Q Consensus        19 ~~~c~~c~~~   28 (71)
                      .|.|..||..
T Consensus         7 ~y~C~~Cg~~   16 (454)
T TIGR00416         7 KFVCQHCGAD   16 (454)
T ss_pred             eEECCcCCCC
Confidence            4888888744


No 136
>PF10276 zf-CHCC:  Zinc-finger domain;  InterPro: IPR019401 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.   This entry represents a short conserved zinc-finger domain. It contains the sequence motif Cx8Hx14Cx2C. ; PDB: 2JVM_A 2JRR_A 2JZ8_A.
Probab=69.20  E-value=0.91  Score=17.58  Aligned_cols=12  Identities=33%  Similarity=1.099  Sum_probs=8.8

Q ss_pred             CceeCChhhHhh
Q psy12265         47 KAFQCEYCGKDF   58 (71)
Q Consensus        47 ~~~~C~~c~~~f   58 (71)
                      .+..|++|+..|
T Consensus        28 ~~~~CpYCg~~y   39 (40)
T PF10276_consen   28 GPVVCPYCGTRY   39 (40)
T ss_dssp             CEEEETTTTEEE
T ss_pred             CeEECCCCCCEE
Confidence            356899998765


No 137
>KOG1280|consensus
Probab=68.62  E-value=6.2  Score=22.80  Aligned_cols=38  Identities=21%  Similarity=0.450  Sum_probs=26.3

Q ss_pred             CceecccccccccchhhHHHhHhhhcCCcCc-eeCChhh
Q psy12265         18 KPYGCEVCGRHFRQWGDLKYHKASLHSDVKA-FQCEYCG   55 (71)
Q Consensus        18 ~~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~-~~C~~c~   55 (71)
                      ..|.|+.|+..-.....+.-|....|....+ ..|+.|+
T Consensus        78 qSftCPyC~~~Gfte~~f~~Hv~s~Hpda~~~~icp~c~  116 (381)
T KOG1280|consen   78 QSFTCPYCGIMGFTERQFGTHVLSQHPEASTSVICPLCA  116 (381)
T ss_pred             ccccCCcccccccchhHHHHHhhhcCcccCcceeeeccc
Confidence            4689999998777778888887766664432 3455553


No 138
>PRK00564 hypA hydrogenase nickel incorporation protein; Provisional
Probab=68.48  E-value=2.2  Score=20.40  Aligned_cols=11  Identities=27%  Similarity=0.884  Sum_probs=8.2

Q ss_pred             eeccccccccc
Q psy12265         20 YGCEVCGRHFR   30 (71)
Q Consensus        20 ~~c~~c~~~~~   30 (71)
                      ..|..|+..|.
T Consensus        72 ~~C~~Cg~~~~   82 (117)
T PRK00564         72 LECKDCSHVFK   82 (117)
T ss_pred             EEhhhCCCccc
Confidence            78888886654


No 139
>PRK03681 hypA hydrogenase nickel incorporation protein; Validated
Probab=68.29  E-value=2  Score=20.49  Aligned_cols=25  Identities=20%  Similarity=0.465  Sum_probs=15.3

Q ss_pred             eecccccccccchhhHHHhHhhhcCCcCceeCChhhH
Q psy12265         20 YGCEVCGRHFRQWGDLKYHKASLHSDVKAFQCEYCGK   56 (71)
Q Consensus        20 ~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~C~~c~~   56 (71)
                      ..|..|+..|....            ...+.||.||.
T Consensus        71 ~~C~~Cg~~~~~~~------------~~~~~CP~Cgs   95 (114)
T PRK03681         71 CWCETCQQYVTLLT------------QRVRRCPQCHG   95 (114)
T ss_pred             EEcccCCCeeecCC------------ccCCcCcCcCC
Confidence            78888986554211            11256998984


No 140
>COG1571 Predicted DNA-binding protein containing a Zn-ribbon domain [General function prediction only]
Probab=68.26  E-value=2.6  Score=24.79  Aligned_cols=29  Identities=24%  Similarity=0.720  Sum_probs=18.4

Q ss_pred             ecccccccccchhhHHHhHhhhcCCcCceeCChhhHhhhch
Q psy12265         21 GCEVCGRHFRQWGDLKYHKASLHSDVKAFQCEYCGKDFARK   61 (71)
Q Consensus        21 ~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~C~~c~~~f~~~   61 (71)
                      .|+.|+.+..            ..|..-|+|+.||..+...
T Consensus       352 ~Cp~Cg~~m~------------S~G~~g~rC~kCg~~~~~~  380 (421)
T COG1571         352 VCPRCGGRMK------------SAGRNGFRCKKCGTRARET  380 (421)
T ss_pred             CCCccCCchh------------hcCCCCcccccccccCCcc
Confidence            6778875532            2233378888888776543


No 141
>PF05443 ROS_MUCR:  ROS/MUCR transcriptional regulator protein;  InterPro: IPR008807 This family consists of several ROS/MUCR transcriptional regulator proteins. The ros chromosomal gene is present in octopine and nopaline strains of Agrobacterium tumefaciens as well as in Rhizobium meliloti (Sinorhizobium meliloti). This gene encodes a 15.5 kDa protein that specifically represses the virC and virD operons in the virulence region of the Ti plasmid [] and is necessary for succinoglycan production []. S. meliloti can produce two types of acidic exopolysaccharides, succinoglycan and galactoglucan, that are interchangeable for infection of Medicago sativa (Alfalfa) nodules. MucR from S. meliloti acts as a transcriptional repressor that blocks the expression of the exp genes responsible for galactoglucan production therefore allowing the exclusive production of succinoglycan [].; GO: 0003677 DNA binding, 0008270 zinc ion binding, 0006355 regulation of transcription, DNA-dependent; PDB: 2JSP_A.
Probab=67.45  E-value=2.8  Score=20.67  Aligned_cols=18  Identities=28%  Similarity=0.554  Sum_probs=9.7

Q ss_pred             eeCChhhHhhhchHHHHHhhh
Q psy12265         49 FQCEYCGKDFARKYQAHSYHQ   69 (71)
Q Consensus        49 ~~C~~c~~~f~~~~~l~~h~~   69 (71)
                      ..|.+||+.|..   |.+|.+
T Consensus        73 i~clecGk~~k~---LkrHL~   90 (132)
T PF05443_consen   73 IICLECGKKFKT---LKRHLR   90 (132)
T ss_dssp             EE-TBT--EESB---HHHHHH
T ss_pred             eEEccCCcccch---HHHHHH
Confidence            578889987764   355554


No 142
>PLN03238 probable histone acetyltransferase MYST; Provisional
Probab=67.17  E-value=4.2  Score=22.76  Aligned_cols=24  Identities=29%  Similarity=0.459  Sum_probs=19.1

Q ss_pred             cCceeCChhhHhhhchHHHHHhhh
Q psy12265         46 VKAFQCEYCGKDFARKYQAHSYHQ   69 (71)
Q Consensus        46 ~~~~~C~~c~~~f~~~~~l~~h~~   69 (71)
                      ...|.|..|-+-|.....|.+|+.
T Consensus        46 ~~lyiCe~Clky~~~~~~l~~H~~   69 (290)
T PLN03238         46 TKLYICEYCLKYMRKKKSLLRHLA   69 (290)
T ss_pred             CeEEEcCCCcchhCCHHHHHHHHH
Confidence            456888888888888888888864


No 143
>KOG0782|consensus
Probab=66.84  E-value=2.8  Score=25.96  Aligned_cols=49  Identities=29%  Similarity=0.497  Sum_probs=28.7

Q ss_pred             HHHHHHhHhhCCCceecccccccccchhhHHHhHhhhcCCc-CceeCChhhHhhhch
Q psy12265          6 YLKVHNRVHLGLKPYGCEVCGRHFRQWGDLKYHKASLHSDV-KAFQCEYCGKDFARK   61 (71)
Q Consensus         6 ~l~~h~~~~~~~~~~~c~~c~~~~~~~~~l~~h~~~~~~~~-~~~~C~~c~~~f~~~   61 (71)
                      .+.+|.=+|-....-.|..|+++|-++-.       .|..+ ....|..|...|-.+
T Consensus       240 ~fvrHHWVHrrRqeGkC~~CgKgFQQKf~-------FhsKEivAisCSWCKqayH~K  289 (1004)
T KOG0782|consen  240 GFVRHHWVHRRRQEGKCNTCGKGFQQKFF-------FHSKEIVAISCSWCKQAYHLK  289 (1004)
T ss_pred             cchHHhHhhHhhhccccchhhhhhhhhee-------eccccEEEEEehHHHHHhhcc
Confidence            34455455555556778888888765433       23323 335688887766544


No 144
>KOG2807|consensus
Probab=66.37  E-value=8  Score=22.26  Aligned_cols=22  Identities=18%  Similarity=0.460  Sum_probs=13.7

Q ss_pred             ceeCChhhHhhhchHHHHHhhh
Q psy12265         48 AFQCEYCGKDFARKYQAHSYHQ   69 (71)
Q Consensus        48 ~~~C~~c~~~f~~~~~l~~h~~   69 (71)
                      .|+|..|...|-..-+.-.|..
T Consensus       345 ~y~C~~Ck~~FCldCDv~iHes  366 (378)
T KOG2807|consen  345 RYRCESCKNVFCLDCDVFIHES  366 (378)
T ss_pred             cEEchhccceeeccchHHHHhh
Confidence            4677777777766555555543


No 145
>COG0675 Transposase and inactivated derivatives [DNA replication, recombination, and repair]
Probab=65.56  E-value=3.7  Score=22.57  Aligned_cols=19  Identities=32%  Similarity=0.607  Sum_probs=12.2

Q ss_pred             cCceeCChhhHhhhchHHH
Q psy12265         46 VKAFQCEYCGKDFARKYQA   64 (71)
Q Consensus        46 ~~~~~C~~c~~~f~~~~~l   64 (71)
                      ...|.|+.||..+......
T Consensus       320 ~r~~~C~~cg~~~~rD~na  338 (364)
T COG0675         320 GRLFKCPRCGFVHDRDVNA  338 (364)
T ss_pred             ceeEECCCCCCeehhhHHH
Confidence            3467899998765544333


No 146
>KOG2636|consensus
Probab=65.18  E-value=3.6  Score=24.52  Aligned_cols=26  Identities=23%  Similarity=0.443  Sum_probs=16.2

Q ss_pred             hcCCcCceeCChhh-HhhhchHHHHHh
Q psy12265         42 LHSDVKAFQCEYCG-KDFARKYQAHSY   67 (71)
Q Consensus        42 ~~~~~~~~~C~~c~-~~f~~~~~l~~h   67 (71)
                      .|.-...|.|.+|| .++.-+...++|
T Consensus       395 LHGL~~ey~CEICGNy~Y~GrkaF~RH  421 (497)
T KOG2636|consen  395 LHGLDIEYNCEICGNYVYKGRKAFDRH  421 (497)
T ss_pred             hcCCCcccceeeccCccccCcHHHHHH
Confidence            57667788999998 444444444433


No 147
>PLN00104 MYST -like histone acetyltransferase; Provisional
Probab=64.45  E-value=5.9  Score=23.66  Aligned_cols=24  Identities=33%  Similarity=0.506  Sum_probs=21.0

Q ss_pred             cCceeCChhhHhhhchHHHHHhhh
Q psy12265         46 VKAFQCEYCGKDFARKYQAHSYHQ   69 (71)
Q Consensus        46 ~~~~~C~~c~~~f~~~~~l~~h~~   69 (71)
                      ...|.|..|-+-|.....|.+|+.
T Consensus       196 ~~lyiCe~Cl~y~~~~~~~~~H~~  219 (450)
T PLN00104        196 SKLYFCEFCLKFMKRKEQLQRHMK  219 (450)
T ss_pred             CeEEEchhhhhhhcCHHHHHHHHh
Confidence            456899999999999999999975


No 148
>PTZ00064 histone acetyltransferase; Provisional
Probab=63.66  E-value=6  Score=24.06  Aligned_cols=24  Identities=21%  Similarity=0.227  Sum_probs=20.7

Q ss_pred             cCceeCChhhHhhhchHHHHHhhh
Q psy12265         46 VKAFQCEYCGKDFARKYQAHSYHQ   69 (71)
Q Consensus        46 ~~~~~C~~c~~~f~~~~~l~~h~~   69 (71)
                      ...|.|..|-+-|.....|.+|+.
T Consensus       278 d~LYICEfCLkY~~s~~~l~rH~~  301 (552)
T PTZ00064        278 DTLHFCEYCLDFFCFEDELIRHLS  301 (552)
T ss_pred             CeEEEccchhhhhCCHHHHHHHHh
Confidence            456899999999999999999975


No 149
>PF09845 DUF2072:  Zn-ribbon containing protein (DUF2072);  InterPro: IPR018645  This archaeal Zinc-ribbon containing proteins have no known function. 
Probab=63.53  E-value=3.8  Score=20.22  Aligned_cols=15  Identities=40%  Similarity=0.879  Sum_probs=11.9

Q ss_pred             ceecccccccccchh
Q psy12265         19 PYGCEVCGRHFRQWG   33 (71)
Q Consensus        19 ~~~c~~c~~~~~~~~   33 (71)
                      |+.|..|+..|..-+
T Consensus         1 PH~Ct~Cg~~f~dgs   15 (131)
T PF09845_consen    1 PHQCTKCGRVFEDGS   15 (131)
T ss_pred             CcccCcCCCCcCCCc
Confidence            678999999987543


No 150
>PLN03239 histone acetyltransferase; Provisional
Probab=63.35  E-value=6.2  Score=22.76  Aligned_cols=24  Identities=25%  Similarity=0.379  Sum_probs=20.8

Q ss_pred             cCceeCChhhHhhhchHHHHHhhh
Q psy12265         46 VKAFQCEYCGKDFARKYQAHSYHQ   69 (71)
Q Consensus        46 ~~~~~C~~c~~~f~~~~~l~~h~~   69 (71)
                      ...|.|..|-+-|.....|.+|+.
T Consensus       104 ~~lYiCE~Clky~~~~~~l~~H~~  127 (351)
T PLN03239        104 DVLYVCEFSFGFFARKSELLRFQA  127 (351)
T ss_pred             ceEEEeccchhhhcCHHHHHHHHH
Confidence            457899999999999999999874


No 151
>PF01155 HypA:  Hydrogenase expression/synthesis hypA family;  InterPro: IPR000688 Bacterial membrane-bound nickel-dependent hydrogenases requires a number of accessory proteins which are involved in their maturation. The exact role of these proteins is not yet clear, but some seem to be required for the incorporation of the nickel ions []. One of these proteins is generally known as hypA. It is a protein of about 12 to 14 kDa that contains, in its C-terminal region, four conserved cysteines that form a zinc-finger like motif. Escherichia coli has two proteins that belong to this family, hypA and hybF. A homologue, MJ0214, has also been found in a number of archaeal species, including the genome of Methanocaldococcus jannaschii (Methanococcus jannaschii).; GO: 0016151 nickel ion binding, 0006464 protein modification process; PDB: 2KDX_A 3A44_D 3A43_B.
Probab=63.14  E-value=3  Score=19.80  Aligned_cols=25  Identities=32%  Similarity=0.736  Sum_probs=14.5

Q ss_pred             eecccccccccchhhHHHhHhhhcCCcCceeCChhhHh
Q psy12265         20 YGCEVCGRHFRQWGDLKYHKASLHSDVKAFQCEYCGKD   57 (71)
Q Consensus        20 ~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~C~~c~~~   57 (71)
                      ..|..|+..|.....             .+.||.||..
T Consensus        71 ~~C~~Cg~~~~~~~~-------------~~~CP~Cgs~   95 (113)
T PF01155_consen   71 ARCRDCGHEFEPDEF-------------DFSCPRCGSP   95 (113)
T ss_dssp             EEETTTS-EEECHHC-------------CHH-SSSSSS
T ss_pred             EECCCCCCEEecCCC-------------CCCCcCCcCC
Confidence            788888877764321             1458888753


No 152
>PF10537 WAC_Acf1_DNA_bd:  ATP-utilising chromatin assembly and remodelling N-terminal;  InterPro: IPR013136 ACF (for ATP-utilising chromatin assembly and remodeling factor) is a chromatin-remodeling complex that catalyzes the ATP-dependent assembly of periodic nucleosome arrays. This reaction utilises the energy of ATP hydrolysis by ISWI, the smaller of the two subunits of ACF. Acf1, the large subunit of ACF, is essential for the full activity of the complex. The WAC (WSTF/Acf1/cbp146) domain is an ~110-residue module present at the N-termini of Acf1-related proteins in a variety of organisms. It is found in association with other domains such as the bromodomain, the PHD-type zinc finger, DDT or WAKS. The DNA-binding region of Acf1 includes the WAC domain, which is necessary for the efficient binding of ACF complex to DNA. It seems probable that the WAC domain will be involved in DNA binding in other related factors [, ].   Some proteins known to contain a WAC domain are the Drosophila melanogaster (Fruit fly) ATP-dependent chromatin assembly factor large subunit Acf1, human WSTF (Williams syndrome transcription factor), mouse cbp146, yeast imitation switch two complex protein 1 (ITC1 or YGL133w), and yeast protein YPL216w. 
Probab=62.78  E-value=6.7  Score=18.44  Aligned_cols=10  Identities=30%  Similarity=1.029  Sum_probs=4.4

Q ss_pred             Cceecccccc
Q psy12265         18 KPYGCEVCGR   27 (71)
Q Consensus        18 ~~~~c~~c~~   27 (71)
                      +.|.|...|+
T Consensus        29 ~vwtC~~TGk   38 (102)
T PF10537_consen   29 RVWTCEITGK   38 (102)
T ss_pred             CeeEEecCCC
Confidence            3444444443


No 153
>COG1773 Rubredoxin [Energy production and conversion]
Probab=62.75  E-value=1.9  Score=17.98  Aligned_cols=9  Identities=33%  Similarity=1.066  Sum_probs=4.4

Q ss_pred             eeCChhhHh
Q psy12265         49 FQCEYCGKD   57 (71)
Q Consensus        49 ~~C~~c~~~   57 (71)
                      |+|..||..
T Consensus         4 ~~C~~CG~v   12 (55)
T COG1773           4 WRCSVCGYV   12 (55)
T ss_pred             eEecCCceE
Confidence            455555443


No 154
>PF09416 UPF1_Zn_bind:  RNA helicase (UPF2 interacting domain);  InterPro: IPR018999 UPF1 (or regulator of nonsense transcripts 1 homologue) is an essential RNA helicase that detects mRNAs containing premature stop codons and triggers their degradation. This domain contains 3 zinc binding motifs and forms interactions with another protein (UPF2) that is also involved nonsense-mediated mRNA decay (NMD) []. ; GO: 0003677 DNA binding, 0004386 helicase activity, 0005524 ATP binding, 0008270 zinc ion binding, 0000184 nuclear-transcribed mRNA catabolic process, nonsense-mediated decay, 0005737 cytoplasm; PDB: 2IYK_B 2WJY_A 2WJV_A 2XZL_A.
Probab=62.35  E-value=14  Score=18.76  Aligned_cols=43  Identities=19%  Similarity=0.352  Sum_probs=18.7

Q ss_pred             hCCCceeccccccccc------chhhHHHhHhhh-------c----CCcCceeCChhhHh
Q psy12265         15 LGLKPYGCEVCGRHFR------QWGDLKYHKASL-------H----SDVKAFQCEYCGKD   57 (71)
Q Consensus        15 ~~~~~~~c~~c~~~~~------~~~~l~~h~~~~-------~----~~~~~~~C~~c~~~   57 (71)
                      .......|..|++-|.      +.+.+..|+...       |    .|+...+|..||..
T Consensus        10 ~p~~vv~C~~c~kWFCNg~~~~s~SHIv~HLv~srh~ev~LH~~s~lgdt~leCy~Cg~~   69 (152)
T PF09416_consen   10 DPSCVVKCNTCNKWFCNGRGNTSGSHIVNHLVRSRHKEVSLHPDSPLGDTVLECYNCGSR   69 (152)
T ss_dssp             -CCCEEEETTTTEEEES--TTSSS-HHHHHHHHHT---EEE-TTSTT-S-B---TTT---
T ss_pred             CcccEeEcCCCCcEeecCCCCCcccHHHHHHHHccCCceeeCCCCCCCCcEEEEEecCCC
Confidence            3444567777777664      345566665421       1    23445788888753


No 155
>PRK05978 hypothetical protein; Provisional
Probab=62.30  E-value=1.7  Score=21.80  Aligned_cols=32  Identities=31%  Similarity=0.573  Sum_probs=17.8

Q ss_pred             eecccccccccchhhHHHhHhhhcCCcCceeCChhhHhhhch
Q psy12265         20 YGCEVCGRHFRQWGDLKYHKASLHSDVKAFQCEYCGKDFARK   61 (71)
Q Consensus        20 ~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~C~~c~~~f~~~   61 (71)
                      -.|+.|++.-.....++          ..-.|+.||..|...
T Consensus        34 grCP~CG~G~LF~g~Lk----------v~~~C~~CG~~~~~~   65 (148)
T PRK05978         34 GRCPACGEGKLFRAFLK----------PVDHCAACGEDFTHH   65 (148)
T ss_pred             CcCCCCCCCcccccccc----------cCCCccccCCccccC
Confidence            46788876533222222          122688888776543


No 156
>PF08209 Sgf11:  Sgf11 (transcriptional regulation protein);  InterPro: IPR013246 The Sgf11 family is a SAGA complex subunit in Saccharomyces cerevisiae (Baker's yeast). The SAGA complex is a multisubunit protein complex involved in transcriptional regulation. SAGA combines proteins involved in interactions with DNA-bound activators and TATA-binding protein (TBP), as well as enzymes for histone acetylation and deubiquitylation [].; PDB: 3M99_B 2LO2_A 3MHH_C 3MHS_C.
Probab=62.15  E-value=1.6  Score=16.16  Aligned_cols=12  Identities=33%  Similarity=0.883  Sum_probs=7.7

Q ss_pred             ceeCChhhHhhh
Q psy12265         48 AFQCEYCGKDFA   59 (71)
Q Consensus        48 ~~~C~~c~~~f~   59 (71)
                      .+.|+.|++.+.
T Consensus         4 ~~~C~nC~R~v~   15 (33)
T PF08209_consen    4 YVECPNCGRPVA   15 (33)
T ss_dssp             EEE-TTTSSEEE
T ss_pred             eEECCCCcCCcc
Confidence            478999987543


No 157
>KOG1994|consensus
Probab=61.97  E-value=3.1  Score=22.53  Aligned_cols=24  Identities=13%  Similarity=0.390  Sum_probs=19.8

Q ss_pred             CCcCceeCChhhHhhhchHHHHHh
Q psy12265         44 SDVKAFQCEYCGKDFARKYQAHSY   67 (71)
Q Consensus        44 ~~~~~~~C~~c~~~f~~~~~l~~h   67 (71)
                      .....|-|-.||..|...-+|..|
T Consensus       235 LR~eh~YC~fCG~~y~~~edl~eh  258 (268)
T KOG1994|consen  235 LRSEHYYCFFCGIKYKDEEDLYEH  258 (268)
T ss_pred             HhccceEEEEeccccCCHHHHHHh
Confidence            345568899999999999998877


No 158
>KOG2747|consensus
Probab=61.96  E-value=6.9  Score=22.97  Aligned_cols=24  Identities=21%  Similarity=0.407  Sum_probs=21.2

Q ss_pred             cCceeCChhhHhhhchHHHHHhhh
Q psy12265         46 VKAFQCEYCGKDFARKYQAHSYHQ   69 (71)
Q Consensus        46 ~~~~~C~~c~~~f~~~~~l~~h~~   69 (71)
                      ...|.|..|.+.+.....|++|+.
T Consensus       156 ~~lYiCEfCLkY~~s~~~l~rH~~  179 (396)
T KOG2747|consen  156 DKLYICEFCLKYMKSRTSLQRHLK  179 (396)
T ss_pred             CeEEEehHHHhHhchHHHHHHHHH
Confidence            456899999999999999999975


No 159
>KOG0978|consensus
Probab=61.92  E-value=1.7  Score=27.14  Aligned_cols=20  Identities=15%  Similarity=0.263  Sum_probs=15.9

Q ss_pred             eeCChhhHhhhchHHHHHhh
Q psy12265         49 FQCEYCGKDFARKYQAHSYH   68 (71)
Q Consensus        49 ~~C~~c~~~f~~~~~l~~h~   68 (71)
                      -+||.|+..|..+.-+.+|+
T Consensus       679 RKCP~Cn~aFganDv~~I~l  698 (698)
T KOG0978|consen  679 RKCPKCNAAFGANDVHRIHL  698 (698)
T ss_pred             CCCCCCCCCCCcccccccCC
Confidence            48999999999887666653


No 160
>PF06397 Desulfoferrod_N:  Desulfoferrodoxin, N-terminal domain;  InterPro: IPR004462 This domain is found as essentially the full length of desulforedoxin, a 37-residue homodimeric non-haem iron protein. It is also found as the N-terminal domain of desulfoferrodoxin (rbo), a homodimeric non-haem iron protein with 2 Fe atoms per monomer in different oxidation states. This domain binds the ferric rather than the ferrous Fe of desulfoferrodoxin. Neelaredoxin, a monomeric blue non-haem iron protein, lacks this domain.; GO: 0005506 iron ion binding; PDB: 1DFX_A 1VZI_B 2JI2_D 1VZH_B 2JI3_C 2JI1_C 1VZG_A 1CFW_A 2LK5_B 1DHG_B ....
Probab=61.80  E-value=4.1  Score=15.41  Aligned_cols=11  Identities=36%  Similarity=1.014  Sum_probs=5.3

Q ss_pred             CceeCChhhHh
Q psy12265         47 KAFQCEYCGKD   57 (71)
Q Consensus        47 ~~~~C~~c~~~   57 (71)
                      +-|+|..||-.
T Consensus         5 ~~YkC~~CGni   15 (36)
T PF06397_consen    5 EFYKCEHCGNI   15 (36)
T ss_dssp             EEEE-TTT--E
T ss_pred             cEEEccCCCCE
Confidence            35788888743


No 161
>TIGR00622 ssl1 transcription factor ssl1. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=61.73  E-value=4.5  Score=19.42  Aligned_cols=24  Identities=13%  Similarity=0.402  Sum_probs=16.0

Q ss_pred             CceeCChhhHhhhchHHHHHhhhc
Q psy12265         47 KAFQCEYCGKDFARKYQAHSYHQI   70 (71)
Q Consensus        47 ~~~~C~~c~~~f~~~~~l~~h~~~   70 (71)
                      ..|+|+.|...|-..-+.-.|..+
T Consensus        80 ~~y~C~~C~~~FC~dCD~fiHe~L  103 (112)
T TIGR00622        80 HRYVCAVCKNVFCVDCDVFVHESL  103 (112)
T ss_pred             cceeCCCCCCccccccchhhhhhc
Confidence            357788887777766666666544


No 162
>PF04810 zf-Sec23_Sec24:  Sec23/Sec24 zinc finger;  InterPro: IPR006895 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  COPII (coat protein complex II)-coated vesicles carry proteins from the endoplasmic reticulum (ER) to the Golgi complex []. COPII-coated vesicles form on the ER by the stepwise recruitment of three cytosolic components: Sar1-GTP to initiate coat formation, Sec23/24 heterodimer to select SNARE and cargo molecules, and Sec13/31 to induce coat polymerisation and membrane deformation [].  Sec23 p and Sec24p are structurally related, folding into five distinct domains: a beta-barrel, a zinc-finger, an alpha/beta trunk domain (IPR006896 from INTERPRO), an all-helical region (IPR006900 from INTERPRO), and a C-terminal gelsolin-like domain (IPR007123 from INTERPRO). This entry describes an approximately 55-residue Sec23/24 zinc-binding domain, which lies against the beta-barrel at the periphery of the complex. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0006886 intracellular protein transport, 0006888 ER to Golgi vesicle-mediated transport, 0030127 COPII vesicle coat; PDB: 3EFO_B 3EG9_B 3EGD_A 2YRC_A 2NUP_A 2YRD_A 3EGX_A 2NUT_A 3EH1_A 1PD0_A ....
Probab=61.59  E-value=1.8  Score=16.52  Aligned_cols=15  Identities=27%  Similarity=0.875  Sum_probs=8.7

Q ss_pred             cCCcCceeCChhhHh
Q psy12265         43 HSDVKAFQCEYCGKD   57 (71)
Q Consensus        43 ~~~~~~~~C~~c~~~   57 (71)
                      ..+.+.|.|..|+..
T Consensus        19 ~~~~~~w~C~~C~~~   33 (40)
T PF04810_consen   19 DDGGKTWICNFCGTK   33 (40)
T ss_dssp             ETTTTEEEETTT--E
T ss_pred             cCCCCEEECcCCCCc
Confidence            334567888888764


No 163
>KOG3362|consensus
Probab=61.43  E-value=1.6  Score=21.83  Aligned_cols=24  Identities=17%  Similarity=0.515  Sum_probs=15.5

Q ss_pred             ceeCChhhHhhhchHHHHHhhhcC
Q psy12265         48 AFQCEYCGKDFARKYQAHSYHQIR   71 (71)
Q Consensus        48 ~~~C~~c~~~f~~~~~l~~h~~~~   71 (71)
                      +|.|..||-.+-.-..+..|..+|
T Consensus       129 ~ysC~~CG~kyCsv~C~~~HneTR  152 (156)
T KOG3362|consen  129 KYSCVNCGTKYCSVRCLKTHNETR  152 (156)
T ss_pred             hhHHHhcCCceeechhhhhccccc
Confidence            355666776676777777776553


No 164
>PF03811 Zn_Tnp_IS1:  InsA N-terminal domain;  InterPro: IPR003220 Insertion elements are mobile elements in DNA, usually encoding proteins required for transposition, for example transposases. Protein InsA is absolutely required for transposition of insertion element 1. This entry represents a short zinc binding domain found in IS1 InsA family protein. It is found at the N terminus of the protein and may be a DNA-binding domain.; GO: 0006313 transposition, DNA-mediated
Probab=61.16  E-value=3.1  Score=15.67  Aligned_cols=30  Identities=20%  Similarity=0.494  Sum_probs=16.5

Q ss_pred             eecccccccccchhhHHHhHhhhcCCcCceeCChh
Q psy12265         20 YGCEVCGRHFRQWGDLKYHKASLHSDVKAFQCEYC   54 (71)
Q Consensus        20 ~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~C~~c   54 (71)
                      ..|+.|+..    ..+.+|=. ...|...|.|..|
T Consensus         6 v~CP~C~s~----~~v~k~G~-~~~G~qryrC~~C   35 (36)
T PF03811_consen    6 VHCPRCQST----EGVKKNGK-SPSGHQRYRCKDC   35 (36)
T ss_pred             eeCCCCCCC----CcceeCCC-CCCCCEeEecCcC
Confidence            467767643    11333322 3456677888877


No 165
>PF04606 Ogr_Delta:  Ogr/Delta-like zinc finger;  InterPro: IPR007684 This entry is represented by Bacteriophage P2, Ogr. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches. This is a viral family of phage zinc-binding transcriptional activators, which also contains cryptic members in some bacterial genomes []. The P4 phage delta protein contains two such domains attached covalently, while the P2 phage Ogr proteins possess one domain but function as dimers. All the members of this family have the following consensus sequence: C-X(2)-C-X(3)-A-(X)2-R-X(15)-C-X(4)-C-X(3)-F [].; GO: 0006355 regulation of transcription, DNA-dependent
Probab=61.10  E-value=1.5  Score=17.39  Aligned_cols=16  Identities=31%  Similarity=0.638  Sum_probs=10.1

Q ss_pred             CcCceeCCh--hhHhhhc
Q psy12265         45 DVKAFQCEY--CGKDFAR   60 (71)
Q Consensus        45 ~~~~~~C~~--c~~~f~~   60 (71)
                      .+.-+.|..  ||..|..
T Consensus        22 ~~~Y~qC~N~~Cg~tfv~   39 (47)
T PF04606_consen   22 RELYCQCTNPECGHTFVA   39 (47)
T ss_pred             EEEEEEECCCcCCCEEEE
Confidence            345567765  8877653


No 166
>PTZ00448 hypothetical protein; Provisional
Probab=59.97  E-value=4.9  Score=23.32  Aligned_cols=23  Identities=9%  Similarity=0.205  Sum_probs=17.6

Q ss_pred             ceeCChhhHhhhchHHHHHhhhc
Q psy12265         48 AFQCEYCGKDFARKYQAHSYHQI   70 (71)
Q Consensus        48 ~~~C~~c~~~f~~~~~l~~h~~~   70 (71)
                      .|.|..|+..|......+.|.++
T Consensus       314 ~~tC~~C~v~F~~~~~qR~H~KS  336 (373)
T PTZ00448        314 MLLCRKCNIQLMDHNAFKQHYRS  336 (373)
T ss_pred             CccccccccccCCHHHHHHHhhh
Confidence            57899999888777777777653


No 167
>KOG2907|consensus
Probab=59.80  E-value=3.9  Score=19.64  Aligned_cols=41  Identities=17%  Similarity=0.426  Sum_probs=22.2

Q ss_pred             ceecccccccccchhhHHHhHhhhcCCcCc-eeCChhhHhhhch
Q psy12265         19 PYGCEVCGRHFRQWGDLKYHKASLHSDVKA-FQCEYCGKDFARK   61 (71)
Q Consensus        19 ~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~-~~C~~c~~~f~~~   61 (71)
                      ...|+.|+..=..-..  ..++...-|+-. |.|+.|+..|...
T Consensus        74 ~~kCpkCghe~m~Y~T--~QlRSADEGQTVFYTC~kC~~k~~e~  115 (116)
T KOG2907|consen   74 KHKCPKCGHEEMSYHT--LQLRSADEGQTVFYTCPKCKYKFTEN  115 (116)
T ss_pred             hccCcccCCchhhhhh--hhcccccCCceEEEEcCccceeeecc
Confidence            3788888854222122  122212223333 7899999887643


No 168
>PRK00762 hypA hydrogenase nickel incorporation protein; Provisional
Probab=59.46  E-value=3.8  Score=19.85  Aligned_cols=30  Identities=27%  Similarity=0.473  Sum_probs=16.7

Q ss_pred             eecccccccccchhhHHHhHhhhcCCcCceeCChhhH
Q psy12265         20 YGCEVCGRHFRQWGDLKYHKASLHSDVKAFQCEYCGK   56 (71)
Q Consensus        20 ~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~C~~c~~   56 (71)
                      ..| .|+..|.....-..+     . ...+.||.||.
T Consensus        71 ~~C-~Cg~~~~~~~~~~~~-----~-~~~~~CP~Cgs  100 (124)
T PRK00762         71 IEC-ECGYEGVVDEDEIDH-----Y-AAVIECPVCGN  100 (124)
T ss_pred             EEe-eCcCcccccccchhc-----c-ccCCcCcCCCC
Confidence            789 999776543211111     0 11357999983


No 169
>PF02748 PyrI_C:  Aspartate carbamoyltransferase regulatory chain, metal binding domain;  InterPro: IPR020542 Aspartate carbamoyltransferase (aspartate transcarbamylase, ATCase) 2.1.3.2 from EC is an allosteric enzyme that plays a central role in the regulation of the pyrimidine pathway in bacteria. The holoenzyme is a dodecamer composed of six catalytic chains, each with an active site, and six regulatory chains lacking catalytic activity []. The catalytic subunits exist as a dimer of catalytic trimers, (c3)2, while the regulatory subunits exist as a trimer of regulatory dimers, (r2)3, therefore the complete holoenzyme can be represented as (c3)2(r2)3. The association of the catalytic subunits c3 with the regulatory subunits r2 is responsible for the establishment of positive co-operativity between catalytic sites for the binding of aspartate and it dictates the pattern of allosteric response toward nucleotide effectors. ATCase from Escherichia coli is the most extensively studied allosteric enzyme []. The crystal structure of the T-state, the T-state with CTP bound, the R-state with N-phosphonacetyl-L-aspartate (PALA) bound, and the R-state with phosphonoacetamide plus malonate bound have been used in interpreting kinetic and mutational studies. A high-resolution structure of E. coli ATCase in the presence of PALA (a bisubstrate analog) allows a detailed description of the binding at the active site of the enzyme and allows a detailed model of the tetrahedral intermediate to be constructed. The entire regulatory chain has been traced showing that the N-terminal regions of the regulatory chains R1 and R6 are located in close proximity to each other and to the regulatory site. This portion of the molecule may be involved in the observed asymmetry between the regulatory binding sites as well as in the heterotropic response of the enzyme []. The C-terminal domain of the regulatory chains have a rubredoxin-like zinc-bound fold.  ATCase from Enterobacter agglomerans (Erwinia herbicola) (Pantoea agglomerans) differs from the other investigated enterobacterial ATCases by its absence of homotropic co-operativity toward the substrate aspartate and its lack of response to ATP which is an allosteric effector (activator) of this family of enzymes. Nevertheless, the E. herbicola ATCase has the same quaternary structure, two trimers of catalytic chains with three dimers of regulatory chains, (c3)2(r2)3, as other enterobacterial ATCases and shows extensive primary structure conservation [].  This entry represents the C-terminal domain.; PDB: 2YWW_B 1SKU_D 1Q95_L 8ATC_B 3AT1_D 1RAI_D 4E2F_D 1NBE_B 6AT1_B 2FZC_D ....
Probab=59.24  E-value=4.2  Score=16.65  Aligned_cols=17  Identities=18%  Similarity=0.661  Sum_probs=10.6

Q ss_pred             CcCceeCChhhHhhhch
Q psy12265         45 DVKAFQCEYCGKDFARK   61 (71)
Q Consensus        45 ~~~~~~C~~c~~~f~~~   61 (71)
                      ....++|.+|++.+...
T Consensus        32 ~~~~~rC~YCe~~~~~~   48 (52)
T PF02748_consen   32 EPIKLRCHYCERIITED   48 (52)
T ss_dssp             TTCEEEETTT--EEEHH
T ss_pred             CCCEEEeeCCCCEeccc
Confidence            44568999998877654


No 170
>COG5112 UFD2 U1-like Zn-finger-containing protein [General function prediction only]
Probab=58.70  E-value=15  Score=17.59  Aligned_cols=21  Identities=14%  Similarity=0.298  Sum_probs=12.9

Q ss_pred             eeCChhhHhhhchHHHHHhhh
Q psy12265         49 FQCEYCGKDFARKYQAHSYHQ   69 (71)
Q Consensus        49 ~~C~~c~~~f~~~~~l~~h~~   69 (71)
                      +-|..|.+-|...-.|..|.+
T Consensus        56 hYCieCaryf~t~~aL~~Hkk   76 (126)
T COG5112          56 HYCIECARYFITEKALMEHKK   76 (126)
T ss_pred             eeeehhHHHHHHHHHHHHHhc
Confidence            456666666666666666643


No 171
>PF14255 Cys_rich_CPXG:  Cysteine-rich CPXCG
Probab=58.45  E-value=2.1  Score=17.55  Aligned_cols=10  Identities=50%  Similarity=1.368  Sum_probs=6.1

Q ss_pred             eCChhhHhhh
Q psy12265         50 QCEYCGKDFA   59 (71)
Q Consensus        50 ~C~~c~~~f~   59 (71)
                      .|++||..+.
T Consensus         2 ~CPyCge~~~   11 (52)
T PF14255_consen    2 QCPYCGEPIE   11 (52)
T ss_pred             CCCCCCCeeE
Confidence            5777776543


No 172
>PF12230 PRP21_like_P:  Pre-mRNA splicing factor PRP21 like protein;  InterPro: IPR022030  This domain family is found in eukaryotes, and is typically between 212 and 238 amino acids in length. The family is found in association with PF01805 from PFAM. There are two completely conserved residues (W and H) that may be functionally important. PRP21 is required for assembly of the prespliceosome and it interacts with U2 snRNP and/or pre-mRNA in the prespliceosome. This family also contains proteins similar to PRP21, such as the mammalian SF3a. SF3a also interacts with U2 snRNP from the prespliceosome, converting it to its active form. ; PDB: 4DGW_B.
Probab=58.37  E-value=3.3  Score=22.07  Aligned_cols=24  Identities=17%  Similarity=0.221  Sum_probs=0.0

Q ss_pred             cCceeCChhhHhhhchHHHHHhhhc
Q psy12265         46 VKAFQCEYCGKDFARKYQAHSYHQI   70 (71)
Q Consensus        46 ~~~~~C~~c~~~f~~~~~l~~h~~~   70 (71)
                      .....|++||..++- +.+..||++
T Consensus       166 ~~~~~cPitGe~IP~-~e~~eHmRi  189 (229)
T PF12230_consen  166 EKMIICPITGEMIPA-DEMDEHMRI  189 (229)
T ss_dssp             -------------------------
T ss_pred             ccccccccccccccc-ccccccccc
Confidence            344679999887653 356677664


No 173
>PTZ00043 cytochrome c oxidase subunit; Provisional
Probab=56.69  E-value=3.1  Score=22.56  Aligned_cols=15  Identities=20%  Similarity=0.450  Sum_probs=11.8

Q ss_pred             cCceeCChhhHhhhc
Q psy12265         46 VKAFQCEYCGKDFAR   60 (71)
Q Consensus        46 ~~~~~C~~c~~~f~~   60 (71)
                      .++.+|+.||..|.-
T Consensus       179 GkpqRCpECGqVFKL  193 (268)
T PTZ00043        179 GFLYRCGECDQIFML  193 (268)
T ss_pred             CCCccCCCCCcEEEE
Confidence            457899999987763


No 174
>cd01121 Sms Sms (bacterial radA) DNA repair protein. This protein is not related to archael radA any more than is to other RecA-like NTPases. Sms has a role in recombination and recombinational repair and is responsible for the stabilization or processing of branched DNA molecules.
Probab=56.28  E-value=7.2  Score=22.57  Aligned_cols=9  Identities=33%  Similarity=0.748  Sum_probs=4.8

Q ss_pred             ceecccccc
Q psy12265         19 PYGCEVCGR   27 (71)
Q Consensus        19 ~~~c~~c~~   27 (71)
                      -+.|+.|+.
T Consensus        14 ~g~cp~c~~   22 (372)
T cd01121          14 LGKCPECGE   22 (372)
T ss_pred             cEECcCCCC
Confidence            355666653


No 175
>PF01194 RNA_pol_N:  RNA polymerases N / 8 kDa subunit;  InterPro: IPR000268 In eukaryotes, there are three different forms of DNA-dependent RNA polymerases (2.7.7.6 from EC) transcribing different sets of genes. Each class of RNA polymerase is an assemblage of ten to twelve different polypeptides. In archaebacteria, there is generally a single form of RNA polymerase which also consists of an oligomeric assemblage of 10 to 13 polypeptides. Archaebacterial subunit N (gene rpoN) [] is a small protein of about 8 kDa, it is evolutionary related [] to a 8.3 kDa component shared by all three forms of eukaryotic RNA polymerases (gene RPB10 in yeast and POLR2J in mammals) as well as to African swine fever virus (ASFV) protein CP80R []. There is a conserved region which is located at the N-terminal extremity of these polymerase subunits; this region contains two cysteines that binds a zinc ion [].; GO: 0003677 DNA binding, 0003899 DNA-directed RNA polymerase activity, 0006351 transcription, DNA-dependent; PDB: 2PMZ_N 3HKZ_N 1EF4_A 3H0G_V 2Y0S_N 2R92_J 3M4O_J 3S2D_J 1R9S_J 1Y1W_J ....
Probab=55.22  E-value=4.3  Score=17.24  Aligned_cols=14  Identities=36%  Similarity=0.738  Sum_probs=7.6

Q ss_pred             ceeCChhhHhhhch
Q psy12265         48 AFQCEYCGKDFARK   61 (71)
Q Consensus        48 ~~~C~~c~~~f~~~   61 (71)
                      |.+|-.||+..++.
T Consensus         4 PVRCFTCGkvi~~~   17 (60)
T PF01194_consen    4 PVRCFTCGKVIGNK   17 (60)
T ss_dssp             SSS-STTTSBTCGH
T ss_pred             ceecCCCCCChhHh
Confidence            45677777655443


No 176
>COG1655 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=55.09  E-value=4.5  Score=22.04  Aligned_cols=17  Identities=24%  Similarity=0.686  Sum_probs=12.4

Q ss_pred             cCceeCChhhHhhhchH
Q psy12265         46 VKAFQCEYCGKDFARKY   62 (71)
Q Consensus        46 ~~~~~C~~c~~~f~~~~   62 (71)
                      ++.+.||+|+-.|....
T Consensus        17 kk~ieCPvC~tkFkkee   33 (267)
T COG1655          17 KKTIECPVCNTKFKKEE   33 (267)
T ss_pred             hceeccCcccchhhhhh
Confidence            55678999988876543


No 177
>TIGR01206 lysW lysine biosynthesis protein LysW. This very small, poorly characterized protein has been shown essential in Thermus thermophilus for an unusual pathway of Lys biosynthesis from aspartate by way of alpha-aminoadipate (AAA) rather than diaminopimelate. It is found also in Deinococcus radiodurans and Pyrococcus horikoshii, which appear to share the AAA pathway.
Probab=55.01  E-value=2.5  Score=17.50  Aligned_cols=11  Identities=36%  Similarity=1.159  Sum_probs=6.8

Q ss_pred             eeCChhhHhhh
Q psy12265         49 FQCEYCGKDFA   59 (71)
Q Consensus        49 ~~C~~c~~~f~   59 (71)
                      |.|+.||..+.
T Consensus         3 ~~CP~CG~~ie   13 (54)
T TIGR01206         3 FECPDCGAEIE   13 (54)
T ss_pred             cCCCCCCCEEe
Confidence            56777776543


No 178
>TIGR00686 phnA alkylphosphonate utilization operon protein PhnA. The protein family includes an uncharacterized member designated phnA in Escherichia coli, part of a large operon associated with alkylphosphonate uptake and carbon-phosphorus bond cleavage. This protein is not related to the characterized phosphonoacetate hydrolase designated PhnA by Kulakova, et al. (2001, 1997).
Probab=54.93  E-value=6.6  Score=18.74  Aligned_cols=12  Identities=17%  Similarity=0.556  Sum_probs=7.2

Q ss_pred             ceeCChhhHhhh
Q psy12265         48 AFQCEYCGKDFA   59 (71)
Q Consensus        48 ~~~C~~c~~~f~   59 (71)
                      .|.|+.|+...+
T Consensus        19 ~~iCpeC~~EW~   30 (109)
T TIGR00686        19 QLICPSCLYEWN   30 (109)
T ss_pred             eeECcccccccc
Confidence            466777765543


No 179
>smart00440 ZnF_C2C2 C2C2 Zinc finger. Nucleic-acid-binding motif in transcriptional elongation factor TFIIS and RNA polymerases.
Probab=54.88  E-value=1.2  Score=17.14  Aligned_cols=10  Identities=30%  Similarity=1.162  Sum_probs=7.5

Q ss_pred             eeCChhhHhh
Q psy12265         49 FQCEYCGKDF   58 (71)
Q Consensus        49 ~~C~~c~~~f   58 (71)
                      |.|..|+..+
T Consensus        29 y~C~~C~~~w   38 (40)
T smart00440       29 YVCTKCGHRW   38 (40)
T ss_pred             EEeCCCCCEe
Confidence            7888888654


No 180
>PF13824 zf-Mss51:  Zinc-finger of mitochondrial splicing suppressor 51
Probab=54.83  E-value=5.8  Score=16.53  Aligned_cols=14  Identities=29%  Similarity=0.674  Sum_probs=10.1

Q ss_pred             CCcCceeCChhhHh
Q psy12265         44 SDVKAFQCEYCGKD   57 (71)
Q Consensus        44 ~~~~~~~C~~c~~~   57 (71)
                      .+...|.|+.||-.
T Consensus        10 ~~~v~~~Cp~cGip   23 (55)
T PF13824_consen   10 PAHVNFECPDCGIP   23 (55)
T ss_pred             ccccCCcCCCCCCc
Confidence            34567899998854


No 181
>smart00731 SprT SprT homologues. Predicted to have roles in transcription elongation. Contains a conserved HExxH motif, indicating a metalloprotease function.
Probab=54.68  E-value=6.7  Score=19.38  Aligned_cols=32  Identities=28%  Similarity=0.879  Sum_probs=17.8

Q ss_pred             ceecccccccccchhhHHHhHhhhcCCcCceeCChhhHhh
Q psy12265         19 PYGCEVCGRHFRQWGDLKYHKASLHSDVKAFQCEYCGKDF   58 (71)
Q Consensus        19 ~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~C~~c~~~f   58 (71)
                      .|.|..|+..+.      ++.+  +.....|.|..|+..+
T Consensus       112 ~y~C~~C~~~~~------~~rr--~~~~~~y~C~~C~g~l  143 (146)
T smart00731      112 PYRCTGCGQRYL------RVRR--SNNVSRYRCGKCGGKL  143 (146)
T ss_pred             EEECCCCCCCCc------eEcc--ccCcceEEcCCCCCEE
Confidence            577877876543      2222  2222557888887543


No 182
>COG5151 SSL1 RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, subunit SSL1 [Transcription / DNA replication, recombination, and repair]
Probab=54.66  E-value=8.4  Score=22.07  Aligned_cols=46  Identities=20%  Similarity=0.417  Sum_probs=26.8

Q ss_pred             cccccccccchhhHHHhHhhhcCCcCceeCChhhHhhhchHHHHHhhhc
Q psy12265         22 CEVCGRHFRQWGDLKYHKASLHSDVKAFQCEYCGKDFARKYQAHSYHQI   70 (71)
Q Consensus        22 c~~c~~~~~~~~~l~~h~~~~~~~~~~~~C~~c~~~f~~~~~l~~h~~~   70 (71)
                      |-.|...|+-...-...   .-+....|+|+.|...|-..-+.-.|..+
T Consensus       365 Cf~CQ~~fp~~~~~~~~---~~~ss~rY~Ce~CK~~FC~dCdvfiHe~L  410 (421)
T COG5151         365 CFVCQGPFPKPPVSPFD---ESTSSGRYQCELCKSTFCSDCDVFIHETL  410 (421)
T ss_pred             ceeccCCCCCCCCCccc---ccccccceechhhhhhhhhhhHHHHHHHH
Confidence            55566666544321111   12234568999999888877776666543


No 183
>PF11931 DUF3449:  Domain of unknown function (DUF3449);  InterPro: IPR024598 This presumed domain is functionally uncharacterised. It has two conserved sequence motifs: PIP and CEICG and contains a zinc-finger of the C2H2-type.; PDB: 4DGW_A.
Probab=54.50  E-value=4.1  Score=21.49  Aligned_cols=14  Identities=43%  Similarity=0.963  Sum_probs=0.0

Q ss_pred             hcCCcCceeCChhh
Q psy12265         42 LHSDVKAFQCEYCG   55 (71)
Q Consensus        42 ~~~~~~~~~C~~c~   55 (71)
                      .|.-...|.|.+||
T Consensus        95 LhGL~~ey~CEICG  108 (196)
T PF11931_consen   95 LHGLGVEYKCEICG  108 (196)
T ss_dssp             --------------
T ss_pred             HhCCCCeeeeEeCC
Confidence            34445667888886


No 184
>COG5188 PRP9 Splicing factor 3a, subunit 3 [RNA processing and modification]
Probab=54.46  E-value=8.4  Score=22.46  Aligned_cols=14  Identities=50%  Similarity=1.013  Sum_probs=11.4

Q ss_pred             hcCCcCceeCChhh
Q psy12265         42 LHSDVKAFQCEYCG   55 (71)
Q Consensus        42 ~~~~~~~~~C~~c~   55 (71)
                      .|.-.+.|+|.+||
T Consensus       368 lhgLd~ef~CEICg  381 (470)
T COG5188         368 LHGLDIEFECEICG  381 (470)
T ss_pred             hcCCCcceeeeecc
Confidence            56667789999998


No 185
>PF01844 HNH:  HNH endonuclease;  InterPro: IPR002711 HNH endonuclease is found in bacteria and viruses [, , ]. This family includes pyocins, colicins and anaredoxins.; GO: 0003676 nucleic acid binding, 0004519 endonuclease activity; PDB: 2QGP_C.
Probab=54.04  E-value=1.6  Score=16.76  Aligned_cols=7  Identities=57%  Similarity=1.184  Sum_probs=1.6

Q ss_pred             ChhhHhh
Q psy12265         52 EYCGKDF   58 (71)
Q Consensus        52 ~~c~~~f   58 (71)
                      ..|+..+
T Consensus         2 ~~C~~~~    8 (47)
T PF01844_consen    2 QYCGKPG    8 (47)
T ss_dssp             TTT--B-
T ss_pred             CCCCCcC
Confidence            3444433


No 186
>PF13878 zf-C2H2_3:  zinc-finger of acetyl-transferase ESCO
Probab=53.80  E-value=15  Score=14.13  Aligned_cols=22  Identities=32%  Similarity=0.546  Sum_probs=14.3

Q ss_pred             ceeccccccccc--chhhHHHhHh
Q psy12265         19 PYGCEVCGRHFR--QWGDLKYHKA   40 (71)
Q Consensus        19 ~~~c~~c~~~~~--~~~~l~~h~~   40 (71)
                      .-.|..|+..|.  ...+-..|.+
T Consensus        13 ~~~C~~CgM~Y~~~~~eD~~~H~~   36 (41)
T PF13878_consen   13 ATTCPTCGMLYSPGSPEDEKLHKK   36 (41)
T ss_pred             CcCCCCCCCEECCCCHHHHHHHHH
Confidence            358999997765  3455555654


No 187
>PF08271 TF_Zn_Ribbon:  TFIIB zinc-binding;  InterPro: IPR013137 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents a zinc finger motif found in transcription factor IIB (TFIIB). In eukaryotes the initiation of transcription of protein encoding genes by the polymerase II complexe (Pol II) is modulated by general and specific transcription factors. The general transcription factors operate through common promoters elements (such as the TATA box). At least seven different proteins associate to form the general transcription factors: TFIIA, -IIB, -IID, -IIE, -IIF, -IIG, and -IIH [].  TFIIB and TFIID are responsible for promoter recognition and interaction with pol II; together with Pol II, they form a minimal initiation complex capable of transcription under certain conditions. The TATA box of a Pol II promoter is bound in the initiation complex by the TBP subunit of TFIID, which bends the DNA around the C-terminal domain of TFIIB whereas the N-terminal zinc finger of TFIIB interacts with Pol II [, ]. The TFIIB zinc finger adopts a zinc ribbon fold characterised by two beta-hairpins forming two structurally similar zinc-binding sub-sites []. The zinc finger contacts the rbp1 subunit of Pol II through its dock domain, a conserved region of about 70 amino acids located close to the polymerase active site []. In the Pol II complex this surface is located near the RNA exit groove. Interestingly this sequence is best conserved in the three polymerases that utilise a TFIIB-like general transcription factor (Pol II, Pol III, and archaeal RNA polymerase) but not in Pol I [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0006355 regulation of transcription, DNA-dependent; PDB: 1VD4_A 1PFT_A 3K1F_M 3K7A_M 1RO4_A 1RLY_A 1DL6_A.
Probab=53.41  E-value=5.1  Score=15.39  Aligned_cols=8  Identities=38%  Similarity=1.286  Sum_probs=4.4

Q ss_pred             eeCChhhH
Q psy12265         49 FQCEYCGK   56 (71)
Q Consensus        49 ~~C~~c~~   56 (71)
                      |.|+.|+.
T Consensus         1 m~Cp~Cg~    8 (43)
T PF08271_consen    1 MKCPNCGS    8 (43)
T ss_dssp             ESBTTTSS
T ss_pred             CCCcCCcC
Confidence            34666654


No 188
>PRK10220 hypothetical protein; Provisional
Probab=52.89  E-value=7.9  Score=18.52  Aligned_cols=12  Identities=17%  Similarity=0.816  Sum_probs=7.2

Q ss_pred             ceeCChhhHhhh
Q psy12265         48 AFQCEYCGKDFA   59 (71)
Q Consensus        48 ~~~C~~c~~~f~   59 (71)
                      .|.|+.|+..+.
T Consensus        20 ~~vCpeC~hEW~   31 (111)
T PRK10220         20 MYICPECAHEWN   31 (111)
T ss_pred             eEECCcccCcCC
Confidence            466777765443


No 189
>PRK05452 anaerobic nitric oxide reductase flavorubredoxin; Provisional
Probab=52.86  E-value=6.2  Score=23.58  Aligned_cols=38  Identities=18%  Similarity=0.359  Sum_probs=22.0

Q ss_pred             CCCceecccccccccch-hhHHHhHhhhcCCc------CceeCChhhH
Q psy12265         16 GLKPYGCEVCGRHFRQW-GDLKYHKASLHSDV------KAFQCEYCGK   56 (71)
Q Consensus        16 ~~~~~~c~~c~~~~~~~-~~l~~h~~~~~~~~------~~~~C~~c~~   56 (71)
                      ....|.|..|+..|... ++-..-   ...|.      ..|.|+.|+.
T Consensus       422 ~~~~~~c~~c~~~yd~~~g~~~~~---~~~gt~~~~lp~~~~cp~c~~  466 (479)
T PRK05452        422 LGPRMQCSVCQWIYDPAKGEPMQD---VAPGTPWSEVPDNFLCPECSL  466 (479)
T ss_pred             CCCeEEECCCCeEECCCCCCcccC---CCCCCChhhCCCCCcCcCCCC
Confidence            34569999999877643 211111   12221      2379999984


No 190
>PF11672 DUF3268:  Protein of unknown function (DUF3268);  InterPro: IPR021686 This entry is represented by Listeria phage P100, Gp150. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches.
Probab=52.77  E-value=8.2  Score=18.21  Aligned_cols=11  Identities=45%  Similarity=0.954  Sum_probs=7.4

Q ss_pred             Cceeccccccc
Q psy12265         18 KPYGCEVCGRH   28 (71)
Q Consensus        18 ~~~~c~~c~~~   28 (71)
                      +|-.|+.|+..
T Consensus         1 ~p~~CpYCg~~   11 (102)
T PF11672_consen    1 KPIICPYCGGP   11 (102)
T ss_pred             CCcccCCCCCe
Confidence            45678888754


No 191
>PF01215 COX5B:  Cytochrome c oxidase subunit Vb This family consists of chains F and S ;  InterPro: IPR002124 Cytochrome c oxidase (1.9.3.1 from EC) is an oligomeric enzymatic complex which is a component of the respiratory chain complex and is involved in the transfer of electrons from cytochrome c to oxygen []. In eukaryotes this enzyme complex is located in the mitochondrial inner membrane; in aerobic prokaryotes it is found in the plasma membrane.  In eukaryotes, in addition to the three large subunits, I, II and III, that form the catalytic centre of the enzyme complex, there are a variable number of small polypeptidic subunits. One of these subunits, which is known as Vb in mammals, V in Dictyostelium discoideum (Slime mold) and IV in yeast, binds a zinc atom. The sequence of subunit Vb is well conserved and includes three conserved cysteines that coordinate the zinc ion [, ]. Two of these cysteines are clustered in the C-terminal section of the subunit.; GO: 0004129 cytochrome-c oxidase activity, 0005740 mitochondrial envelope; PDB: 2EIL_S 2ZXW_S 3ASN_S 1OCO_S 3AG4_S 3ABK_S 1OCZ_S 1OCC_F 3ASO_S 3ABL_S ....
Probab=52.76  E-value=3.2  Score=20.61  Aligned_cols=17  Identities=35%  Similarity=0.745  Sum_probs=12.5

Q ss_pred             cCCcCceeCChhhHhhhc
Q psy12265         43 HSDVKAFQCEYCGKDFAR   60 (71)
Q Consensus        43 ~~~~~~~~C~~c~~~f~~   60 (71)
                      +.+ ++.+|+.||.-|.-
T Consensus       108 ~~g-~~~RCpeCG~~fkL  124 (136)
T PF01215_consen  108 HKG-KPQRCPECGQVFKL  124 (136)
T ss_dssp             ETT-SEEEETTTEEEEEE
T ss_pred             eCC-CccCCCCCCeEEEE
Confidence            444 57899999987763


No 192
>COG5319 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=52.42  E-value=14  Score=18.28  Aligned_cols=26  Identities=19%  Similarity=0.447  Sum_probs=15.2

Q ss_pred             ccccchhhHHHhHhhhcCCcCceeCChhhHh
Q psy12265         27 RHFRQWGDLKYHKASLHSDVKAFQCEYCGKD   57 (71)
Q Consensus        27 ~~~~~~~~l~~h~~~~~~~~~~~~C~~c~~~   57 (71)
                      ..|.++.++.+...     .....|+.|+.+
T Consensus        16 GWF~ssaDfd~Q~~-----rgLv~CPvCgs~   41 (142)
T COG5319          16 GWFGSSADFDRQRE-----RGLVTCPVCGST   41 (142)
T ss_pred             ccccCchhHHHHHH-----cCceeCCCCCcH
Confidence            35666666665432     234578888754


No 193
>PRK11788 tetratricopeptide repeat protein; Provisional
Probab=52.14  E-value=28  Score=19.62  Aligned_cols=7  Identities=57%  Similarity=1.644  Sum_probs=5.1

Q ss_pred             eeccccc
Q psy12265         20 YGCEVCG   26 (71)
Q Consensus        20 ~~c~~c~   26 (71)
                      |.|..||
T Consensus       355 ~~c~~cg  361 (389)
T PRK11788        355 YRCRNCG  361 (389)
T ss_pred             EECCCCC
Confidence            7777776


No 194
>PF05180 zf-DNL:  DNL zinc finger;  InterPro: IPR007853 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The DNL-type zinc finger is found in Tim15, a zinc finger protein essential for protein import into mitochondria. Mitochondrial functions rely on the correct transport of resident proteins synthesized in the cytosol to mitochondria. Protein import into mitochondria is mediated by membrane protein complexes, protein translocators, in the outer and inner mitochondrial membranes, in cooperation with their assistant proteins in the cytosol, intermembrane space and matrix. Proteins destined to the mitochondrial matrix cross the outer membrane with the aid of the outer membrane translocator, the tOM40 complex, and then the inner membrane with the aid of the inner membrane translocator, the TIM23 complex, and mitochondrial motor and chaperone (MMC) proteins including mitochondrial heat- shock protein 70 (mtHsp70), and translocase in the inner mitochondrial membrane (Tim)15. Tim15 is also known as zinc finger motif (Zim)17 or mtHsp70 escort protein (Hep)1. Tim15 contains a zinc-finger motif (CXXC and CXXC) of ~100 residues, which has been named DNL after a short C-terminal motif of D(N/H)L [, , ]. The DNL-type zinc finger is an L-shaped molecule. The two CXXC motifs are located at the end of the L, and are sandwiched by two- stranded antiparallel beta-sheets. Two short alpha-helices constitute another leg of the L. The outer (convex) face of the L has a large acidic groove, which is lined with five acidic residues, whereas the inner (concave) face of the L has two positively charged residues, next to the CXXC motifs []. This entry represents the DNL-type zinc finger.; GO: 0008270 zinc ion binding; PDB: 2E2Z_A.
Probab=51.38  E-value=3.4  Score=17.87  Aligned_cols=34  Identities=24%  Similarity=0.537  Sum_probs=18.5

Q ss_pred             ceecccccccccchhhHHHhHhhhcCCcCceeCChhhH
Q psy12265         19 PYGCEVCGRHFRQWGDLKYHKASLHSDVKAFQCEYCGK   56 (71)
Q Consensus        19 ~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~C~~c~~   56 (71)
                      .|.|..|+....  ..+..+.  .+.|..-.+|+.|..
T Consensus         4 ~FTC~~C~~Rs~--~~~sk~a--Y~~GvViv~C~gC~~   37 (66)
T PF05180_consen    4 TFTCNKCGTRSA--KMFSKQA--YHKGVVIVQCPGCKN   37 (66)
T ss_dssp             EEEETTTTEEEE--EEEEHHH--HHTSEEEEE-TTS--
T ss_pred             EEEcCCCCCccc--eeeCHHH--HhCCeEEEECCCCcc
Confidence            378888875432  2222332  456666778998864


No 195
>PRK08222 hydrogenase 4 subunit H; Validated
Probab=51.16  E-value=7.3  Score=20.12  Aligned_cols=19  Identities=21%  Similarity=0.494  Sum_probs=14.0

Q ss_pred             CceeCChhhHhhhchHHHH
Q psy12265         47 KAFQCEYCGKDFARKYQAH   65 (71)
Q Consensus        47 ~~~~C~~c~~~f~~~~~l~   65 (71)
                      ....|..||+.|.....++
T Consensus       113 ~~~~C~~Cg~~f~~~k~i~  131 (181)
T PRK08222        113 HLQRCSRCERPFAPQKTVA  131 (181)
T ss_pred             ccCcCcccCCccCcHhHHH
Confidence            4678999999988554443


No 196
>COG1997 RPL43A Ribosomal protein L37AE/L43A [Translation, ribosomal structure and biogenesis]
Probab=50.53  E-value=4.7  Score=18.47  Aligned_cols=33  Identities=30%  Similarity=0.681  Sum_probs=21.9

Q ss_pred             CCceecccccccccchhhHHHhHhhhcCCcCceeCChhhHhhhc
Q psy12265         17 LKPYGCEVCGRHFRQWGDLKYHKASLHSDVKAFQCEYCGKDFAR   60 (71)
Q Consensus        17 ~~~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~C~~c~~~f~~   60 (71)
                      ..+|.|+.|++. .       +.+ .  ..--|.|..|+..|.-
T Consensus        33 ~~~~~Cp~C~~~-~-------VkR-~--a~GIW~C~kCg~~fAG   65 (89)
T COG1997          33 RAKHVCPFCGRT-T-------VKR-I--ATGIWKCRKCGAKFAG   65 (89)
T ss_pred             hcCCcCCCCCCc-c-------eee-e--ccCeEEcCCCCCeecc
Confidence            357999999855 1       112 2  2346899999988763


No 197
>COG5027 SAS2 Histone acetyltransferase (MYST family) [Chromatin structure and dynamics]
Probab=50.39  E-value=13  Score=21.64  Aligned_cols=24  Identities=17%  Similarity=0.386  Sum_probs=20.7

Q ss_pred             cCceeCChhhHhhhchHHHHHhhh
Q psy12265         46 VKAFQCEYCGKDFARKYQAHSYHQ   69 (71)
Q Consensus        46 ~~~~~C~~c~~~f~~~~~l~~h~~   69 (71)
                      ...|.|..|-+.|.....+.+|++
T Consensus       156 d~vyICefClkY~~s~~~~~rH~~  179 (395)
T COG5027         156 DIVYICEFCLKYYGSQTSLVRHRK  179 (395)
T ss_pred             ceEEEhhhhHHHhcchhHHHHHHh
Confidence            346899999999999999999975


No 198
>TIGR00627 tfb4 transcription factor tfb4. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=50.20  E-value=8.5  Score=21.49  Aligned_cols=7  Identities=29%  Similarity=0.923  Sum_probs=3.3

Q ss_pred             eCChhhH
Q psy12265         50 QCEYCGK   56 (71)
Q Consensus        50 ~C~~c~~   56 (71)
                      .|+.||.
T Consensus       271 ~C~~Cgt  277 (279)
T TIGR00627       271 ICKTCKT  277 (279)
T ss_pred             CCCCCCC
Confidence            4555543


No 199
>KOG2071|consensus
Probab=50.15  E-value=7.5  Score=23.98  Aligned_cols=24  Identities=21%  Similarity=0.360  Sum_probs=16.5

Q ss_pred             cCceeCChhhHhhhchHHHHHhhh
Q psy12265         46 VKAFQCEYCGKDFARKYQAHSYHQ   69 (71)
Q Consensus        46 ~~~~~C~~c~~~f~~~~~l~~h~~   69 (71)
                      ..+-.|..||..|........||-
T Consensus       416 ~~pnqC~~CG~R~~~~ee~sk~md  439 (579)
T KOG2071|consen  416 DSPNQCKSCGLRFDDSEERSKHMD  439 (579)
T ss_pred             CCcchhcccccccccchhhhhHhh
Confidence            345678888888877766665553


No 200
>COG4640 Predicted membrane protein [Function unknown]
Probab=49.96  E-value=8.8  Score=22.71  Aligned_cols=18  Identities=22%  Similarity=0.543  Sum_probs=10.9

Q ss_pred             ceecccccccccchhhHH
Q psy12265         19 PYGCEVCGRHFRQWGDLK   36 (71)
Q Consensus        19 ~~~c~~c~~~~~~~~~l~   36 (71)
                      ...|.+||..|.......
T Consensus        15 ~~qC~qCG~~~t~~~sqa   32 (465)
T COG4640          15 DVQCTQCGHKFTSRQSQA   32 (465)
T ss_pred             cccccccCCcCCchhhhh
Confidence            345777777766554433


No 201
>PF13240 zinc_ribbon_2:  zinc-ribbon domain
Probab=49.77  E-value=3.5  Score=13.78  Aligned_cols=6  Identities=50%  Similarity=1.542  Sum_probs=3.6

Q ss_pred             CChhhH
Q psy12265         51 CEYCGK   56 (71)
Q Consensus        51 C~~c~~   56 (71)
                      |+.||.
T Consensus        16 C~~CG~   21 (23)
T PF13240_consen   16 CPNCGT   21 (23)
T ss_pred             hhhhCC
Confidence            666654


No 202
>PF01927 Mut7-C:  Mut7-C RNAse domain;  InterPro: IPR002782 This prokaryotic family of proteins have no known function. The proteins contain four conserved cysteines that may be involved in metal binding or disulphide bridges.
Probab=49.59  E-value=4.6  Score=20.02  Aligned_cols=39  Identities=21%  Similarity=0.439  Sum_probs=20.1

Q ss_pred             eecccccccccchhh--HHHhHh--hhcCCcCceeCChhhHhh
Q psy12265         20 YGCEVCGRHFRQWGD--LKYHKA--SLHSDVKAFQCEYCGKDF   58 (71)
Q Consensus        20 ~~c~~c~~~~~~~~~--l~~h~~--~~~~~~~~~~C~~c~~~f   58 (71)
                      -.|..|+..+..-+.  +..-..  .....+.-+.|+.|++.|
T Consensus        92 sRC~~CN~~L~~v~~~~v~~~vp~~v~~~~~~f~~C~~C~kiy  134 (147)
T PF01927_consen   92 SRCPKCNGPLRPVSKEEVKDRVPPYVYETYDEFWRCPGCGKIY  134 (147)
T ss_pred             CccCCCCcEeeechhhccccccCccccccCCeEEECCCCCCEe
Confidence            588899875543221  110000  011122347899999865


No 203
>COG4391 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=49.44  E-value=7  Score=16.68  Aligned_cols=43  Identities=16%  Similarity=0.308  Sum_probs=23.5

Q ss_pred             hHhhCCCceecccccccccchhhHHHhHhhhcCCcCceeCChhhHhhh
Q psy12265         12 RVHLGLKPYGCEVCGRHFRQWGDLKYHKASLHSDVKAFQCEYCGKDFA   59 (71)
Q Consensus        12 ~~~~~~~~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~C~~c~~~f~   59 (71)
                      .++.+..++.|.--+..+..+--+.   . + ..+.-..|++|+..|.
T Consensus        17 ~I~~~~~~l~C~g~~~p~~HPrV~L---~-m-g~~gev~CPYC~t~y~   59 (62)
T COG4391          17 TIEIGDLPLMCPGPEPPNDHPRVFL---D-M-GDEGEVVCPYCSTRYR   59 (62)
T ss_pred             EEEeCCeeEEcCCCCCCCCCCEEEE---E-c-CCCCcEecCccccEEE
Confidence            3455667788875544433221111   0 1 2234468999998775


No 204
>PF06170 DUF983:  Protein of unknown function (DUF983);  InterPro: IPR009325 This family consists of several bacterial proteins of unknown function.
Probab=47.80  E-value=4.9  Score=18.25  Aligned_cols=11  Identities=36%  Similarity=1.144  Sum_probs=8.1

Q ss_pred             eCChhhHhhhc
Q psy12265         50 QCEYCGKDFAR   60 (71)
Q Consensus        50 ~C~~c~~~f~~   60 (71)
                      +|+.||..|..
T Consensus        10 ~C~~CG~d~~~   20 (86)
T PF06170_consen   10 RCPHCGLDYSH   20 (86)
T ss_pred             cccccCCcccc
Confidence            68888877654


No 205
>PRK12722 transcriptional activator FlhC; Provisional
Probab=47.38  E-value=14  Score=19.47  Aligned_cols=28  Identities=36%  Similarity=0.880  Sum_probs=18.1

Q ss_pred             eecccccccccchhhHHHhHhhhcCCcCceeCChhhH
Q psy12265         20 YGCEVCGRHFRQWGDLKYHKASLHSDVKAFQCEYCGK   56 (71)
Q Consensus        20 ~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~C~~c~~   56 (71)
                      ..|..|+..|....         +.....|.|+.|.-
T Consensus       135 ~~C~~Cgg~fv~~~---------~e~~~~f~CplC~~  162 (187)
T PRK12722        135 SSCNCCGGHFVTHA---------HDPVGSFVCGLCQP  162 (187)
T ss_pred             ccCCCCCCCeeccc---------cccCCCCcCCCCCC
Confidence            57888888776321         22245688998853


No 206
>PF10263 SprT-like:  SprT-like family;  InterPro: IPR006640 This is a family of uncharacterised bacterial proteins which includes Escherichia coli SprT (P39902 from SWISSPROT). SprT is described as a regulator of bolA gene in stationary phase []. The majority of members contain the metallopeptidase zinc binding signature which has a HExxH motif, however there is no evidence for them being metallopeptidases. 
Probab=47.18  E-value=4.4  Score=20.00  Aligned_cols=31  Identities=32%  Similarity=0.950  Sum_probs=17.4

Q ss_pred             ceecccccccccchhhHHHhHhhhcCCcCceeCChhhHhh
Q psy12265         19 PYGCEVCGRHFRQWGDLKYHKASLHSDVKAFQCEYCGKDF   58 (71)
Q Consensus        19 ~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~C~~c~~~f   58 (71)
                      .|.|..|+..+..      +.+ .  ....|.|..|+..+
T Consensus       123 ~~~C~~C~~~~~r------~~~-~--~~~~~~C~~C~~~l  153 (157)
T PF10263_consen  123 VYRCPSCGREYKR------HRR-S--KRKRYRCGRCGGPL  153 (157)
T ss_pred             EEEcCCCCCEeee------ecc-c--chhhEECCCCCCEE
Confidence            4778888766532      211 1  22347888887543


No 207
>PHA02942 putative transposase; Provisional
Probab=47.16  E-value=9.9  Score=22.13  Aligned_cols=15  Identities=33%  Similarity=0.795  Sum_probs=10.8

Q ss_pred             cCceeCChhhHhhhc
Q psy12265         46 VKAFQCEYCGKDFAR   60 (71)
Q Consensus        46 ~~~~~C~~c~~~f~~   60 (71)
                      ...|.|+.||.....
T Consensus       340 ~r~f~C~~CG~~~dr  354 (383)
T PHA02942        340 HRYFHCPSCGYENDR  354 (383)
T ss_pred             CCEEECCCCCCEeCc
Confidence            357999999876543


No 208
>PF06676 DUF1178:  Protein of unknown function (DUF1178);  InterPro: IPR009562 This family consists of several hypothetical bacterial proteins of around 150 residues in length. The function of this family is unknown.
Probab=46.70  E-value=21  Score=18.12  Aligned_cols=9  Identities=33%  Similarity=1.006  Sum_probs=4.7

Q ss_pred             ceeCChhhH
Q psy12265         48 AFQCEYCGK   56 (71)
Q Consensus        48 ~~~C~~c~~   56 (71)
                      ...|++||.
T Consensus        32 lv~CP~Cgs   40 (148)
T PF06676_consen   32 LVSCPVCGS   40 (148)
T ss_pred             CccCCCCCC
Confidence            345666653


No 209
>PF02146 SIR2:  Sir2 family;  InterPro: IPR003000 These sequences represent the Sirtuin (Sir2-related) family of NAD+-dependent deacetylases. This family of enzymes is broadly conserved from bacteria to humans. In yeast, Sir2 proteins form complexes with other proteins to silence chromatin by accessing histones and deacetylating them. Sir2 proteins have been proposed to play a role in silencing, chromosome stability and ageing []. The bacterial enzyme CobB, an homologue of Sir2, is a phosphoribosyltransferase []. An in vitro ADP ribosyltransferase activity has also been associated with human members of this family []. Sir2-like enzymes employ NAD+ as a cosubstrate in deacetylation reactions [] and catalyse a reaction in which the cleavage of NAD(+)and histone and/or protein deacetylation are coupled to the formation of O-acetyl-ADP-ribose, a novel metabolite. The dependence of the reaction on both NAD(+) and the generation of this potential second messenger offers new clues to understanding the function and regulation of nuclear, cytoplasmic and mitochondrial Sir2-like enzymes []. Silent Information Regulator protein of Saccharomyces cerevisiae (Sir2) is one of several factors critical for silencing at least three loci. Among them, it is unique because it silences the rDNA as well as the mating type loci and telomeres []. Sir2 interacts in a complex with itself and with Sir3 and Sir4, two proteins that are able to interact with nucleosomes. In addition Sir2 also interacts with ubiquitination factors and/or complexes [].  Homologues of Sir2 share a core domain including the GAG and NID motifs and a putative C4 Zinc finger. The regions containing these three conserved motifs are individually essential for Sir2 silencing function, as are the four cysteins []. In addition, the conserved residues HG next to the putative Zn finger have been shown to be essential for the ADP ribosyltransferase activity []. ; GO: 0008270 zinc ion binding, 0070403 NAD+ binding, 0006476 protein deacetylation; PDB: 1S5P_A 3PKI_E 3PKJ_F 3K35_A 1ICI_A 1M2K_A 1M2G_A 1M2N_B 1M2H_A 1M2J_A ....
Probab=46.67  E-value=24  Score=17.94  Aligned_cols=33  Identities=18%  Similarity=0.520  Sum_probs=18.4

Q ss_pred             ceecccccccccchhhHHHhHhhhcCCcCceeCChhhH
Q psy12265         19 PYGCEVCGRHFRQWGDLKYHKASLHSDVKAFQCEYCGK   56 (71)
Q Consensus        19 ~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~C~~c~~   56 (71)
                      ...|..|+..+....... ..   .. ..+-.|+.|+.
T Consensus       105 ~~~C~~C~~~~~~~~~~~-~~---~~-~~~~~C~~C~~  137 (178)
T PF02146_consen  105 RLRCSKCGKEYDREDIVD-SI---DE-EEPPRCPKCGG  137 (178)
T ss_dssp             EEEETTTSBEEEGHHHHH-HH---HT-TSSCBCTTTSC
T ss_pred             eeeecCCCccccchhhcc-cc---cc-cccccccccCc
Confidence            468888988776543222 11   11 12237888864


No 210
>PRK12860 transcriptional activator FlhC; Provisional
Probab=46.33  E-value=15  Score=19.41  Aligned_cols=27  Identities=30%  Similarity=0.636  Sum_probs=17.6

Q ss_pred             eecccccccccchhhHHHhHhhhcCCcCceeCChhh
Q psy12265         20 YGCEVCGRHFRQWGDLKYHKASLHSDVKAFQCEYCG   55 (71)
Q Consensus        20 ~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~C~~c~   55 (71)
                      ..|..|+..|...         .+.....|.|+.|.
T Consensus       135 ~~C~~Cgg~fv~~---------~~e~~~~f~CplC~  161 (189)
T PRK12860        135 ARCCRCGGKFVTH---------AHDLRHNFVCGLCQ  161 (189)
T ss_pred             ccCCCCCCCeecc---------ccccCCCCcCCCCC
Confidence            6788888877632         12234468898884


No 211
>PRK12387 formate hydrogenlyase complex iron-sulfur subunit; Provisional
Probab=46.19  E-value=10  Score=19.49  Aligned_cols=18  Identities=28%  Similarity=0.683  Sum_probs=13.4

Q ss_pred             CceeCChhhHhhhchHHH
Q psy12265         47 KAFQCEYCGKDFARKYQA   64 (71)
Q Consensus        47 ~~~~C~~c~~~f~~~~~l   64 (71)
                      .++.|..||+.|.....+
T Consensus       113 ~~~~C~~CG~~f~~~~~i  130 (180)
T PRK12387        113 ALCNCRVCGRPFAVQKEI  130 (180)
T ss_pred             CcccchhhCCccccHHHH
Confidence            467899999988755443


No 212
>COG5432 RAD18 RING-finger-containing E3 ubiquitin ligase [Signal transduction mechanisms]
Probab=45.98  E-value=9.5  Score=21.66  Aligned_cols=27  Identities=30%  Similarity=0.678  Sum_probs=17.6

Q ss_pred             cccccccchhhHHHhHhhhcCCcCceeCChhhHh
Q psy12265         24 VCGRHFRQWGDLKYHKASLHSDVKAFQCEYCGKD   57 (71)
Q Consensus        24 ~c~~~~~~~~~l~~h~~~~~~~~~~~~C~~c~~~   57 (71)
                      .||.+|.+..     ++ .|.+..|+ |+.|...
T Consensus        42 tCgHtFCslC-----IR-~hL~~qp~-CP~Cr~~   68 (391)
T COG5432          42 TCGHTFCSLC-----IR-RHLGTQPF-CPVCRED   68 (391)
T ss_pred             ccccchhHHH-----HH-HHhcCCCC-Ccccccc
Confidence            4888887643     23 57777776 7877543


No 213
>COG1779 C4-type Zn-finger protein [General function prediction only]
Probab=45.97  E-value=3.7  Score=21.70  Aligned_cols=40  Identities=23%  Similarity=0.309  Sum_probs=21.9

Q ss_pred             CceecccccccccchhhHHHhHhhhcCCc---CceeCChhhHhhhc
Q psy12265         18 KPYGCEVCGRHFRQWGDLKYHKASLHSDV---KAFQCEYCGKDFAR   60 (71)
Q Consensus        18 ~~~~c~~c~~~~~~~~~l~~h~~~~~~~~---~~~~C~~c~~~f~~   60 (71)
                      ....|+.|+..+.....+..  . -|.|+   ..+.|..||..+..
T Consensus        13 ~~~~CPvCg~~l~~~~~~~~--I-PyFG~V~i~t~~C~~CgYR~~D   55 (201)
T COG1779          13 TRIDCPVCGGTLKAHMYLYD--I-PYFGEVLISTGVCERCGYRSTD   55 (201)
T ss_pred             eeecCCcccceeeEEEeeec--C-CccceEEEEEEEccccCCcccc
Confidence            34679999874433222211  1 23343   23578889876653


No 214
>PRK04016 DNA-directed RNA polymerase subunit N; Provisional
Probab=45.76  E-value=8.3  Score=16.49  Aligned_cols=13  Identities=38%  Similarity=0.764  Sum_probs=7.9

Q ss_pred             ceeCChhhHhhhc
Q psy12265         48 AFQCEYCGKDFAR   60 (71)
Q Consensus        48 ~~~C~~c~~~f~~   60 (71)
                      |.+|-.||+..++
T Consensus         4 PvRCFTCGkvi~~   16 (62)
T PRK04016          4 PVRCFTCGKVIAE   16 (62)
T ss_pred             CeEecCCCCChHH
Confidence            4566677765544


No 215
>PF10083 DUF2321:  Uncharacterized protein conserved in bacteria (DUF2321);  InterPro: IPR016891 This entry is represented by Bacteriophage 'Lactobacillus prophage Lj928', Orf-Ljo1454. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches. There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function.
Probab=45.59  E-value=2.1  Score=21.69  Aligned_cols=15  Identities=27%  Similarity=0.632  Sum_probs=11.1

Q ss_pred             cCceeCChhhHhhhc
Q psy12265         46 VKAFQCEYCGKDFAR   60 (71)
Q Consensus        46 ~~~~~C~~c~~~f~~   60 (71)
                      +.|.-|..||+.|++
T Consensus        66 ~~PsYC~~CGkpyPW   80 (158)
T PF10083_consen   66 EAPSYCHNCGKPYPW   80 (158)
T ss_pred             CCChhHHhCCCCCch
Confidence            456678888888774


No 216
>PF02891 zf-MIZ:  MIZ/SP-RING zinc finger;  InterPro: IPR004181 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents MIZ-type zinc finger domains. Miz1 (Msx-interacting-zinc finger) is a zinc finger-containing protein with homology to the yeast protein, Nfi-1. Miz1 is a sequence specific DNA binding protein that can function as a positive-acting transcription factor. Miz1 binds to the homeobox protein Msx2, enhancing the specific DNA-binding ability of Msx2 []. Other proteins containing this domain include the human pias family (protein inhibitor of activated STAT protein). More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 3I2D_A.
Probab=45.48  E-value=13  Score=14.89  Aligned_cols=8  Identities=38%  Similarity=1.269  Sum_probs=3.1

Q ss_pred             eeCChhhH
Q psy12265         49 FQCEYCGK   56 (71)
Q Consensus        49 ~~C~~c~~   56 (71)
                      |.|+.|++
T Consensus        42 W~CPiC~~   49 (50)
T PF02891_consen   42 WKCPICNK   49 (50)
T ss_dssp             -B-TTT--
T ss_pred             eECcCCcC
Confidence            77777764


No 217
>PF05129 Elf1:  Transcription elongation factor Elf1 like;  InterPro: IPR007808 This family of uncharacterised, mostly short, proteins contain a putative zinc binding domain with four conserved cysteines.; PDB: 1WII_A.
Probab=45.45  E-value=9.6  Score=17.09  Aligned_cols=12  Identities=33%  Similarity=0.944  Sum_probs=3.8

Q ss_pred             CcCceeCChhhH
Q psy12265         45 DVKAFQCEYCGK   56 (71)
Q Consensus        45 ~~~~~~C~~c~~   56 (71)
                      -.+.|.|+.|+.
T Consensus        19 l~~~F~CPfC~~   30 (81)
T PF05129_consen   19 LPKVFDCPFCNH   30 (81)
T ss_dssp             -SS----TTT--
T ss_pred             CCceEcCCcCCC
Confidence            346789998873


No 218
>PF14690 zf-ISL3:  zinc-finger of transposase IS204/IS1001/IS1096/IS1165
Probab=45.36  E-value=8.3  Score=14.83  Aligned_cols=9  Identities=33%  Similarity=0.925  Sum_probs=6.3

Q ss_pred             ceeCChhhH
Q psy12265         48 AFQCEYCGK   56 (71)
Q Consensus        48 ~~~C~~c~~   56 (71)
                      |..|+.||.
T Consensus         2 ~~~Cp~Cg~   10 (47)
T PF14690_consen    2 PPRCPHCGS   10 (47)
T ss_pred             CccCCCcCC
Confidence            456888874


No 219
>PF01286 XPA_N:  XPA protein N-terminal;  InterPro: IPR022652 Xeroderma pigmentosum (XP) [] is a human autosomal recessive disease, characterised by a high incidence of sunlight-induced skin cancer. Skin cells of individual's with this condition are hypersensitive to ultraviolet light, due to defects in the incision step of DNA excision repair. There are a minimum of seven genetic complementation groups involved in this pathway: XP-A to XP-G. XP-A is the most severe form of the disease and is due to defects in a 30 kDa nuclear protein called XPA (or XPAC) []. The sequence of the XPA protein is conserved from higher eukaryotes [] to yeast (gene RAD14) []. XPA is a hydrophilic protein of 247 to 296 amino-acid residues which has a C4-type zinc finger motif in its central section. This entry contains the zinc-finger containing region in the XPA protein. It is found N-terminal to PF05181 from PFAM ; PDB: 1D4U_A 1XPA_A.
Probab=45.32  E-value=9.8  Score=14.18  Aligned_cols=12  Identities=33%  Similarity=0.944  Sum_probs=5.7

Q ss_pred             eecccccccccc
Q psy12265         20 YGCEVCGRHFRQ   31 (71)
Q Consensus        20 ~~c~~c~~~~~~   31 (71)
                      -.|..|++.|..
T Consensus         4 ~~C~eC~~~f~d   15 (34)
T PF01286_consen    4 PKCDECGKPFMD   15 (34)
T ss_dssp             EE-TTT--EES-
T ss_pred             chHhHhCCHHHH
Confidence            367888887764


No 220
>PF11789 zf-Nse:  Zinc-finger of the MIZ type in Nse subunit; PDB: 2YU4_A 3HTK_C.
Probab=45.01  E-value=9.3  Score=15.86  Aligned_cols=20  Identities=15%  Similarity=0.421  Sum_probs=11.5

Q ss_pred             cCceeCChhhHhhhchHHHH
Q psy12265         46 VKAFQCEYCGKDFARKYQAH   65 (71)
Q Consensus        46 ~~~~~C~~c~~~f~~~~~l~   65 (71)
                      +.|+....|+..|...+-++
T Consensus        22 ~~PV~s~~C~H~fek~aI~~   41 (57)
T PF11789_consen   22 EDPVKSKKCGHTFEKEAILQ   41 (57)
T ss_dssp             SSEEEESSS--EEEHHHHHH
T ss_pred             hCCcCcCCCCCeecHHHHHH
Confidence            34666667888887665544


No 221
>KOG3352|consensus
Probab=44.82  E-value=5.5  Score=20.17  Aligned_cols=14  Identities=29%  Similarity=0.698  Sum_probs=10.4

Q ss_pred             CceeCChhhHhhhc
Q psy12265         47 KAFQCEYCGKDFAR   60 (71)
Q Consensus        47 ~~~~C~~c~~~f~~   60 (71)
                      +..+|++||.-|.-
T Consensus       132 e~~rc~eCG~~fkL  145 (153)
T KOG3352|consen  132 ETQRCPECGHYFKL  145 (153)
T ss_pred             CcccCCcccceEEe
Confidence            35689999987753


No 222
>PF10058 DUF2296:  Predicted integral membrane metal-binding protein (DUF2296);  InterPro: IPR019273  This domain, found mainly in the eukaryotic lunapark proteins, has no known function []. 
Probab=44.62  E-value=9.6  Score=15.70  Aligned_cols=11  Identities=36%  Similarity=1.177  Sum_probs=8.4

Q ss_pred             cCceeCChhhH
Q psy12265         46 VKAFQCEYCGK   56 (71)
Q Consensus        46 ~~~~~C~~c~~   56 (71)
                      ...|.|+.|+.
T Consensus        42 ~i~y~C~~Cg~   52 (54)
T PF10058_consen   42 EIQYRCPYCGA   52 (54)
T ss_pred             ceEEEcCCCCC
Confidence            44699999974


No 223
>PF13821 DUF4187:  Domain of unknown function (DUF4187)
Probab=44.50  E-value=7.4  Score=16.10  Aligned_cols=21  Identities=14%  Similarity=0.430  Sum_probs=12.7

Q ss_pred             cCceeCChhhHhhhchHHHHH
Q psy12265         46 VKAFQCEYCGKDFARKYQAHS   66 (71)
Q Consensus        46 ~~~~~C~~c~~~f~~~~~l~~   66 (71)
                      ..-+-|-.||..|.....|..
T Consensus        25 ~~~~YC~~Cg~~Y~d~~dL~~   45 (55)
T PF13821_consen   25 EEHNYCFWCGTKYDDEEDLER   45 (55)
T ss_pred             hhCceeeeeCCccCCHHHHHh
Confidence            344557777777766666543


No 224
>PF05741 zf-nanos:  Nanos RNA binding domain;  InterPro: IPR024161 Nanos is a highly conserved RNA-binding protein in higher eukaryotes and functions as a key regulatory protein in translational control using a 3' untranslated region during the development and maintenance of germ cells. Nanos comprises a non-conserved amino-terminus and highly conserved carboxy- terminal regions. The C-terminal region has two conserved Cys-Cys-His-Cys (CCHC)-type zinc-finger motifs that are indispensable for nanos function [, , ]. The structure of the nanos-type zinc finger is composed of two independent zinc-finger (ZF) lobes, the N-terminal ZF1 and the C-terminal ZF2, which are connected by a linker helix []. These lobes create a large cleft. Zinc ions in ZF1 and ZF2 are bound to the CCHC motif by tetrahedral coordination.; PDB: 3ALR_B.
Probab=44.43  E-value=9.1  Score=15.94  Aligned_cols=11  Identities=27%  Similarity=1.026  Sum_probs=3.6

Q ss_pred             CceeCChhhHh
Q psy12265         47 KAFQCEYCGKD   57 (71)
Q Consensus        47 ~~~~C~~c~~~   57 (71)
                      +.|.|+.||.+
T Consensus        32 r~y~Cp~CgAt   42 (55)
T PF05741_consen   32 RKYVCPICGAT   42 (55)
T ss_dssp             GG---TTT---
T ss_pred             hcCcCCCCcCc
Confidence            34789999875


No 225
>PF00301 Rubredoxin:  Rubredoxin;  InterPro: IPR004039 Rubredoxin is a low molecular weight iron-containing bacterial protein involved in electron transfer [, ], sometimes replacing ferredoxin as an electron carrier []. The 3-D structures of a number of rubredoxins have been solved [, ]. The fold belongs to the alpha+beta class, with 2 alpha-helices and 2-3 beta-strands. Its active site contains an iron ion which is co-ordinated by the sulphurs of four conserved cysteine residues forming an almost regular tetrahedron. The conserved cysteines reside on two loops, which are the most conserved regions of the protein. In addition, a ring of acidic residues in the proximity of the [Fe(Cys)4] centre is also well-conserved []. ; GO: 0009055 electron carrier activity, 0046872 metal ion binding; PDB: 2RDV_C 1RDV_A 1S24_A 1T9O_B 1B2J_A 1SMW_A 2PVE_B 1BFY_A 1T9P_C 1C09_C ....
Probab=44.05  E-value=12  Score=14.92  Aligned_cols=35  Identities=23%  Similarity=0.552  Sum_probs=17.1

Q ss_pred             eecccccccccchhhHHHhHhhhcCC------cCceeCChhhH
Q psy12265         20 YGCEVCGRHFRQWGDLKYHKASLHSD------VKAFQCEYCGK   56 (71)
Q Consensus        20 ~~c~~c~~~~~~~~~l~~h~~~~~~~------~~~~~C~~c~~   56 (71)
                      |.|..|+..|.....-...-  ...|      ..-|.|+.|+.
T Consensus         2 y~C~~CgyvYd~~~Gd~~~~--i~pGt~F~~Lp~~w~CP~C~a   42 (47)
T PF00301_consen    2 YQCPVCGYVYDPEKGDPENG--IPPGTPFEDLPDDWVCPVCGA   42 (47)
T ss_dssp             EEETTTSBEEETTTBBGGGT--B-TT--GGGS-TT-B-TTTSS
T ss_pred             cCCCCCCEEEcCCcCCcccC--cCCCCCHHHCCCCCcCcCCCC
Confidence            78999997765443211110  1111      12489999974


No 226
>COG0068 HypF Hydrogenase maturation factor [Posttranslational modification, protein turnover, chaperones]
Probab=43.94  E-value=5.9  Score=25.09  Aligned_cols=14  Identities=29%  Similarity=0.700  Sum_probs=8.4

Q ss_pred             ecccccccccchhh
Q psy12265         21 GCEVCGRHFRQWGD   34 (71)
Q Consensus        21 ~c~~c~~~~~~~~~   34 (71)
                      .|+.||-.|+-..+
T Consensus       125 ~CT~CGPRfTIi~a  138 (750)
T COG0068         125 NCTNCGPRFTIIEA  138 (750)
T ss_pred             ccCCCCcceeeecc
Confidence            56677776654433


No 227
>PF13248 zf-ribbon_3:  zinc-ribbon domain
Probab=43.58  E-value=5.5  Score=13.56  Aligned_cols=6  Identities=50%  Similarity=1.514  Sum_probs=3.6

Q ss_pred             CChhhH
Q psy12265         51 CEYCGK   56 (71)
Q Consensus        51 C~~c~~   56 (71)
                      |+.||.
T Consensus        19 C~~CG~   24 (26)
T PF13248_consen   19 CPNCGA   24 (26)
T ss_pred             ChhhCC
Confidence            666664


No 228
>COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair]
Probab=43.53  E-value=17  Score=23.32  Aligned_cols=12  Identities=25%  Similarity=0.645  Sum_probs=8.5

Q ss_pred             cCceeCChhhHh
Q psy12265         46 VKAFQCEYCGKD   57 (71)
Q Consensus        46 ~~~~~C~~c~~~   57 (71)
                      ..|..|+.||..
T Consensus       473 ~~p~~Cp~Cgs~  484 (730)
T COG1198         473 PIPQSCPECGSE  484 (730)
T ss_pred             CCCCCCCCCCCC
Confidence            457788888753


No 229
>smart00586 ZnF_DBF Zinc finger in DBF-like proteins.
Probab=43.46  E-value=24  Score=14.32  Aligned_cols=20  Identities=40%  Similarity=0.697  Sum_probs=11.1

Q ss_pred             CCceecccccccccchhhHHHhH
Q psy12265         17 LKPYGCEVCGRHFRQWGDLKYHK   39 (71)
Q Consensus        17 ~~~~~c~~c~~~~~~~~~l~~h~   39 (71)
                      .+|.-|..|...|.   ++..|+
T Consensus         3 ~k~GYCE~Cr~kfd---~l~~Hi   22 (49)
T smart00586        3 KKPGYCENCREKYD---DLETHL   22 (49)
T ss_pred             CCCcccccHhHHHh---hHHHHh
Confidence            34566777766553   444454


No 230
>TIGR00319 desulf_FeS4 desulfoferrodoxin FeS4 iron-binding domain. Neelaredoxin, a monomeric blue non-heme iron protein, lacks this domain.
Probab=43.33  E-value=11  Score=13.66  Aligned_cols=10  Identities=40%  Similarity=1.192  Sum_probs=6.7

Q ss_pred             ceeCChhhHh
Q psy12265         48 AFQCEYCGKD   57 (71)
Q Consensus        48 ~~~C~~c~~~   57 (71)
                      -|+|..||-.
T Consensus         7 ~ykC~~Cgni   16 (34)
T TIGR00319         7 VYKCEVCGNI   16 (34)
T ss_pred             EEEcCCCCcE
Confidence            5778777643


No 231
>PHA02998 RNA polymerase subunit; Provisional
Probab=42.95  E-value=3.8  Score=21.36  Aligned_cols=37  Identities=16%  Similarity=0.278  Sum_probs=20.6

Q ss_pred             CceecccccccccchhhHHHhHhhhcCCcCc----eeCChhhHhhh
Q psy12265         18 KPYGCEVCGRHFRQWGDLKYHKASLHSDVKA----FQCEYCGKDFA   59 (71)
Q Consensus        18 ~~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~----~~C~~c~~~f~   59 (71)
                      ....|+.|+..=.....++     +...+.|    |.|..||..|.
T Consensus       142 t~v~CPkCg~~~A~f~qlQ-----TRSADEPmT~FYkC~~CG~~wk  182 (195)
T PHA02998        142 YNTPCPNCKSKNTTPMMIQ-----TRAADEPPLVRHACRDCKKHFK  182 (195)
T ss_pred             cCCCCCCCCCCceEEEEEe-----eccCCCCceEEEEcCCCCCccC
Confidence            3467888885433322221     2222222    78999997654


No 232
>cd00974 DSRD Desulforedoxin (DSRD) domain; a small non-heme iron domain present in the desulforedoxin (rubredoxin oxidoreductase) and desulfoferrodoxin proteins of some archeael and bacterial methanogens and sulfate/sulfur reducers. Desulforedoxin is a small, single-domain homodimeric protein; each subunit contains an iron atom bound to four cysteinyl sulfur atoms, Fe(S-Cys)4, in a distorted tetrahedral coordination. Its metal center is similar to that found in rubredoxin type proteins. Desulforedoxin is regarded as a potential redox partner for rubredoxin. Desulfoferrodoxin forms a homodimeric protein, with each protomer comprised of two domains, the N-terminal DSRD domain and C-terminal superoxide reductase-like (SORL) domain. Each domain has a distinct iron center: the DSRD iron center I, Fe(S-Cys)4; and the SORL iron center II, Fe[His4Cys(Glu)].
Probab=42.88  E-value=11  Score=13.67  Aligned_cols=9  Identities=44%  Similarity=1.479  Sum_probs=6.1

Q ss_pred             ceeCChhhH
Q psy12265         48 AFQCEYCGK   56 (71)
Q Consensus        48 ~~~C~~c~~   56 (71)
                      -|+|..||.
T Consensus         4 ~ykC~~CGn   12 (34)
T cd00974           4 VYKCEICGN   12 (34)
T ss_pred             EEEcCCCCc
Confidence            467777764


No 233
>KOG2857|consensus
Probab=42.82  E-value=8.3  Score=19.39  Aligned_cols=21  Identities=10%  Similarity=0.276  Sum_probs=11.3

Q ss_pred             ceeCChhhHhhhchHHHHHhh
Q psy12265         48 AFQCEYCGKDFARKYQAHSYH   68 (71)
Q Consensus        48 ~~~C~~c~~~f~~~~~l~~h~   68 (71)
                      .|+|+.|...+-+-..+..|+
T Consensus        17 KYKCpkC~vPYCSl~CfKiHk   37 (157)
T KOG2857|consen   17 KYKCPKCSVPYCSLPCFKIHK   37 (157)
T ss_pred             hccCCCCCCccccchhhhhcc
Confidence            356666655555555555553


No 234
>PF11023 DUF2614:  Protein of unknown function (DUF2614);  InterPro: IPR020912 This entry describes proteins of unknown function, which are thought to be membrane proteins.; GO: 0005887 integral to plasma membrane
Probab=42.25  E-value=11  Score=18.22  Aligned_cols=15  Identities=27%  Similarity=0.702  Sum_probs=9.4

Q ss_pred             CCcCceeCChhhHhh
Q psy12265         44 SDVKAFQCEYCGKDF   58 (71)
Q Consensus        44 ~~~~~~~C~~c~~~f   58 (71)
                      +.....+|+.|++..
T Consensus        65 tkav~V~CP~C~K~T   79 (114)
T PF11023_consen   65 TKAVQVECPNCGKQT   79 (114)
T ss_pred             ccceeeECCCCCChH
Confidence            344556788887653


No 235
>cd00730 rubredoxin Rubredoxin; nonheme iron binding domains containing a [Fe(SCys)4] center. Rubredoxins are small nonheme iron proteins. The iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), but iron can also be replaced by cobalt, nickel or zinc. They are believed to be involved in electron transfer.
Probab=42.23  E-value=12  Score=15.19  Aligned_cols=34  Identities=26%  Similarity=0.714  Sum_probs=19.0

Q ss_pred             eecccccccccch-hhHHHhHhhhcCC------cCceeCChhhH
Q psy12265         20 YGCEVCGRHFRQW-GDLKYHKASLHSD------VKAFQCEYCGK   56 (71)
Q Consensus        20 ~~c~~c~~~~~~~-~~l~~h~~~~~~~------~~~~~C~~c~~   56 (71)
                      |.|..|+..|... .+...-   .-.|      ...|.|+.|+.
T Consensus         2 y~C~~CgyiYd~~~Gd~~~~---i~pGt~f~~Lp~~w~CP~C~a   42 (50)
T cd00730           2 YECRICGYIYDPAEGDPDEG---IPPGTPFEDLPDDWVCPVCGA   42 (50)
T ss_pred             cCCCCCCeEECCCCCCcccC---cCCCCCHhHCCCCCCCCCCCC
Confidence            7899999877643 111110   1111      12479999974


No 236
>COG4888 Uncharacterized Zn ribbon-containing protein [General function prediction only]
Probab=42.13  E-value=10  Score=17.93  Aligned_cols=12  Identities=42%  Similarity=1.099  Sum_probs=8.2

Q ss_pred             cCceeCChhhHh
Q psy12265         46 VKAFQCEYCGKD   57 (71)
Q Consensus        46 ~~~~~C~~c~~~   57 (71)
                      .+.|.|+.|+..
T Consensus        20 ~k~FtCp~Cghe   31 (104)
T COG4888          20 PKTFTCPRCGHE   31 (104)
T ss_pred             CceEecCccCCe
Confidence            456888888753


No 237
>COG1656 Uncharacterized conserved protein [Function unknown]
Probab=42.07  E-value=9.5  Score=19.64  Aligned_cols=39  Identities=18%  Similarity=0.471  Sum_probs=19.5

Q ss_pred             eecccccccccch--hhHHHhHh--hhcCCcCceeCChhhHhh
Q psy12265         20 YGCEVCGRHFRQW--GDLKYHKA--SLHSDVKAFQCEYCGKDF   58 (71)
Q Consensus        20 ~~c~~c~~~~~~~--~~l~~h~~--~~~~~~~~~~C~~c~~~f   58 (71)
                      -.|+.|+......  .....-..  ..-..+.-+.|+.||+.|
T Consensus        98 ~RCp~CN~~L~~vs~eev~~~Vp~~~~~~~~~f~~C~~CgkiY  140 (165)
T COG1656          98 SRCPECNGELEKVSREEVKEKVPEKVYRNYEEFYRCPKCGKIY  140 (165)
T ss_pred             ccCcccCCEeccCcHHHHhhccchhhhhcccceeECCCCcccc
Confidence            4788998754322  22111100  001112346799999865


No 238
>PRK01343 zinc-binding protein; Provisional
Probab=41.75  E-value=7.6  Score=16.32  Aligned_cols=12  Identities=33%  Similarity=0.664  Sum_probs=8.3

Q ss_pred             ceeCChhhHhhh
Q psy12265         48 AFQCEYCGKDFA   59 (71)
Q Consensus        48 ~~~C~~c~~~f~   59 (71)
                      ...|+.|++.+.
T Consensus         9 ~~~CP~C~k~~~   20 (57)
T PRK01343          9 TRPCPECGKPST   20 (57)
T ss_pred             CCcCCCCCCcCc
Confidence            456888887654


No 239
>COG5152 Uncharacterized conserved protein, contains RING and CCCH-type Zn-fingers [General function prediction only]
Probab=41.61  E-value=15  Score=19.72  Aligned_cols=16  Identities=31%  Similarity=0.719  Sum_probs=11.4

Q ss_pred             cCceeCChhhHhhhch
Q psy12265         46 VKAFQCEYCGKDFARK   61 (71)
Q Consensus        46 ~~~~~C~~c~~~f~~~   61 (71)
                      ..||.|.+|.+.|..+
T Consensus       194 ~IPF~C~iCKkdy~sp  209 (259)
T COG5152         194 KIPFLCGICKKDYESP  209 (259)
T ss_pred             CCceeehhchhhccch
Confidence            4688898887766554


No 240
>PRK11032 hypothetical protein; Provisional
Probab=41.13  E-value=9  Score=19.60  Aligned_cols=28  Identities=32%  Similarity=0.666  Sum_probs=17.0

Q ss_pred             ceecccccccccchhhHHHhHhhhcCCcCceeCChhhHh
Q psy12265         19 PYGCEVCGRHFRQWGDLKYHKASLHSDVKAFQCEYCGKD   57 (71)
Q Consensus        19 ~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~C~~c~~~   57 (71)
                      ..+|..|+....        .  .+++. .-.|+.|+..
T Consensus       124 ~LvC~~Cg~~~~--------~--~~p~~-i~pCp~C~~~  151 (160)
T PRK11032        124 NLVCEKCHHHLA--------F--YTPEV-LPLCPKCGHD  151 (160)
T ss_pred             eEEecCCCCEEE--------e--cCCCc-CCCCCCCCCC
Confidence            488999985532        1  23333 3379999854


No 241
>PF14369 zf-RING_3:  zinc-finger
Probab=40.60  E-value=14  Score=13.73  Aligned_cols=10  Identities=30%  Similarity=0.740  Sum_probs=8.2

Q ss_pred             eccccccccc
Q psy12265         21 GCEVCGRHFR   30 (71)
Q Consensus        21 ~c~~c~~~~~   30 (71)
                      .|+.|+..|.
T Consensus        23 ~CP~C~~gFv   32 (35)
T PF14369_consen   23 ACPRCHGGFV   32 (35)
T ss_pred             CCcCCCCcEe
Confidence            5999998875


No 242
>KOG4124|consensus
Probab=40.35  E-value=7.2  Score=22.66  Aligned_cols=51  Identities=33%  Similarity=0.695  Sum_probs=31.9

Q ss_pred             CCceeccc--ccccccchhhHHHhHhhh--------------c----CCcCceeCChhhHhhhchHHHHHh
Q psy12265         17 LKPYGCEV--CGRHFRQWGDLKYHKASL--------------H----SDVKAFQCEYCGKDFARKYQAHSY   67 (71)
Q Consensus        17 ~~~~~c~~--c~~~~~~~~~l~~h~~~~--------------~----~~~~~~~C~~c~~~f~~~~~l~~h   67 (71)
                      .+++.|..  |.+.+.....+..|....              |    ..-++|+|++|-+.......|..|
T Consensus       347 ~~~~~~~vp~~~~~~~n~ng~~~~~~~~h~s~i~~~s~~~~ph~~~~~~nk~~r~~i~~~~~k~~~~l~~~  417 (442)
T KOG4124|consen  347 DKPYKCPVPNCDKAYKNQNGLKYHKLHGHCSPITTPTPAPIPHQGFVVENKPYRCEVCSKRYKNLNGLKYH  417 (442)
T ss_pred             cCCCCCCCCcchhhcccCcceeeccccCcCCCCCCCCCCCCCcceeeeccCcccChhhhhhhccCCCCCce
Confidence            36777753  777777666665554311              1    123678999998887766555544


No 243
>COG4896 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=39.33  E-value=37  Score=14.57  Aligned_cols=9  Identities=22%  Similarity=0.899  Sum_probs=4.6

Q ss_pred             ceeCChhhH
Q psy12265         48 AFQCEYCGK   56 (71)
Q Consensus        48 ~~~C~~c~~   56 (71)
                      .|-|+.|..
T Consensus        31 tymC~eC~~   39 (68)
T COG4896          31 TYMCPECEH   39 (68)
T ss_pred             eEechhhHh
Confidence            455555543


No 244
>PF06524 NOA36:  NOA36 protein;  InterPro: IPR010531 This family consists of several NOA36 proteins which contain 29 highly conserved cysteine residues. The function of this protein is unknown.; GO: 0008270 zinc ion binding, 0005634 nucleus
Probab=39.32  E-value=21  Score=20.03  Aligned_cols=16  Identities=25%  Similarity=0.582  Sum_probs=8.4

Q ss_pred             CceeCChhhHhhhchH
Q psy12265         47 KAFQCEYCGKDFARKY   62 (71)
Q Consensus        47 ~~~~C~~c~~~f~~~~   62 (71)
                      ++++|+.|+.....-.
T Consensus       208 k~~PCPKCg~et~eTk  223 (314)
T PF06524_consen  208 KPIPCPKCGYETQETK  223 (314)
T ss_pred             CCCCCCCCCCcccccc
Confidence            4556666665544333


No 245
>COG1781 PyrI Aspartate carbamoyltransferase, regulatory subunit [Nucleotide transport and metabolism]
Probab=39.23  E-value=7.1  Score=19.79  Aligned_cols=15  Identities=40%  Similarity=1.034  Sum_probs=11.6

Q ss_pred             ceeCChhhHhhhchH
Q psy12265         48 AFQCEYCGKDFARKY   62 (71)
Q Consensus        48 ~~~C~~c~~~f~~~~   62 (71)
                      .++|.+|++.|+...
T Consensus       135 ~lrC~YCe~~~~~~~  149 (153)
T COG1781         135 ALRCKYCEKTFSEDE  149 (153)
T ss_pred             EEEEEecCcEechhh
Confidence            489999998887543


No 246
>PRK04351 hypothetical protein; Provisional
Probab=39.14  E-value=16  Score=18.44  Aligned_cols=31  Identities=23%  Similarity=0.821  Sum_probs=17.2

Q ss_pred             eecccccccccchhhHHHhHhhhcCCcCceeCChhhHhhh
Q psy12265         20 YGCEVCGRHFRQWGDLKYHKASLHSDVKAFQCEYCGKDFA   59 (71)
Q Consensus        20 ~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~C~~c~~~f~   59 (71)
                      |.|..|+..+..      +.+  + ....|.|..|+-.+.
T Consensus       113 Y~C~~Cg~~~~r------~Rr--~-n~~~yrCg~C~g~L~  143 (149)
T PRK04351        113 YECQSCGQQYLR------KRR--I-NTKRYRCGKCRGKLK  143 (149)
T ss_pred             EECCCCCCEeee------eee--c-CCCcEEeCCCCcEee
Confidence            777777755432      111  2 235578888875443


No 247
>KOG3497|consensus
Probab=39.05  E-value=11  Score=16.07  Aligned_cols=14  Identities=36%  Similarity=0.745  Sum_probs=7.9

Q ss_pred             ceeCChhhHhhhch
Q psy12265         48 AFQCEYCGKDFARK   61 (71)
Q Consensus        48 ~~~C~~c~~~f~~~   61 (71)
                      |.+|-.||+....+
T Consensus         4 PiRCFtCGKvig~K   17 (69)
T KOG3497|consen    4 PIRCFTCGKVIGDK   17 (69)
T ss_pred             eeEeeecccccccc
Confidence            45666666655443


No 248
>COG1644 RPB10 DNA-directed RNA polymerase, subunit N (RpoN/RPB10) [Transcription]
Probab=38.45  E-value=12  Score=16.05  Aligned_cols=13  Identities=31%  Similarity=0.720  Sum_probs=7.8

Q ss_pred             ceeCChhhHhhhc
Q psy12265         48 AFQCEYCGKDFAR   60 (71)
Q Consensus        48 ~~~C~~c~~~f~~   60 (71)
                      |.+|-.||+....
T Consensus         4 PiRCFsCGkvi~~   16 (63)
T COG1644           4 PVRCFSCGKVIGH   16 (63)
T ss_pred             ceEeecCCCCHHH
Confidence            5567667765443


No 249
>COG3880 Modulator of heat shock repressor CtsR, McsA [Signal transduction    mechanisms]
Probab=38.44  E-value=14  Score=19.16  Aligned_cols=32  Identities=31%  Similarity=0.829  Sum_probs=19.2

Q ss_pred             ceecccccccccchhhHHHhHhhhcCCcCceeCChhhHhhhch
Q psy12265         19 PYGCEVCGRHFRQWGDLKYHKASLHSDVKAFQCEYCGKDFARK   61 (71)
Q Consensus        19 ~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~C~~c~~~f~~~   61 (71)
                      ...|..|+.+|...         .+  ...|-|..|.++|...
T Consensus        74 ~l~C~~C~~Tfk~f---------~~--~g~fGCaeCY~tf~~~  105 (176)
T COG3880          74 LLGCHNCGMTFKEF---------IQ--SGLFGCAECYKTFESQ  105 (176)
T ss_pred             HhcCccccccHHHH---------HH--hcccchHHHHHHHHHH
Confidence            46777787666421         11  2246788888877654


No 250
>PF01780 Ribosomal_L37ae:  Ribosomal L37ae protein family;  InterPro: IPR002674 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms. The codons of the mRNA are exposed on the ribosome to allow tRNA binding. This leads to the incorporation of amino acids into the growing polypeptide chain in accordance with the genetic information. Incoming amino acid monomers enter the ribosomal A site in the form of aminoacyl-tRNAs complexed with elongation factor Tu (EF-Tu) and GTP. The growing polypeptide chain, situated in the P site as peptidyl-tRNA, is then transferred to aminoacyl-tRNA and the new peptidyl-tRNA, extended by one residue, is translocated to the P site with the aid the elongation factor G (EF-G) and GTP as the deacylated tRNA is released from the ribosome through one or more exit sites [, ]. About 2/3 of the mass of the ribosome consists of RNA and 1/3 of protein. The proteins are named in accordance with the subunit of the ribosome which they belong to - the small (S1 to S31) and the large (L1 to L44). Usually they decorate the rRNA cores of the subunits.  Many ribosomal proteins, particularly those of the large subunit, are composed of a globular, surfaced-exposed domain with long finger-like projections that extend into the rRNA core to stabilise its structure. Most of the proteins interact with multiple RNA elements, often from different domains. In the large subunit, about 1/3 of the 23S rRNA nucleotides are at least in van der Waal's contact with protein, and L22 interacts with all six domains of the 23S rRNA. Proteins S4 and S7, which initiate assembly of the 16S rRNA, are located at junctions of five and four RNA helices, respectively. In this way proteins serve to organise and stabilise the rRNA tertiary structure. While the crucial activities of decoding and peptide transfer are RNA based, proteins play an active role in functions that may have evolved to streamline the process of protein synthesis. In addition to their function in the ribosome, many ribosomal proteins have some function 'outside' the ribosome [, ]. This ribosomal protein is found in archaebacteria and eukaryotes []. Ribosomal protein L37 has a single zinc finger-like motif of the C2-C2 type [].; GO: 0003735 structural constituent of ribosome, 0006412 translation, 0005622 intracellular, 0005840 ribosome; PDB: 4A1E_Y 4A17_Y 4A1C_Y 4A1A_Y 3O58_g 3IZS_m 3O5H_g 1S1I_9 3IZR_m 1YSH_D ....
Probab=38.41  E-value=6.2  Score=18.18  Aligned_cols=31  Identities=32%  Similarity=0.882  Sum_probs=19.5

Q ss_pred             CceecccccccccchhhHHHhHhhhcCCcCceeCChhhHhhh
Q psy12265         18 KPYGCEVCGRHFRQWGDLKYHKASLHSDVKAFQCEYCGKDFA   59 (71)
Q Consensus        18 ~~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~C~~c~~~f~   59 (71)
                      ..|.|+.|++.-..        + ..+|  -|.|..|++.|+
T Consensus        34 ~ky~Cp~Cgk~~vk--------R-~a~G--IW~C~~C~~~~A   64 (90)
T PF01780_consen   34 AKYTCPFCGKTSVK--------R-VATG--IWKCKKCGKKFA   64 (90)
T ss_dssp             S-BEESSSSSSEEE--------E-EETT--EEEETTTTEEEE
T ss_pred             CCCcCCCCCCceeE--------E-eeeE--EeecCCCCCEEe
Confidence            57999999865211        1 2333  479999987665


No 251
>PF03884 DUF329:  Domain of unknown function (DUF329);  InterPro: IPR005584 The biological function of these short proteins is unknown, but they contain four conserved cysteines, suggesting that they all bind zinc. YacG (Q5X8H6 from SWISSPROT) from Escherichia coli has been shown to bind zinc and contains the structural motifs typical of zinc-binding proteins []. The conserved four cysteine motif in these proteins (-C-X(2)-C-X(15)-C-X(3)-C-) is not found in other zinc-binding proteins with known structures.; GO: 0008270 zinc ion binding; PDB: 1LV3_A.
Probab=38.22  E-value=16  Score=15.34  Aligned_cols=12  Identities=33%  Similarity=0.861  Sum_probs=5.5

Q ss_pred             eeCChhhHhhhc
Q psy12265         49 FQCEYCGKDFAR   60 (71)
Q Consensus        49 ~~C~~c~~~f~~   60 (71)
                      ..|+.|++.+..
T Consensus         3 v~CP~C~k~~~~   14 (57)
T PF03884_consen    3 VKCPICGKPVEW   14 (57)
T ss_dssp             EE-TTT--EEE-
T ss_pred             ccCCCCCCeecc
Confidence            578888876543


No 252
>PF04438 zf-HIT:  HIT zinc finger;  InterPro: IPR007529 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents the HIT-type zinc finger, which contains 7 conserved cysteines and one histidine that can potentially coordinate two zinc atoms. It has been named after the first protein that originally defined the domain: the yeast HIT1 protein (P46973 from SWISSPROT) []. The HIT-type zinc finger displays some sequence similarities to the MYND-type zinc finger. The function of this domain is unknown but it is mainly found in nuclear proteins involved in gene regulation and chromatin remodeling. This domain is also found in the thyroid receptor interacting protein 3 (TRIP-3) Q15649 from SWISSPROT, that specifically interacts with the ligand binding domain of the thyroid receptor. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 2YQP_A 2YQQ_A 1X4S_A.
Probab=38.20  E-value=11  Score=13.46  Aligned_cols=11  Identities=27%  Similarity=1.147  Sum_probs=4.8

Q ss_pred             ceeCChhhHhh
Q psy12265         48 AFQCEYCGKDF   58 (71)
Q Consensus        48 ~~~C~~c~~~f   58 (71)
                      .|.|+.|+..+
T Consensus        13 kY~Cp~C~~~~   23 (30)
T PF04438_consen   13 KYRCPRCGARY   23 (30)
T ss_dssp             SEE-TTT--EE
T ss_pred             EEECCCcCCce
Confidence            46777776543


No 253
>PF13453 zf-TFIIB:  Transcription factor zinc-finger
Probab=37.79  E-value=30  Score=13.05  Aligned_cols=21  Identities=24%  Similarity=0.408  Sum_probs=15.6

Q ss_pred             CceecccccccccchhhHHHh
Q psy12265         18 KPYGCEVCGRHFRQWGDLKYH   38 (71)
Q Consensus        18 ~~~~c~~c~~~~~~~~~l~~h   38 (71)
                      ....|..|+..+.....+..-
T Consensus        18 ~id~C~~C~G~W~d~~el~~~   38 (41)
T PF13453_consen   18 EIDVCPSCGGIWFDAGELEKL   38 (41)
T ss_pred             EEEECCCCCeEEccHHHHHHH
Confidence            347899999888877776653


No 254
>PF10164 DUF2367:  Uncharacterized conserved protein (DUF2367);  InterPro: IPR019317  This is a highly conserved set of proteins which contains three pairs of cysteine residues within a length of 42 amino acids and is rich in proline residues towards the N terminus. It includes a membrane protein that has been found to be highly expressed in the mouse brain and consequently, several members have been assigned as brain protein i3 (Bri3). Their function is unknown.
Probab=36.92  E-value=11  Score=17.64  Aligned_cols=12  Identities=33%  Similarity=0.999  Sum_probs=7.7

Q ss_pred             CceeCChhhHhh
Q psy12265         47 KAFQCEYCGKDF   58 (71)
Q Consensus        47 ~~~~C~~c~~~f   58 (71)
                      +..+|..||..|
T Consensus        87 r~~rC~nCG~~f   98 (98)
T PF10164_consen   87 RERRCSNCGATF   98 (98)
T ss_pred             CccccCCCCccC
Confidence            345777787654


No 255
>PF05864 Chordopox_RPO7:  Chordopoxvirus DNA-directed RNA polymerase 7 kDa polypeptide (RPO7);  InterPro: IPR008448 DNA-directed RNA polymerases 2.7.7.6 from EC (also known as DNA-dependent RNA polymerases) are responsible for the polymerisation of ribonucleotides into a sequence complementary to the template DNA. In eukaryotes, there are three different forms of DNA-directed RNA polymerases transcribing different sets of genes. Most RNA polymerases are multimeric enzymes and are composed of a variable number of subunits. The core RNA polymerase complex consists of five subunits (two alpha, one beta, one beta-prime and one omega) and is sufficient for transcription elongation and termination but is unable to initiate transcription. Transcription initiation from promoter elements requires a sixth, dissociable subunit called a sigma factor, which reversibly associates with the core RNA polymerase complex to form a holoenzyme []. The core RNA polymerase complex forms a "crab claw"-like structure with an internal channel running along the full length []. The key functional sites of the enzyme, as defined by mutational and cross-linking analysis, are located on the inner wall of this channel. RNA synthesis follows after the attachment of RNA polymerase to a specific site, the promoter, on the template DNA strand. The RNA synthesis process continues until a termination sequence is reached. The RNA product, which is synthesised in the 5' to 3'direction, is known as the primary transcript. Eukaryotic nuclei contain three distinct types of RNA polymerases that differ in the RNA they synthesise:  RNA polymerase I: located in the nucleoli, synthesises precursors of most ribosomal RNAs. RNA polymerase II: occurs in the nucleoplasm, synthesises mRNA precursors.  RNA polymerase III: also occurs in the nucleoplasm, synthesises the precursors of 5S ribosomal RNA, the tRNAs, and a variety of other small nuclear and cytosolic RNAs.   Eukaryotic cells are also known to contain separate mitochondrial and chloroplast RNA polymerases. Eukaryotic RNA polymerases, whose molecular masses vary in size from 500 to 700 kDa, contain two non-identical large (>100 kDa) subunits and an array of up to 12 different small (less than 50 kDa) subunits. This family consists of several Chordopoxvirus DNA-directed RNA polymerase 7 kDa polypeptide sequences. DNA-dependent RNA polymerase catalyses the transcription of DNA into RNA [].; GO: 0003677 DNA binding, 0003899 DNA-directed RNA polymerase activity, 0006351 transcription, DNA-dependent
Probab=36.83  E-value=14  Score=15.54  Aligned_cols=11  Identities=36%  Similarity=1.129  Sum_probs=6.5

Q ss_pred             eCChhhHhhhc
Q psy12265         50 QCEYCGKDFAR   60 (71)
Q Consensus        50 ~C~~c~~~f~~   60 (71)
                      .|..||+..+.
T Consensus         6 vCSTCGrDlSe   16 (63)
T PF05864_consen    6 VCSTCGRDLSE   16 (63)
T ss_pred             eecccCCcchH
Confidence            46666665543


No 256
>PF14149 YhfH:  YhfH-like protein
Probab=36.03  E-value=21  Score=13.61  Aligned_cols=11  Identities=36%  Similarity=1.078  Sum_probs=7.7

Q ss_pred             eCChhhHhhhc
Q psy12265         50 QCEYCGKDFAR   60 (71)
Q Consensus        50 ~C~~c~~~f~~   60 (71)
                      .|..||+.+..
T Consensus        15 ~C~~CG~~i~E   25 (37)
T PF14149_consen   15 KCTECGKEIEE   25 (37)
T ss_pred             ccHHHHHHHHH
Confidence            68888876543


No 257
>PF07649 C1_3:  C1-like domain;  InterPro: IPR011424 This short domain is rich in cysteines and histidines. The pattern of conservation is similar to that found in IPR002219 from INTERPRO. C1 domains are protein kinase C-like zinc finger structures. Diacylglycerol (DAG) kinases (DGKs) have a two or three commonly conserved cysteine-rich C1 domains []. DGKs modulate the balance between the two signaling lipids, DAG and phosphatidic acid (PA), by phosphorylating DAG to yield PA []. The PKD (protein kinase D) family are novel DAG receptors. They have twin C1 domains, designated C1a and C1b, which bind DAG or phorbol esters. Individual C1 domains differ in ligand-binding activity and selectivity []. ; GO: 0047134 protein-disulfide reductase activity, 0055114 oxidation-reduction process; PDB: 1V5N_A.
Probab=35.57  E-value=18  Score=12.55  Aligned_cols=12  Identities=25%  Similarity=0.542  Sum_probs=4.8

Q ss_pred             cCceeCChhhHh
Q psy12265         46 VKAFQCEYCGKD   57 (71)
Q Consensus        46 ~~~~~C~~c~~~   57 (71)
                      ...|.|..|...
T Consensus        13 ~~~Y~C~~Cdf~   24 (30)
T PF07649_consen   13 GWFYRCSECDFD   24 (30)
T ss_dssp             --EEE-TTT---
T ss_pred             CceEECccCCCc
Confidence            356788888654


No 258
>PF14311 DUF4379:  Domain of unknown function (DUF4379)
Probab=35.25  E-value=13  Score=15.02  Aligned_cols=13  Identities=23%  Similarity=0.976  Sum_probs=8.7

Q ss_pred             eeCChhhHhhhch
Q psy12265         49 FQCEYCGKDFARK   61 (71)
Q Consensus        49 ~~C~~c~~~f~~~   61 (71)
                      ++|+.||..+...
T Consensus        29 W~C~~Cgh~w~~~   41 (55)
T PF14311_consen   29 WKCPKCGHEWKAS   41 (55)
T ss_pred             EECCCCCCeeEcc
Confidence            6788887665544


No 259
>PF02591 DUF164:  Putative zinc ribbon domain;  InterPro: IPR003743 This entry describes proteins of unknown function.
Probab=34.80  E-value=19  Score=14.61  Aligned_cols=33  Identities=18%  Similarity=0.434  Sum_probs=17.8

Q ss_pred             eecccccccccchhhHHHhHhhhcCCcCceeCChhhHh
Q psy12265         20 YGCEVCGRHFRQWGDLKYHKASLHSDVKAFQCEYCGKD   57 (71)
Q Consensus        20 ~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~C~~c~~~   57 (71)
                      -.|.-|.-..+. +.+ ..   ...++....|+.||+.
T Consensus        23 ~~C~gC~~~l~~-~~~-~~---i~~~~~i~~Cp~CgRi   55 (56)
T PF02591_consen   23 GTCSGCHMELPP-QEL-NE---IRKGDEIVFCPNCGRI   55 (56)
T ss_pred             CccCCCCEEcCH-HHH-HH---HHcCCCeEECcCCCcc
Confidence            356666544332 222 22   2333667789999863


No 260
>PF14446 Prok-RING_1:  Prokaryotic RING finger family 1
Probab=34.75  E-value=5.7  Score=16.48  Aligned_cols=9  Identities=56%  Similarity=1.486  Sum_probs=4.2

Q ss_pred             eCChhhHhh
Q psy12265         50 QCEYCGKDF   58 (71)
Q Consensus        50 ~C~~c~~~f   58 (71)
                      +|..|+..|
T Consensus         7 ~C~~Cg~~~   15 (54)
T PF14446_consen    7 KCPVCGKKF   15 (54)
T ss_pred             cChhhCCcc
Confidence            344444444


No 261
>COG5109 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only]
Probab=34.57  E-value=16  Score=21.08  Aligned_cols=18  Identities=28%  Similarity=0.643  Sum_probs=13.1

Q ss_pred             hcCCcCceeCChhhHhhh
Q psy12265         42 LHSDVKAFQCEYCGKDFA   59 (71)
Q Consensus        42 ~~~~~~~~~C~~c~~~f~   59 (71)
                      ...|...|+|++|+..-.
T Consensus       370 S~nG~~~FKCPYCP~~~~  387 (396)
T COG5109         370 SQNGVLSFKCPYCPEMSK  387 (396)
T ss_pred             hhcCcEEeeCCCCCcchh
Confidence            355677999999985433


No 262
>PF08792 A2L_zn_ribbon:  A2L zinc ribbon domain;  InterPro: IPR014900 This zinc ribbon protein is found associated with some viral A2L transcription factors []. 
Probab=34.13  E-value=23  Score=12.94  Aligned_cols=11  Identities=36%  Similarity=0.742  Sum_probs=7.3

Q ss_pred             ceecccccccc
Q psy12265         19 PYGCEVCGRHF   29 (71)
Q Consensus        19 ~~~c~~c~~~~   29 (71)
                      -+.|..|+..|
T Consensus        21 ~~~C~~Cg~~~   31 (33)
T PF08792_consen   21 YEVCIFCGSSF   31 (33)
T ss_pred             eEEcccCCcEe
Confidence            46777777655


No 263
>TIGR03826 YvyF flagellar operon protein TIGR03826. This gene is found in flagellar operons of Bacillus-related organisms. Its function has not been determined and an official gene symbol has not been assigned, although the gene is designated yvyF in B. subtilus. A tentative assignment as a regulator is suggested in the NCBI record GI:16080597.
Probab=34.09  E-value=17  Score=18.14  Aligned_cols=11  Identities=36%  Similarity=1.096  Sum_probs=8.2

Q ss_pred             eCChhhHhhhc
Q psy12265         50 QCEYCGKDFAR   60 (71)
Q Consensus        50 ~C~~c~~~f~~   60 (71)
                      .|+.||+.|..
T Consensus         5 nC~~CgklF~~   15 (137)
T TIGR03826         5 NCPKCGRLFVK   15 (137)
T ss_pred             cccccchhhhh
Confidence            57888887765


No 264
>KOG2817|consensus
Probab=34.05  E-value=37  Score=20.15  Aligned_cols=29  Identities=24%  Similarity=0.597  Sum_probs=17.5

Q ss_pred             ccccccchhhHHHhHhhhcCCcCceeCChhhHh
Q psy12265         25 CGRHFRQWGDLKYHKASLHSDVKAFQCEYCGKD   57 (71)
Q Consensus        25 c~~~~~~~~~l~~h~~~~~~~~~~~~C~~c~~~   57 (71)
                      ||.. .++.++.+  . ...|...|+||+|+..
T Consensus       355 CGHV-ISkdAlnr--L-S~ng~~sfKCPYCP~e  383 (394)
T KOG2817|consen  355 CGHV-ISKDALNR--L-SKNGSQSFKCPYCPVE  383 (394)
T ss_pred             ccce-ecHHHHHH--H-hhCCCeeeeCCCCCcc
Confidence            5443 33455443  2 3556668999999854


No 265
>TIGR03831 YgiT_finger YgiT-type zinc finger domain. This domain model describes a small domain with two copies of a putative zinc-binding motif CXXC (usually CXXCG). Most member proteins consist largely of this domain or else carry an additional C-terminal helix-turn-helix domain, resembling that of the phage protein Cro and modeled by pfam01381.
Probab=33.84  E-value=20  Score=13.50  Aligned_cols=11  Identities=27%  Similarity=0.848  Sum_probs=7.9

Q ss_pred             eeccccccccc
Q psy12265         20 YGCEVCGRHFR   30 (71)
Q Consensus        20 ~~c~~c~~~~~   30 (71)
                      +.|+.|+..+-
T Consensus        33 ~~C~~CGE~~~   43 (46)
T TIGR03831        33 LVCPQCGEEYL   43 (46)
T ss_pred             cccccCCCEee
Confidence            67888886653


No 266
>TIGR00240 ATCase_reg aspartate carbamoyltransferase, regulatory subunit. The presence of this regulatory subunit allows feedback inhibition by CTP on aspartate carbamoyltransferase, the first step in the synthesis of CTP from aspartate. In many species, this regulatory subunit is not present. In Thermotoga maritima, the catalytic and regulatory subunits are encoded by a fused gene and the regulatory region has enough sequence differences to score below the trusted cutoff.
Probab=33.49  E-value=8.5  Score=19.49  Aligned_cols=13  Identities=38%  Similarity=1.043  Sum_probs=10.7

Q ss_pred             ceeCChhhHhhhc
Q psy12265         48 AFQCEYCGKDFAR   60 (71)
Q Consensus        48 ~~~C~~c~~~f~~   60 (71)
                      .|+|.+|++.|..
T Consensus       132 ~lrC~YCe~~~~~  144 (150)
T TIGR00240       132 ALRCYYCEKEIEH  144 (150)
T ss_pred             EEEEECCCCEEec
Confidence            5999999988753


No 267
>PF05876 Terminase_GpA:  Phage terminase large subunit (GpA);  InterPro: IPR008866 This entry is represented by Bacteriophage lambda, GpA. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches. This entry consists of several phage terminase large subunit proteins as well as related sequences from several bacterial species. The DNA packaging enzyme of bacteriophage lambda, terminase, is a heteromultimer composed of a small subunit, gpNu1, and a large subunit, gpA, products of the Nu1 and A genes, respectively. Terminase is involved in the site-specific binding and cutting of the DNA in the initial stages of packaging. It is now known that gpA is actively involved in late stages of packaging, including DNA translocation, and that this enzyme contains separate functional domains for its early and late packaging activities [].
Probab=33.00  E-value=15  Score=22.58  Aligned_cols=40  Identities=23%  Similarity=0.516  Sum_probs=22.3

Q ss_pred             eecccccccccch-hhHHHhHhhhcCCcCceeCChhhHhhhc
Q psy12265         20 YGCEVCGRHFRQW-GDLKYHKASLHSDVKAFQCEYCGKDFAR   60 (71)
Q Consensus        20 ~~c~~c~~~~~~~-~~l~~h~~~~~~~~~~~~C~~c~~~f~~   60 (71)
                      ..|+.|+..+... ..+..... .....-.|.|+.||.....
T Consensus       201 vpCPhCg~~~~l~~~~l~w~~~-~~~~~a~y~C~~Cg~~i~e  241 (557)
T PF05876_consen  201 VPCPHCGEEQVLEWENLKWDKG-EAPETARYVCPHCGCEIEE  241 (557)
T ss_pred             ccCCCCCCCccccccceeecCC-CCccceEEECCCCcCCCCH
Confidence            5889999776543 22221100 0112334899999876554


No 268
>PF06220 zf-U1:  U1 zinc finger;  InterPro: IPR013085 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  C2H2-type (classical) zinc fingers (Znf) were the first class to be characterised. They contain a short beta hairpin and an alpha helix (beta/beta/alpha structure), where a single zinc atom is held in place by Cys(2)His(2) (C2H2) residues in a tetrahedral array. C2H2 Znf's can be divided into three groups based on the number and pattern of fingers: triple-C2H2 (binds single ligand), multiple-adjacent-C2H2 (binds multiple ligands), and separated paired-C2H2 []. C2H2 Znf's are the most common DNA-binding motifs found in eukaryotic transcription factors, and have also been identified in prokaryotes []. Transcription factors usually contain several Znf's (each with a conserved beta/beta/alpha structure) capable of making multiple contacts along the DNA, where the C2H2 Znf motifs recognise DNA sequences by binding to the major groove of DNA via a short alpha-helix in the Znf, the Znf spanning 3-4 bases of the DNA []. C2H2 Znf's can also bind to RNA and protein targets []. This entry represents a C2H2-type zinc finger motif found in several U1 small nuclear ribonucleoprotein C (U1-C) proteins. Some proteins contain multiple copies of this motif. The U1 small nuclear ribonucleoprotein (U1 snRNP) binds to the pre-mRNA 5' splice site at early stages of spliceosome assembly. Recruitment of U1 to a class of weak 5' splice site is promoted by binding of the protein TIA-1 to uridine-rich sequences immediately downstream from the 5' splice site. Binding of TIA-1 in the vicinity of a 5' splice site helps to stabilise U1 snRNP recruitment, at least in part, via a direct interaction with U1-C, thus providing one molecular mechanism for the function of this splicing regulator []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 2VRD_A.
Probab=32.76  E-value=37  Score=12.78  Aligned_cols=10  Identities=30%  Similarity=0.992  Sum_probs=2.9

Q ss_pred             eecccccccc
Q psy12265         20 YGCEVCGRHF   29 (71)
Q Consensus        20 ~~c~~c~~~~   29 (71)
                      |-|..|...+
T Consensus         4 yyCdyC~~~~   13 (38)
T PF06220_consen    4 YYCDYCKKYL   13 (38)
T ss_dssp             -B-TTT--B-
T ss_pred             eeccccccee
Confidence            5566665555


No 269
>TIGR00595 priA primosomal protein N'. All proteins in this family for which functions are known are components of the primosome which is involved in replication, repair, and recombination.This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=32.58  E-value=27  Score=21.22  Aligned_cols=10  Identities=30%  Similarity=0.746  Sum_probs=6.3

Q ss_pred             CceeCChhhH
Q psy12265         47 KAFQCEYCGK   56 (71)
Q Consensus        47 ~~~~C~~c~~   56 (71)
                      .|..|+.|+.
T Consensus       252 ~~~~Cp~C~s  261 (505)
T TIGR00595       252 IPKTCPQCGS  261 (505)
T ss_pred             CCCCCCCCCC
Confidence            3566777764


No 270
>PF03119 DNA_ligase_ZBD:  NAD-dependent DNA ligase C4 zinc finger domain;  InterPro: IPR004149 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents the zinc finger domain found in NAD-dependent DNA ligases. DNA ligases catalyse the crucial step of joining the breaks in duplex DNA during DNA replication, repair and recombination, utilizing either ATP or NAD(+) as a cofactor []. This domain is a small zinc binding motif that is presumably DNA binding. It is found only in NAD-dependent DNA ligases. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003911 DNA ligase (NAD+) activity, 0006260 DNA replication, 0006281 DNA repair; PDB: 1DGS_A 1V9P_B 2OWO_A.
Probab=32.49  E-value=19  Score=12.59  Aligned_cols=9  Identities=33%  Similarity=1.132  Sum_probs=3.5

Q ss_pred             eCChhhHhh
Q psy12265         50 QCEYCGKDF   58 (71)
Q Consensus        50 ~C~~c~~~f   58 (71)
                      .|+.|+...
T Consensus         1 ~CP~C~s~l    9 (28)
T PF03119_consen    1 TCPVCGSKL    9 (28)
T ss_dssp             B-TTT--BE
T ss_pred             CcCCCCCEe
Confidence            377777543


No 271
>PRK14873 primosome assembly protein PriA; Provisional
Probab=31.98  E-value=36  Score=21.63  Aligned_cols=10  Identities=30%  Similarity=1.052  Sum_probs=6.9

Q ss_pred             CceeCChhhH
Q psy12265         47 KAFQCEYCGK   56 (71)
Q Consensus        47 ~~~~C~~c~~   56 (71)
                      .++.|+.||.
T Consensus       421 ~p~~Cp~Cgs  430 (665)
T PRK14873        421 PDWRCPRCGS  430 (665)
T ss_pred             cCccCCCCcC
Confidence            4667888764


No 272
>PHA03082 DNA-dependent RNA polymerase subunit; Provisional
Probab=31.51  E-value=21  Score=15.07  Aligned_cols=11  Identities=36%  Similarity=1.129  Sum_probs=6.3

Q ss_pred             eCChhhHhhhc
Q psy12265         50 QCEYCGKDFAR   60 (71)
Q Consensus        50 ~C~~c~~~f~~   60 (71)
                      .|..||+..+.
T Consensus         6 VCsTCGrDlSe   16 (63)
T PHA03082          6 VCSTCGRDLSE   16 (63)
T ss_pred             eecccCcchhH
Confidence            46666665543


No 273
>PLN00032 DNA-directed RNA polymerase; Provisional
Probab=31.50  E-value=18  Score=15.96  Aligned_cols=13  Identities=31%  Similarity=0.713  Sum_probs=7.3

Q ss_pred             ceeCChhhHhhhc
Q psy12265         48 AFQCEYCGKDFAR   60 (71)
Q Consensus        48 ~~~C~~c~~~f~~   60 (71)
                      |.+|-.||+...+
T Consensus         4 PVRCFTCGkvig~   16 (71)
T PLN00032          4 PVRCFTCGKVIGN   16 (71)
T ss_pred             ceeecCCCCCcHH
Confidence            4566666665443


No 274
>PF14787 zf-CCHC_5:  GAG-polyprotein viral zinc-finger; PDB: 1CL4_A 1DSV_A.
Probab=31.38  E-value=9.5  Score=14.44  Aligned_cols=10  Identities=50%  Similarity=1.172  Sum_probs=5.3

Q ss_pred             eCChhhHhhh
Q psy12265         50 QCEYCGKDFA   59 (71)
Q Consensus        50 ~C~~c~~~f~   59 (71)
                      .|+.|++.|-
T Consensus         4 ~CprC~kg~H   13 (36)
T PF14787_consen    4 LCPRCGKGFH   13 (36)
T ss_dssp             C-TTTSSSCS
T ss_pred             cCcccCCCcc
Confidence            4666766554


No 275
>PRK00893 aspartate carbamoyltransferase regulatory subunit; Reviewed
Probab=31.34  E-value=11  Score=19.16  Aligned_cols=17  Identities=29%  Similarity=0.940  Sum_probs=12.5

Q ss_pred             CcCceeCChhhHhhhch
Q psy12265         45 DVKAFQCEYCGKDFARK   61 (71)
Q Consensus        45 ~~~~~~C~~c~~~f~~~   61 (71)
                      ....|+|.+|++.+...
T Consensus       131 ~~~~~rC~YCe~~~~~~  147 (152)
T PRK00893        131 EPIKLRCKYCEKEFSED  147 (152)
T ss_pred             CCCEEEeeCCCCEechh
Confidence            34468999999887643


No 276
>KOG4118|consensus
Probab=30.98  E-value=30  Score=15.03  Aligned_cols=26  Identities=23%  Similarity=0.316  Sum_probs=18.7

Q ss_pred             ceecccccccccchhhHHHhHhhhcC
Q psy12265         19 PYGCEVCGRHFRQWGDLKYHKASLHS   44 (71)
Q Consensus        19 ~~~c~~c~~~~~~~~~l~~h~~~~~~   44 (71)
                      .|.|..|......+..+..|....|+
T Consensus        38 ~~kCtVC~~~mpdpktfkqhfe~kHp   63 (74)
T KOG4118|consen   38 HHKCTVCMVQMPDPKTFKQHFENKHP   63 (74)
T ss_pred             HhhhHhhHhhCCCCchHHHHHhhcCC
Confidence            37898888777777777777654443


No 277
>PF09855 DUF2082:  Nucleic-acid-binding protein containing Zn-ribbon domain (DUF2082);  InterPro: IPR018652  This family of proteins contains various hypothetical prokaryotic proteins as well as some Zn-ribbon nucleic-acid-binding proteins.
Probab=30.86  E-value=16  Score=15.66  Aligned_cols=6  Identities=50%  Similarity=1.580  Sum_probs=2.6

Q ss_pred             eCChhh
Q psy12265         50 QCEYCG   55 (71)
Q Consensus        50 ~C~~c~   55 (71)
                      .|+.|+
T Consensus         2 ~C~KCg    7 (64)
T PF09855_consen    2 KCPKCG    7 (64)
T ss_pred             CCCCCC
Confidence            344443


No 278
>PF15135 UPF0515:  Uncharacterised protein UPF0515
Probab=30.63  E-value=72  Score=17.93  Aligned_cols=13  Identities=31%  Similarity=0.833  Sum_probs=10.2

Q ss_pred             eeCChhhHhhhch
Q psy12265         49 FQCEYCGKDFARK   61 (71)
Q Consensus        49 ~~C~~c~~~f~~~   61 (71)
                      |.|+.|+..|.--
T Consensus       156 f~C~~C~h~F~G~  168 (278)
T PF15135_consen  156 FHCPKCRHNFRGF  168 (278)
T ss_pred             eecccccccchhh
Confidence            7899998888644


No 279
>COG1579 Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only]
Probab=30.60  E-value=45  Score=18.41  Aligned_cols=15  Identities=27%  Similarity=0.691  Sum_probs=11.1

Q ss_pred             CcCceeCChhhHhhh
Q psy12265         45 DVKAFQCEYCGKDFA   59 (71)
Q Consensus        45 ~~~~~~C~~c~~~f~   59 (71)
                      +.....||+||+...
T Consensus       218 ~d~iv~CP~CgRILy  232 (239)
T COG1579         218 KDEIVFCPYCGRILY  232 (239)
T ss_pred             CCCCccCCccchHHH
Confidence            555678999998644


No 280
>smart00132 LIM Zinc-binding domain present in Lin-11, Isl-1, Mec-3. Zinc-binding domain family. Some LIM domains bind protein partners via tyrosine-containing motifs. LIM domains are found in many key regulators of developmental pathways.
Probab=30.04  E-value=12  Score=13.21  Aligned_cols=11  Identities=45%  Similarity=1.247  Sum_probs=7.0

Q ss_pred             ceeCChhhHhh
Q psy12265         48 AFQCEYCGKDF   58 (71)
Q Consensus        48 ~~~C~~c~~~f   58 (71)
                      -|.|..|+..+
T Consensus        27 Cf~C~~C~~~L   37 (39)
T smart00132       27 CFKCSKCGKPL   37 (39)
T ss_pred             CCCCcccCCcC
Confidence            36777776554


No 281
>PF07535 zf-DBF:  DBF zinc finger;  InterPro: IPR006572 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  In eukaryotes, initiation of DNA replication requires the assembly of pre-replication complexes (pre-RCs) on chromatin during the G1 phase. In the S phase, pre-RCs are activated by two protein kinases, Cdk2 and Cdc7, which results in the loading of replication factors and the unwinding of replication origins by the MCM helicase complex []. Cdc7 is a serine/threonine kinase that is conserved from yeast to human. It is regulated by its association with a regulatory subunit, the Dbf4 protein. This complex is often referred to as DDK (Dbf4-dependent kinase) []. DBF4 contains an N-terminal BRCT domain and a C-terminal conserved region that could potentially coordinate one zinc atom, the DBF4-type zinc finger. This entry represents the zinc finger, which is important for the interaction with Cdc7 [, ]. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003676 nucleic acid binding, 0008270 zinc ion binding
Probab=29.88  E-value=23  Score=14.34  Aligned_cols=12  Identities=42%  Similarity=0.830  Sum_probs=6.1

Q ss_pred             Cceecccccccc
Q psy12265         18 KPYGCEVCGRHF   29 (71)
Q Consensus        18 ~~~~c~~c~~~~   29 (71)
                      ++.-|..|...|
T Consensus         4 k~GYCE~C~~ky   15 (49)
T PF07535_consen    4 KPGYCENCRVKY   15 (49)
T ss_pred             CCccCccccchh
Confidence            344555555444


No 282
>PF14354 Lar_restr_allev:  Restriction alleviation protein Lar
Probab=29.79  E-value=22  Score=14.56  Aligned_cols=6  Identities=50%  Similarity=1.885  Sum_probs=3.1

Q ss_pred             eCChhh
Q psy12265         50 QCEYCG   55 (71)
Q Consensus        50 ~C~~c~   55 (71)
                      .|+.||
T Consensus         5 PCPFCG   10 (61)
T PF14354_consen    5 PCPFCG   10 (61)
T ss_pred             CCCCCC
Confidence            455554


No 283
>COG4957 Predicted transcriptional regulator [Transcription]
Probab=29.26  E-value=54  Score=16.53  Aligned_cols=22  Identities=32%  Similarity=0.418  Sum_probs=15.8

Q ss_pred             eecccccccccchhhHHHhHhhhcCC
Q psy12265         20 YGCEVCGRHFRQWGDLKYHKASLHSD   45 (71)
Q Consensus        20 ~~c~~c~~~~~~~~~l~~h~~~~~~~   45 (71)
                      ..|-++|+.|   .+|++|.. .|.+
T Consensus        77 IicLEDGkkf---KSLKRHL~-t~~g   98 (148)
T COG4957          77 IICLEDGKKF---KSLKRHLT-THYG   98 (148)
T ss_pred             EEEeccCcch---HHHHHHHh-cccC
Confidence            5788888887   56788876 5544


No 284
>PF09332 Mcm10:  Mcm10 replication factor;  InterPro: IPR015411 Mcm10 is a eukaryotic DNA replication factor that regulates the stability and chromatin association of DNA polymerase alpha []. ; PDB: 2KWQ_A.
Probab=29.25  E-value=32  Score=20.02  Aligned_cols=39  Identities=26%  Similarity=0.508  Sum_probs=14.2

Q ss_pred             ceecccccccccchhhH---HHhHhhhcCCc-CceeCChhhHh
Q psy12265         19 PYGCEVCGRHFRQWGDL---KYHKASLHSDV-KAFQCEYCGKD   57 (71)
Q Consensus        19 ~~~c~~c~~~~~~~~~l---~~h~~~~~~~~-~~~~C~~c~~~   57 (71)
                      .+.|.+|.+..-.....   ..|....+... +-|+|..|+..
T Consensus       252 av~C~~C~yt~~~~~~~C~~~~H~l~~~~a~KRFFkC~~C~~R  294 (344)
T PF09332_consen  252 AVTCKQCKYTAFKPSDRCKEEGHPLKWHDAVKRFFKCKDCGNR  294 (344)
T ss_dssp             EEEETTT--EESS--HHHHHTT--EEEEEEE-EEEE-T-TS-E
T ss_pred             EEEcCCCCCcccCcchhHHhcCCceEEeeeeeeeEECCCCCCe
Confidence            47888887654333322   12221111222 33678877754


No 285
>PRK12496 hypothetical protein; Provisional
Probab=29.24  E-value=20  Score=18.34  Aligned_cols=13  Identities=23%  Similarity=0.595  Sum_probs=9.7

Q ss_pred             ceeCChhhHhhhc
Q psy12265         48 AFQCEYCGKDFAR   60 (71)
Q Consensus        48 ~~~C~~c~~~f~~   60 (71)
                      .+.|.-|++.|..
T Consensus       127 ~~~C~gC~~~~~~  139 (164)
T PRK12496        127 RKVCKGCKKKYPE  139 (164)
T ss_pred             eEECCCCCccccC
Confidence            3678888888853


No 286
>PF01096 TFIIS_C:  Transcription factor S-II (TFIIS);  InterPro: IPR001222 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents a zinc finger motif found in transcription factor IIs (TFIIS). In eukaryotes the initiation of transcription of protein encoding genes by polymerase II (Pol II) is modulated by general and specific transcription factors. The general transcription factors operate through common promoters elements (such as the TATA box). At least eight different proteins associate to form the general transcription factors: TFIIA, -IIB, -IID, -IIE, -IIF, -IIG, -IIH and -IIS []. During mRNA elongation, Pol II can encounter DNA sequences that cause reverse movement of the enzyme. Such backtracking involves extrusion of the RNA 3'-end into the pore, and can lead to transcriptional arrest. Escape from arrest requires cleavage of the extruded RNA with the help of TFIIS, which induces mRNA cleavage by enhancing the intrinsic nuclease activity of RNA polymerase (Pol) II, past template-encoded pause sites []. TFIIS extends from the polymerase surface via a pore to the internal active site. Two essential and invariant acidic residues in a TFIIS loop complement the Pol II active site and could position a metal ion and a water molecule for hydrolytic RNA cleavage. TFIIS also induces extensive structural changes in Pol II that would realign nucleic acids in the active centre.  TFIIS is a protein of about 300 amino acids. It contains three regions: a variable N-terminal domain not required for TFIIS activity; a conserved central domain required for Pol II binding; and a conserved C-terminal C4-type zinc finger essential for RNA cleavage. The zinc finger folds in a conformation termed a zinc ribbon [] characterised by a three-stranded antiparallel beta-sheet and two beta-hairpins. A backbone model for Pol II-TFIIS complex was obtained from X-ray analysis. It shows that a beta hairpin protrudes from the zinc finger and complements the pol II active site [].  Some viral proteins also contain the TFIIS zinc ribbon C-terminal domain. The Vaccinia virus protein, unlike its eukaryotic homologue, is an integral RNA polymerase subunit rather than a readily separable transcription factor []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003676 nucleic acid binding, 0008270 zinc ion binding, 0006351 transcription, DNA-dependent; PDB: 3M4O_I 3S14_I 2E2J_I 4A3J_I 3HOZ_I 1TWA_I 3S1Q_I 3S1N_I 1TWG_I 3I4M_I ....
Probab=29.19  E-value=28  Score=13.11  Aligned_cols=10  Identities=40%  Similarity=1.122  Sum_probs=7.2

Q ss_pred             eecccccccc
Q psy12265         20 YGCEVCGRHF   29 (71)
Q Consensus        20 ~~c~~c~~~~   29 (71)
                      |.|..|+..+
T Consensus        29 y~C~~C~~~w   38 (39)
T PF01096_consen   29 YVCCNCGHRW   38 (39)
T ss_dssp             EEESSSTEEE
T ss_pred             EEeCCCCCee
Confidence            7888887654


No 287
>TIGR01053 LSD1 zinc finger domain, LSD1 subclass. This model describes a putative zinc finger domain found in three closely spaced copies in Arabidopsis protein LSD1 and in two copies in other proteins from the same species. The motif resembles CxxCRxxLMYxxGASxVxCxxC
Probab=28.89  E-value=41  Score=12.12  Aligned_cols=13  Identities=15%  Similarity=0.608  Sum_probs=9.3

Q ss_pred             cCCcCceeCChhh
Q psy12265         43 HSDVKAFQCEYCG   55 (71)
Q Consensus        43 ~~~~~~~~C~~c~   55 (71)
                      ..|...++|..|.
T Consensus        14 P~gA~~vrCs~C~   26 (31)
T TIGR01053        14 PRGASSVRCALCQ   26 (31)
T ss_pred             CCCCCeEECCCCC
Confidence            3466778888884


No 288
>KOG4727|consensus
Probab=28.72  E-value=40  Score=17.72  Aligned_cols=22  Identities=23%  Similarity=0.395  Sum_probs=18.6

Q ss_pred             ceecccccccccchhhHHHhHh
Q psy12265         19 PYGCEVCGRHFRQWGDLKYHKA   40 (71)
Q Consensus        19 ~~~c~~c~~~~~~~~~l~~h~~   40 (71)
                      -|-|.+|+-.+..+.++..|+.
T Consensus        75 GyyCdVCdcvvKDSinflDHiN   96 (193)
T KOG4727|consen   75 GYYCDVCDCVVKDSINFLDHIN   96 (193)
T ss_pred             ceeeeecceeehhhHHHHHHhc
Confidence            3899999999988888888864


No 289
>PF05280 FlhC:  Flagellar transcriptional activator (FlhC);  InterPro: IPR007944 This family consists of several bacterial flagellar transcriptional activator (FlhC) proteins. FlhC combines with FlhD to form a regulatory complex in Escherichia coli, this complex has been shown to be a global regulator involved in many cellular processes as well as a flagellar transcriptional activator [].; GO: 0003677 DNA binding, 0030092 regulation of flagellum assembly, 0045893 positive regulation of transcription, DNA-dependent; PDB: 2AVU_E.
Probab=28.59  E-value=26  Score=18.22  Aligned_cols=27  Identities=33%  Similarity=0.882  Sum_probs=9.7

Q ss_pred             eecccccccccchhhHHHhHhhhcCCcCceeCChhh
Q psy12265         20 YGCEVCGRHFRQWGDLKYHKASLHSDVKAFQCEYCG   55 (71)
Q Consensus        20 ~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~C~~c~   55 (71)
                      ..|..|+..|....         +.....|.|+.|.
T Consensus       135 ~~C~~C~~~fv~~~---------~~~~~~~~Cp~C~  161 (175)
T PF05280_consen  135 APCRRCGGHFVTHA---------HDPRHSFVCPFCQ  161 (175)
T ss_dssp             EE-TTT--EEEEES---------S--SS----TT--
T ss_pred             cCCCCCCCCeECcC---------CCCCcCcCCCCCC
Confidence            67888887776431         1123457888886


No 290
>KOG3214|consensus
Probab=27.25  E-value=24  Score=16.73  Aligned_cols=40  Identities=18%  Similarity=0.408  Sum_probs=21.0

Q ss_pred             CceecccccccccchhhHHHhHhhhcCCcCceeCChhhHhhhchH
Q psy12265         18 KPYGCEVCGRHFRQWGDLKYHKASLHSDVKAFQCEYCGKDFARKY   62 (71)
Q Consensus        18 ~~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~C~~c~~~f~~~~   62 (71)
                      ..|.|..|..--.-.-.+.  +. ...|  ...|.+|+..|....
T Consensus        22 t~FnClfcnHek~v~~~~D--k~-~~iG--~~sC~iC~esFqt~i   61 (109)
T KOG3214|consen   22 TQFNCLFCNHEKSVSCTLD--KK-HNIG--KASCRICEESFQTTI   61 (109)
T ss_pred             eeeccCccccccceeeeeh--hh-cCcc--eeeeeehhhhhccch
Confidence            4478888764322111111  11 1222  347999999987543


No 291
>COG3024 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=27.24  E-value=19  Score=15.58  Aligned_cols=10  Identities=40%  Similarity=0.989  Sum_probs=7.2

Q ss_pred             eeCChhhHhh
Q psy12265         49 FQCEYCGKDF   58 (71)
Q Consensus        49 ~~C~~c~~~f   58 (71)
                      ..|+.||+..
T Consensus         8 v~CP~Cgkpv   17 (65)
T COG3024           8 VPCPTCGKPV   17 (65)
T ss_pred             ccCCCCCCcc
Confidence            4788888753


No 292
>PRK06260 threonine synthase; Validated
Probab=27.07  E-value=42  Score=19.62  Aligned_cols=9  Identities=33%  Similarity=0.999  Sum_probs=4.2

Q ss_pred             eeccccccc
Q psy12265         20 YGCEVCGRH   28 (71)
Q Consensus        20 ~~c~~c~~~   28 (71)
                      +.|..|+..
T Consensus         4 ~~C~~cg~~   12 (397)
T PRK06260          4 LKCIECGKE   12 (397)
T ss_pred             EEECCCCCC
Confidence            345555544


No 293
>KOG3456|consensus
Probab=26.98  E-value=29  Score=16.68  Aligned_cols=13  Identities=38%  Similarity=1.053  Sum_probs=10.0

Q ss_pred             ceeCChhhHhhhc
Q psy12265         48 AFQCEYCGKDFAR   60 (71)
Q Consensus        48 ~~~C~~c~~~f~~   60 (71)
                      +..|.+||-.|-+
T Consensus       104 ~~~CgYCGlrf~~  116 (120)
T KOG3456|consen  104 PHICGYCGLRFVQ  116 (120)
T ss_pred             Ccccccchhhhhh
Confidence            3578999988864


No 294
>PRK00418 DNA gyrase inhibitor; Reviewed
Probab=26.91  E-value=20  Score=15.37  Aligned_cols=11  Identities=36%  Similarity=0.945  Sum_probs=7.7

Q ss_pred             ceeCChhhHhh
Q psy12265         48 AFQCEYCGKDF   58 (71)
Q Consensus        48 ~~~C~~c~~~f   58 (71)
                      ...|+.|++..
T Consensus         6 ~v~CP~C~k~~   16 (62)
T PRK00418          6 TVNCPTCGKPV   16 (62)
T ss_pred             cccCCCCCCcc
Confidence            35788888753


No 295
>PF07503 zf-HYPF:  HypF finger;  InterPro: IPR011125 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  Proteins of the HypF family are involved in the maturation and regulation of hydrogenase []. In the N terminus they appear to have two zinc finger domains that are similar to those found in the DnaJ chaperone []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 3TTD_A 3TSQ_A 3TTC_A 3TSP_A 3TTF_A 3TSU_A.
Probab=26.85  E-value=18  Score=13.50  Aligned_cols=12  Identities=25%  Similarity=0.897  Sum_probs=5.9

Q ss_pred             ceeCChhhHhhh
Q psy12265         48 AFQCEYCGKDFA   59 (71)
Q Consensus        48 ~~~C~~c~~~f~   59 (71)
                      +..|..||..+.
T Consensus        21 ~isC~~CGPr~~   32 (35)
T PF07503_consen   21 FISCTNCGPRYS   32 (35)
T ss_dssp             T--BTTCC-SCC
T ss_pred             CccCCCCCCCEE
Confidence            456888876543


No 296
>PF14952 zf-tcix:  Putative treble-clef, zinc-finger, Zn-binding
Probab=26.64  E-value=24  Score=14.01  Aligned_cols=7  Identities=43%  Similarity=1.360  Sum_probs=4.9

Q ss_pred             eCChhhH
Q psy12265         50 QCEYCGK   56 (71)
Q Consensus        50 ~C~~c~~   56 (71)
                      +|+.||-
T Consensus        13 kCp~CGt   19 (44)
T PF14952_consen   13 KCPKCGT   19 (44)
T ss_pred             cCCcCcC
Confidence            6777764


No 297
>KOG0402|consensus
Probab=26.30  E-value=18  Score=16.52  Aligned_cols=11  Identities=36%  Similarity=1.244  Sum_probs=8.3

Q ss_pred             ceeCChhhHhh
Q psy12265         48 AFQCEYCGKDF   58 (71)
Q Consensus        48 ~~~C~~c~~~f   58 (71)
                      .|.|+.||+.-
T Consensus        36 ky~CsfCGK~~   46 (92)
T KOG0402|consen   36 KYTCSFCGKKT   46 (92)
T ss_pred             hhhhhhcchhh
Confidence            47899998753


No 298
>PRK02935 hypothetical protein; Provisional
Probab=25.76  E-value=29  Score=16.60  Aligned_cols=14  Identities=21%  Similarity=0.494  Sum_probs=8.9

Q ss_pred             CCcCceeCChhhHh
Q psy12265         44 SDVKAFQCEYCGKD   57 (71)
Q Consensus        44 ~~~~~~~C~~c~~~   57 (71)
                      +......|+.|++.
T Consensus        66 tkavqV~CP~C~K~   79 (110)
T PRK02935         66 TKAVQVICPSCEKP   79 (110)
T ss_pred             ccceeeECCCCCch
Confidence            34455678888764


No 299
>PF01722 BolA:  BolA-like protein;  InterPro: IPR002634 This family consist of the morpho-protein BolA from Escherichia coli and its various homologs. In E. coli, over-expression of this protein causes round morphology and may be involved in switching the cell between elongation and septation systems during cell division []. The expression of BolA is growth rate regulated and is induced during the transition into the the stationary phase []. BolA is also induced by stress during early stages of growth [] and may have a general role in stress response. It has also been suggested that BolA can induce the transcription of penicillin binding proteins 6 and 5 [, ].; PDB: 1XS3_A 1V60_A 3O2E_A 1NY8_A 3TR3_A 2KZ0_A 2DHM_A 2KDN_A 1V9J_A.
Probab=25.62  E-value=46  Score=14.66  Aligned_cols=24  Identities=13%  Similarity=0.124  Sum_probs=13.5

Q ss_pred             cCceeCChhhHhhhchHHHHHhhh
Q psy12265         46 VKAFQCEYCGKDFARKYQAHSYHQ   69 (71)
Q Consensus        46 ~~~~~C~~c~~~f~~~~~l~~h~~   69 (71)
                      ..-|...+....|...+.+++|+.
T Consensus        27 ~sHf~i~IvS~~F~g~s~i~rhr~   50 (76)
T PF01722_consen   27 GSHFKIIIVSDEFEGKSRIKRHRL   50 (76)
T ss_dssp             SSEEEEEEECGGGTTS-HHHHHHH
T ss_pred             CceEEEEEEcHHhCCCCHHHHHHH
Confidence            444555555566666666666653


No 300
>smart00647 IBR In Between Ring fingers. the domains occurs between pairs og RING fingers
Probab=25.58  E-value=27  Score=14.12  Aligned_cols=17  Identities=24%  Similarity=0.620  Sum_probs=10.9

Q ss_pred             CcCceeCChhhHhhhch
Q psy12265         45 DVKAFQCEYCGKDFARK   61 (71)
Q Consensus        45 ~~~~~~C~~c~~~f~~~   61 (71)
                      +.....|+.|+..|-..
T Consensus        37 ~~~~v~C~~C~~~fC~~   53 (64)
T smart00647       37 GCNRVTCPKCGFSFCFR   53 (64)
T ss_pred             CCCeeECCCCCCeECCC
Confidence            34456787787766544


No 301
>KOG4602|consensus
Probab=25.54  E-value=20  Score=20.01  Aligned_cols=10  Identities=30%  Similarity=1.089  Sum_probs=6.7

Q ss_pred             ceeCChhhHh
Q psy12265         48 AFQCEYCGKD   57 (71)
Q Consensus        48 ~~~C~~c~~~   57 (71)
                      .|.|++||.+
T Consensus       268 ~YVCPiCGAT  277 (318)
T KOG4602|consen  268 SYVCPICGAT  277 (318)
T ss_pred             hhcCcccccc
Confidence            3777777754


No 302
>TIGR01385 TFSII transcription elongation factor S-II. This model represents eukaryotic transcription elongation factor S-II. This protein allows stalled RNA transcription complexes to perform a cleavage of the nascent RNA and restart at the newly generated 3-prime end.
Probab=25.41  E-value=34  Score=19.44  Aligned_cols=35  Identities=23%  Similarity=0.532  Sum_probs=19.2

Q ss_pred             ceecccccccccchhhHHHhHhhhcCCcC----ceeCChhhHhh
Q psy12265         19 PYGCEVCGRHFRQWGDLKYHKASLHSDVK----AFQCEYCGKDF   58 (71)
Q Consensus        19 ~~~c~~c~~~~~~~~~l~~h~~~~~~~~~----~~~C~~c~~~f   58 (71)
                      -+.|..|+..=.....+  .   ....+.    -|.|..||..+
T Consensus       258 ~~~C~~C~~~~~~~~q~--Q---trsaDEpmT~f~~C~~Cg~~w  296 (299)
T TIGR01385       258 LFTCGKCKQKKCTYYQL--Q---TRSADEPMTTFVTCEECGNRW  296 (299)
T ss_pred             cccCCCCCCccceEEEe--c---ccCCCCCCeEEEEcCCCCCee
Confidence            48999998643322221  1   122222    26899998654


No 303
>PF13462 Thioredoxin_4:  Thioredoxin; PDB: 3FEU_A 3HZ8_A 3DVW_A 3A3T_E 3GMF_A 1Z6M_A 3GYK_C 3BCK_A 3BD2_A 3BCI_A ....
Probab=25.17  E-value=39  Score=16.40  Aligned_cols=18  Identities=28%  Similarity=0.431  Sum_probs=10.9

Q ss_pred             eeCChhhHhhhchHHHHH
Q psy12265         49 FQCEYCGKDFARKYQAHS   66 (71)
Q Consensus        49 ~~C~~c~~~f~~~~~l~~   66 (71)
                      |.|+.|.+....-..+..
T Consensus        22 ~~Cp~C~~~~~~~~~~~~   39 (162)
T PF13462_consen   22 FQCPHCAKFHEELEKLLK   39 (162)
T ss_dssp             TTSHHHHHHHHHHHHHHH
T ss_pred             CCCHhHHHHHHHHhhhhh
Confidence            578888776554444433


No 304
>PF02148 zf-UBP:  Zn-finger in ubiquitin-hydrolases and other protein;  InterPro: IPR001607 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents UBP-type zinc finger domains, which display some similarity with the Zn-binding domain of the insulinase family. The UBP-type zinc finger domain is found only in a small subfamily of ubiquitin C-terminal hydrolases (deubiquitinases or UBP) [, ], All members of this subfamily are isopeptidase-T, which are known to cleave isopeptide bonds between ubiquitin moieties. Some of the proteins containing an UBP zinc finger include:    Homo sapiens (Human) deubiquitinating enzyme 13 (UBPD) Human deubiquitinating enzyme 5 (UBP5)  Dictyostelium discoideum (Slime mold) deubiquitinating enzyme A (UBPA)  Saccharomyces cerevisiae (Baker's yeast) deubiquitinating enzyme 8 (UBP8) Yeast deubiquitinating enzyme 14 (UBP14)   More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 3GV4_A 3PHD_B 3C5K_A 2UZG_A 3IHP_B 2G43_B 2G45_D 2I50_A 3MHH_A 3MHS_A ....
Probab=25.16  E-value=37  Score=14.14  Aligned_cols=15  Identities=20%  Similarity=0.239  Sum_probs=8.4

Q ss_pred             CCceecccccccccc
Q psy12265         17 LKPYGCEVCGRHFRQ   31 (71)
Q Consensus        17 ~~~~~c~~c~~~~~~   31 (71)
                      ...|.|-.|+..+..
T Consensus         9 ~~lw~CL~Cg~~~C~   23 (63)
T PF02148_consen    9 SNLWLCLTCGYVGCG   23 (63)
T ss_dssp             SSEEEETTTS-EEET
T ss_pred             CceEEeCCCCccccc
Confidence            445677777665544


No 305
>PF14447 Prok-RING_4:  Prokaryotic RING finger family 4
Probab=25.00  E-value=21  Score=14.88  Aligned_cols=16  Identities=25%  Similarity=0.667  Sum_probs=10.4

Q ss_pred             CcCceeCChhhHhhhc
Q psy12265         45 DVKAFQCEYCGKDFAR   60 (71)
Q Consensus        45 ~~~~~~C~~c~~~f~~   60 (71)
                      +++---|+.|+..|..
T Consensus        36 ~~rYngCPfC~~~~~~   51 (55)
T PF14447_consen   36 GERYNGCPFCGTPFEF   51 (55)
T ss_pred             hhhccCCCCCCCcccC
Confidence            3444468889887653


No 306
>COG1885 Uncharacterized protein conserved in archaea [Function unknown]
Probab=24.94  E-value=19  Score=17.16  Aligned_cols=11  Identities=36%  Similarity=0.984  Sum_probs=7.8

Q ss_pred             eeCChhhHhhh
Q psy12265         49 FQCEYCGKDFA   59 (71)
Q Consensus        49 ~~C~~c~~~f~   59 (71)
                      ..|+.||..|.
T Consensus        50 t~CP~Cg~~~e   60 (115)
T COG1885          50 TSCPKCGEPFE   60 (115)
T ss_pred             ccCCCCCCccc
Confidence            37888887654


No 307
>COG4311 SoxD Sarcosine oxidase delta subunit [Amino acid transport and metabolism]
Probab=24.57  E-value=28  Score=16.27  Aligned_cols=9  Identities=44%  Similarity=1.394  Sum_probs=6.4

Q ss_pred             ceeCChhhH
Q psy12265         48 AFQCEYCGK   56 (71)
Q Consensus        48 ~~~C~~c~~   56 (71)
                      .+.|+.||.
T Consensus         3 LI~CP~Cg~   11 (97)
T COG4311           3 LIPCPYCGE   11 (97)
T ss_pred             eecCCCCCC
Confidence            357888875


No 308
>TIGR00280 L37a ribosomal protein L37a. This model finds eukaryotic ribosomal protein L37a and its archaeal orthologs. The nomeclature is tricky because eukaryotes have proteins called both L37 and L37a.
Probab=24.57  E-value=40  Score=15.65  Aligned_cols=11  Identities=36%  Similarity=1.141  Sum_probs=6.9

Q ss_pred             eeccccccccc
Q psy12265         20 YGCEVCGRHFR   30 (71)
Q Consensus        20 ~~c~~c~~~~~   30 (71)
                      |.|..|++.|.
T Consensus        54 W~C~~C~~~~A   64 (91)
T TIGR00280        54 WTCRKCGAKFA   64 (91)
T ss_pred             EEcCCCCCEEe
Confidence            66666666553


No 309
>PF12760 Zn_Tnp_IS1595:  Transposase zinc-ribbon domain;  InterPro: IPR024442 This zinc binding domain is found in a range of transposase proteins such as ISSPO8, ISSOD11, ISRSSP2 etc. It may be a zinc-binding beta ribbon domain that could bind DNA.
Probab=24.55  E-value=61  Score=12.53  Aligned_cols=39  Identities=18%  Similarity=0.347  Sum_probs=20.8

Q ss_pred             HHHHhHhhCCCceecccccccccchhhHHHhHhhhcCCcCceeCChhhH
Q psy12265          8 KVHNRVHLGLKPYGCEVCGRHFRQWGDLKYHKASLHSDVKAFQCEYCGK   56 (71)
Q Consensus         8 ~~h~~~~~~~~~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~C~~c~~   56 (71)
                      ..++...-....+.|+.|+.. .       +-  .-.....|+|..|++
T Consensus         7 ~~~l~~~RW~~g~~CP~Cg~~-~-------~~--~~~~~~~~~C~~C~~   45 (46)
T PF12760_consen    7 REYLEEIRWPDGFVCPHCGST-K-------HY--RLKTRGRYRCKACRK   45 (46)
T ss_pred             HHHHHHhcCCCCCCCCCCCCe-e-------eE--EeCCCCeEECCCCCC
Confidence            334443334444779999854 1       00  111245788888864


No 310
>cd01410 SIRT7 SIRT7: Eukaryotic and prokaryotic group (class4) which includes human sirtuin SIRT6, SIRT7, and several bacterial homologs; and are members of the SIR2 family of proteins, silent information regulator 2 (Sir2) enzymes which catalyze NAD+-dependent protein/histone deacetylation. Sir2 proteins have been shown to regulate gene silencing, DNA repair, metabolic enzymes, and life span.
Probab=24.55  E-value=91  Score=16.54  Aligned_cols=35  Identities=17%  Similarity=0.361  Sum_probs=17.6

Q ss_pred             CceecccccccccchhhHHHhHhhhcCCcCceeCChhhH
Q psy12265         18 KPYGCEVCGRHFRQWGDLKYHKASLHSDVKAFQCEYCGK   56 (71)
Q Consensus        18 ~~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~C~~c~~   56 (71)
                      ....|..|+..+.....+. -   .......-.|+.|+.
T Consensus        94 ~~~~C~~C~~~~~~~~~~~-~---~~~~~~~p~C~~Cgg  128 (206)
T cd01410          94 FIEVCKSCGPEYVRDDVVE-T---RGDKETGRRCHACGG  128 (206)
T ss_pred             CcccCCCCCCccchHHHHH-H---hhcCCCCCcCCCCcC
Confidence            4467888886654332221 1   111222346888863


No 311
>smart00661 RPOL9 RNA polymerase subunit 9.
Probab=24.47  E-value=44  Score=13.00  Aligned_cols=13  Identities=23%  Similarity=0.542  Sum_probs=9.9

Q ss_pred             ceecccccccccc
Q psy12265         19 PYGCEVCGRHFRQ   31 (71)
Q Consensus        19 ~~~c~~c~~~~~~   31 (71)
                      .+.|..|+..+.-
T Consensus        20 ~~vC~~Cg~~~~~   32 (52)
T smart00661       20 RFVCRKCGYEEPI   32 (52)
T ss_pred             EEECCcCCCeEEC
Confidence            6899999966543


No 312
>PF10122 Mu-like_Com:  Mu-like prophage protein Com;  InterPro: IPR019294  Members of this entry belong to the Com family of proteins that act as translational regulators of mom [, ]. 
Probab=24.35  E-value=45  Score=13.71  Aligned_cols=11  Identities=36%  Similarity=0.803  Sum_probs=6.7

Q ss_pred             eeCChhhHhhh
Q psy12265         49 FQCEYCGKDFA   59 (71)
Q Consensus        49 ~~C~~c~~~f~   59 (71)
                      ++|..|++...
T Consensus         5 iRC~~CnklLa   15 (51)
T PF10122_consen    5 IRCGHCNKLLA   15 (51)
T ss_pred             eeccchhHHHh
Confidence            56777766543


No 313
>TIGR03830 CxxCG_CxxCG_HTH putative zinc finger/helix-turn-helix protein, YgiT family. This model describes a family of predicted regulatory proteins with a conserved zinc finger/HTH architecture. The amino-terminal region contains a novel domain, featuring two CXXC motifs and occuring in a number of small bacterial proteins as well as in the present family. The carboxyl-terminal region consists of a helix-turn-helix domain, modeled by pfam01381. The predicted function is DNA binding and transcriptional regulation.
Probab=24.18  E-value=86  Score=14.75  Aligned_cols=18  Identities=22%  Similarity=0.504  Sum_probs=12.9

Q ss_pred             ceecccccccccchhhHH
Q psy12265         19 PYGCEVCGRHFRQWGDLK   36 (71)
Q Consensus        19 ~~~c~~c~~~~~~~~~l~   36 (71)
                      -+.|+.||..+.......
T Consensus        31 ~~~C~~CGe~~~~~e~~~   48 (127)
T TIGR03830        31 GWYCPACGEELLDPEESK   48 (127)
T ss_pred             eeECCCCCCEEEcHHHHH
Confidence            478999998776655543


No 314
>PF09082 DUF1922:  Domain of unknown function (DUF1922);  InterPro: IPR015166 Members of this family consist of a beta-sheet region followed by an alpha-helix and an unstructured C terminus. The beta-sheet region contains a CXCX...XCXC sequence with Cys residues located in two proximal loops and pointing towards each other. This precise function of this set of bacterial proteins is, as yet, unknown []. ; PDB: 1GH9_A.
Probab=24.02  E-value=16  Score=15.95  Aligned_cols=6  Identities=67%  Similarity=1.841  Sum_probs=2.7

Q ss_pred             eCChhhH
Q psy12265         50 QCEYCGK   56 (71)
Q Consensus        50 ~C~~c~~   56 (71)
                      .| .||+
T Consensus        22 kC-~CG~   27 (68)
T PF09082_consen   22 KC-VCGK   27 (68)
T ss_dssp             EE-TTTE
T ss_pred             Ee-cCCC
Confidence            44 4443


No 315
>KOG0562|consensus
Probab=23.84  E-value=63  Score=16.96  Aligned_cols=23  Identities=9%  Similarity=0.069  Sum_probs=16.7

Q ss_pred             CceeCChhhHhhhchHHHHHhhh
Q psy12265         47 KAFQCEYCGKDFARKYQAHSYHQ   69 (71)
Q Consensus        47 ~~~~C~~c~~~f~~~~~l~~h~~   69 (71)
                      .+.+|..|+..-..-..|..|.+
T Consensus       152 ~dLrC~~Cq~~~~~~~kLK~Hl~  174 (184)
T KOG0562|consen  152 EDLRCWRCQTFGPHFPKLKAHLR  174 (184)
T ss_pred             cceeehhhhhcccccHHHHHHHH
Confidence            45689999855566777887765


No 316
>TIGR00244 transcriptional regulator NrdR. Members of this almost entirely bacterial family contain an ATP cone domain (PFAM:PF03477). There is never more than one member per genome. Common gene symbols given include nrdR, ybaD, ribX and ytcG. The member from Streptomyces coelicolor is found upstream in the operon of the class II oxygen-independent ribonucleotide reductase gene nrdJ and was shown to repress nrdJ expression. Many members of this family are found near genes for riboflavin biosynthesis in Gram-negative bacteria, suggesting a role in that pathway. However, a phylogenetic profiling study associates members of this family with the presence of a palindromic signal with consensus acaCwAtATaTwGtgt, termed the NrdR-box, an upstream element for most operons for ribonucleotide reductase of all three classes in bacterial genomes.
Probab=23.70  E-value=37  Score=17.28  Aligned_cols=16  Identities=19%  Similarity=0.488  Sum_probs=12.1

Q ss_pred             eecccccccccchhhH
Q psy12265         20 YGCEVCGRHFRQWGDL   35 (71)
Q Consensus        20 ~~c~~c~~~~~~~~~l   35 (71)
                      =.|..|++.|++-..+
T Consensus        29 ReC~~C~~RFTTyErv   44 (147)
T TIGR00244        29 RECLECHERFTTFERA   44 (147)
T ss_pred             ccCCccCCccceeeec
Confidence            5789999999865543


No 317
>PF10609 ParA:  ParA/MinD ATPase like;  InterPro: IPR019591  This entry represents ATPases involved in plasmid partitioning []. It also contains cytosolic Fe-S cluster assembling factors, NBP35 and CFD1 which are required for biogenesis and export of both ribosomal subunits probably through assembling the ISCs in RLI1, a protein which performs rRNA processing and ribosome export [, , ].; PDB: 2PH1_A 3KB1_B.
Probab=23.37  E-value=40  Score=15.24  Aligned_cols=10  Identities=40%  Similarity=1.036  Sum_probs=5.2

Q ss_pred             ceeCChhhHh
Q psy12265         48 AFQCEYCGKD   57 (71)
Q Consensus        48 ~~~C~~c~~~   57 (71)
                      .|.|+.|++.
T Consensus        65 ~~~Cp~Cg~~   74 (81)
T PF10609_consen   65 YFVCPHCGER   74 (81)
T ss_dssp             EEE-TTT--E
T ss_pred             ccCCCCCCCe
Confidence            3789988864


No 318
>COG1545 Predicted nucleic-acid-binding protein containing a Zn-ribbon [General function prediction only]
Probab=23.16  E-value=20  Score=17.77  Aligned_cols=9  Identities=33%  Similarity=1.298  Sum_probs=6.4

Q ss_pred             eCChhhHhh
Q psy12265         50 QCEYCGKDF   58 (71)
Q Consensus        50 ~C~~c~~~f   58 (71)
                      +|..||..|
T Consensus        31 kC~~CG~v~   39 (140)
T COG1545          31 KCKKCGRVY   39 (140)
T ss_pred             EcCCCCeEE
Confidence            688887653


No 319
>COG1327 Predicted transcriptional regulator, consists of a Zn-ribbon and ATP-cone domains [Transcription]
Probab=23.14  E-value=37  Score=17.40  Aligned_cols=15  Identities=27%  Similarity=0.724  Sum_probs=11.6

Q ss_pred             eecccccccccchhh
Q psy12265         20 YGCEVCGRHFRQWGD   34 (71)
Q Consensus        20 ~~c~~c~~~~~~~~~   34 (71)
                      =.|..|+..|++-..
T Consensus        29 ReC~~C~~RFTTfE~   43 (156)
T COG1327          29 RECLECGERFTTFER   43 (156)
T ss_pred             hcccccccccchhhe
Confidence            579999999986544


No 320
>cd04476 RPA1_DBD_C RPA1_DBD_C: A subfamily of OB folds corresponding to the C-terminal OB fold, the ssDNA-binding domain (DBD)-C, of human RPA1 (also called RPA70). RPA1 is the large subunit of Replication protein A (RPA). RPA is a nuclear ssDNA-binding protein (SSB) which appears to be involved in all aspects of DNA metabolism including replication, recombination, and repair. RPA also mediates specific interactions of various nuclear proteins. In animals, plants, and fungi, RPA is a heterotrimer with subunits of 70KDa (RPA1), 32kDa (RPA2), and 14 KDa (RPA3). In addition to DBD-C, RPA1 contains three other OB folds: DBD-A, DBD-B, and RPA1N. The major DNA binding activity of RPA is associated with RPA1 DBD-A and DBD-B. RPA1 DBD-C is involved in DNA binding and trimerization. It contains two structural insertions not found to date in other OB-folds: a zinc ribbon and a three-helix bundle. RPA1 DBD-C also contains a Cys4-type zinc-binding motif, which plays a role in the ssDNA binding fun
Probab=23.01  E-value=33  Score=17.22  Aligned_cols=11  Identities=36%  Similarity=1.050  Sum_probs=6.5

Q ss_pred             CceeCChhhHh
Q psy12265         47 KAFQCEYCGKD   57 (71)
Q Consensus        47 ~~~~C~~c~~~   57 (71)
                      ..|.|..|+..
T Consensus        50 ~~~~C~~C~~~   60 (166)
T cd04476          50 GTYRCEKCNKS   60 (166)
T ss_pred             CcEECCCCCCc
Confidence            34666666654


No 321
>COG1631 RPL42A Ribosomal protein L44E [Translation, ribosomal structure and biogenesis]
Probab=22.90  E-value=28  Score=16.18  Aligned_cols=11  Identities=36%  Similarity=0.996  Sum_probs=8.5

Q ss_pred             eeCChhhHhhh
Q psy12265         49 FQCEYCGKDFA   59 (71)
Q Consensus        49 ~~C~~c~~~f~   59 (71)
                      |.|.+|++.-.
T Consensus        69 ~~Ct~Cgkah~   79 (94)
T COG1631          69 LRCTECGKAHQ   79 (94)
T ss_pred             EEehhhccccc
Confidence            79999987643


No 322
>PRK14892 putative transcription elongation factor Elf1; Provisional
Probab=22.87  E-value=36  Score=16.01  Aligned_cols=10  Identities=50%  Similarity=1.218  Sum_probs=8.0

Q ss_pred             cCceeCChhh
Q psy12265         46 VKAFQCEYCG   55 (71)
Q Consensus        46 ~~~~~C~~c~   55 (71)
                      ...|.|+.|+
T Consensus        19 pt~f~CP~Cg   28 (99)
T PRK14892         19 PKIFECPRCG   28 (99)
T ss_pred             CcEeECCCCC
Confidence            3568999998


No 323
>PTZ00255 60S ribosomal protein L37a; Provisional
Probab=22.85  E-value=46  Score=15.43  Aligned_cols=11  Identities=18%  Similarity=0.751  Sum_probs=6.8

Q ss_pred             eeccccccccc
Q psy12265         20 YGCEVCGRHFR   30 (71)
Q Consensus        20 ~~c~~c~~~~~   30 (71)
                      |.|..|+..|.
T Consensus        55 W~C~~C~~~~A   65 (90)
T PTZ00255         55 WRCKGCKKTVA   65 (90)
T ss_pred             EEcCCCCCEEe
Confidence            66666666554


No 324
>PHA03019 hypothetical protein; Provisional
Probab=22.78  E-value=52  Score=14.28  Aligned_cols=12  Identities=33%  Similarity=1.013  Sum_probs=8.1

Q ss_pred             eeCChhhHhhhc
Q psy12265         49 FQCEYCGKDFAR   60 (71)
Q Consensus        49 ~~C~~c~~~f~~   60 (71)
                      ..|..|.+.|..
T Consensus        21 ~kcd~c~kn~nd   32 (77)
T PHA03019         21 IKCDECEKNFND   32 (77)
T ss_pred             hhHHHHHHHHHH
Confidence            367777777654


No 325
>KOG3134|consensus
Probab=22.61  E-value=68  Score=17.57  Aligned_cols=33  Identities=21%  Similarity=0.525  Sum_probs=17.5

Q ss_pred             eecccccccccchhhHHHhHhhhcCCcCceeCChhhHh
Q psy12265         20 YGCEVCGRHFRQWGDLKYHKASLHSDVKAFQCEYCGKD   57 (71)
Q Consensus        20 ~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~C~~c~~~   57 (71)
                      +.|..||..-   .+|-.  +-.+..-+.=+|+.|++.
T Consensus         1 ~~CVeCg~~v---ksLy~--~Ys~g~irlt~C~nC~e~   33 (225)
T KOG3134|consen    1 YRCVECGSEV---KSLYT--QYSPGNIRLTKCPNCQEV   33 (225)
T ss_pred             CcccccCchH---HHHHH--hcCCCcEEEeeCCchhhH
Confidence            4678887442   22221  112333455689999765


No 326
>PF08273 Prim_Zn_Ribbon:  Zinc-binding domain of primase-helicase;  InterPro: IPR013237 This entry is represented by bacteriophage T7 Gp4. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches. This entry represents a zinc binding domain found in the N-terminal region of the bacteriophage T7 Gp4 and P4 alpha protein. P4 is a multifunctional protein with origin recognition, helicase and primase activities [, , ].; GO: 0003896 DNA primase activity, 0004386 helicase activity, 0008270 zinc ion binding; PDB: 1NUI_B.
Probab=22.44  E-value=33  Score=13.22  Aligned_cols=8  Identities=38%  Similarity=0.912  Sum_probs=3.5

Q ss_pred             eeCChhhH
Q psy12265         49 FQCEYCGK   56 (71)
Q Consensus        49 ~~C~~c~~   56 (71)
                      -.|+.|+-
T Consensus         4 ~pCP~CGG   11 (40)
T PF08273_consen    4 GPCPICGG   11 (40)
T ss_dssp             E--TTTT-
T ss_pred             CCCCCCcC
Confidence            36888864


No 327
>PF10367 Vps39_2:  Vacuolar sorting protein 39 domain 2;  InterPro: IPR019453  This entry represents a domain found in the vacuolar sorting protein Vps39 and transforming growth factor beta receptor-associated protein Trap1. Vps39, a component of the C-Vps complex, is thought to be required for the fusion of endosomes and other types of transport intermediates with the vacuole [, ]. In Saccharomyces cerevisiae (Baker's yeast), Vps39 has been shown to stimulate nucleotide exchange []. Trap1 plays a role in the TGF-beta/activin signaling pathway. It associates with inactive heteromeric TGF-beta and activin receptor complexes, mainly through the type II receptor, and is released upon activation of signaling [, ]. The precise function of this domain has not been characterised In Vps39 this domain is involved in localisation and in mediating the interactions with Vps11 []. 
Probab=22.34  E-value=23  Score=16.08  Aligned_cols=11  Identities=36%  Similarity=1.075  Sum_probs=8.4

Q ss_pred             eCChhhHhhhc
Q psy12265         50 QCEYCGKDFAR   60 (71)
Q Consensus        50 ~C~~c~~~f~~   60 (71)
                      .|..|++.+..
T Consensus        80 ~C~vC~k~l~~   90 (109)
T PF10367_consen   80 KCSVCGKPLGN   90 (109)
T ss_pred             CccCcCCcCCC
Confidence            59999887654


No 328
>PRK05580 primosome assembly protein PriA; Validated
Probab=21.92  E-value=54  Score=20.84  Aligned_cols=10  Identities=30%  Similarity=0.707  Sum_probs=6.9

Q ss_pred             CceeCChhhH
Q psy12265         47 KAFQCEYCGK   56 (71)
Q Consensus        47 ~~~~C~~c~~   56 (71)
                      .+..|+.|+.
T Consensus       420 ~~~~Cp~Cg~  429 (679)
T PRK05580        420 IPKACPECGS  429 (679)
T ss_pred             CCCCCCCCcC
Confidence            4567888865


No 329
>PF10825 DUF2752:  Protein of unknown function (DUF2752);  InterPro: IPR021215  This family is conserved in bacteria. Many members are annotated as being putative membrane proteins. 
Probab=21.86  E-value=32  Score=13.91  Aligned_cols=9  Identities=33%  Similarity=0.907  Sum_probs=6.5

Q ss_pred             eeCChhhHh
Q psy12265         49 FQCEYCGKD   57 (71)
Q Consensus        49 ~~C~~c~~~   57 (71)
                      +.|+-||-+
T Consensus        10 ~~CPgCG~t   18 (52)
T PF10825_consen   10 IPCPGCGMT   18 (52)
T ss_pred             CCCCCCcHH
Confidence            468889854


No 330
>TIGR03829 YokU_near_AblA uncharacterized protein, YokU family. Members of this protein family occur in various species of the genus Bacillus, always next to the gene (kamA or ablA) for lysine 2,3-aminomutase. Members have a pair of CXXC motifs, and share homology to the amino-terminal region of a family of putative transcription factors for which the C-terminal is modeled by pfam01381, a helix-turn-helix domain model. This family, however, is shorter and lacks the helix-turn-helix region. The function of this protein family is unknown, but a regulatory role in compatible solute biosynthesis is suggested by local genome context.
Probab=21.81  E-value=69  Score=14.83  Aligned_cols=17  Identities=24%  Similarity=0.636  Sum_probs=13.1

Q ss_pred             eecccccccccchhhHH
Q psy12265         20 YGCEVCGRHFRQWGDLK   36 (71)
Q Consensus        20 ~~c~~c~~~~~~~~~l~   36 (71)
                      ..|+.||..|....-+.
T Consensus        36 ~~C~~CGe~y~~dev~~   52 (89)
T TIGR03829        36 ISCSHCGMEYQDDTTVK   52 (89)
T ss_pred             ccccCCCcEeecHHHHH
Confidence            78999999887665544


No 331
>PF04777 Evr1_Alr:  Erv1 / Alr family;  InterPro: IPR006863 Biogenesis of Fe/S clusters involves a number of essential mitochondrial proteins. Erv1p of Saccharomyces cerevisiae (Baker's yeast) mitochondria is required for the maturation of Fe/S proteins in the cytosol. The ALR (augmenter of liver regeneration) represents a mammalian ortholog of yeast Erv1p. Both Erv1p and full-length ALR are located in the mitochondrial intermembrane and it is thought to operate downstream of the mitochondrial ABC transporter [].; GO: 0016972 thiol oxidase activity, 0055114 oxidation-reduction process; PDB: 3MBG_C 3U2L_A 3U2M_A 3QD9_D 3QCP_A 3O55_A 2HJ3_B 3GWN_A 3T58_D 3T59_B ....
Probab=21.35  E-value=44  Score=15.10  Aligned_cols=15  Identities=33%  Similarity=0.842  Sum_probs=10.8

Q ss_pred             CceeCChhhHhhhch
Q psy12265         47 KAFQCEYCGKDFARK   61 (71)
Q Consensus        47 ~~~~C~~c~~~f~~~   61 (71)
                      .-|.|..|...|...
T Consensus        35 ~~~pC~~C~~hf~~~   49 (95)
T PF04777_consen   35 HFFPCEECRNHFSKY   49 (95)
T ss_dssp             HHSSSHHHHHHHHHH
T ss_pred             HHCCcHHHHHHHHHH
Confidence            347899998777644


No 332
>COG3478 Predicted nucleic-acid-binding protein containing a Zn-ribbon domain [General function prediction only]
Probab=21.31  E-value=40  Score=14.63  Aligned_cols=6  Identities=50%  Similarity=1.580  Sum_probs=3.0

Q ss_pred             eCChhh
Q psy12265         50 QCEYCG   55 (71)
Q Consensus        50 ~C~~c~   55 (71)
                      .|+.||
T Consensus         6 kCpKCg   11 (68)
T COG3478           6 KCPKCG   11 (68)
T ss_pred             cCCCcC
Confidence            455554


No 333
>PRK03976 rpl37ae 50S ribosomal protein L37Ae; Reviewed
Probab=21.29  E-value=52  Score=15.27  Aligned_cols=11  Identities=36%  Similarity=1.150  Sum_probs=6.5

Q ss_pred             eeccccccccc
Q psy12265         20 YGCEVCGRHFR   30 (71)
Q Consensus        20 ~~c~~c~~~~~   30 (71)
                      |.|..|+..|.
T Consensus        55 W~C~~C~~~~A   65 (90)
T PRK03976         55 WECRKCGAKFA   65 (90)
T ss_pred             EEcCCCCCEEe
Confidence            66666665543


No 334
>PF14803 Nudix_N_2:  Nudix N-terminal; PDB: 3CNG_C.
Probab=21.28  E-value=37  Score=12.52  Aligned_cols=7  Identities=43%  Similarity=1.217  Sum_probs=2.7

Q ss_pred             CChhhHh
Q psy12265         51 CEYCGKD   57 (71)
Q Consensus        51 C~~c~~~   57 (71)
                      |+.||..
T Consensus         3 C~~CG~~    9 (34)
T PF14803_consen    3 CPQCGGP    9 (34)
T ss_dssp             -TTT--B
T ss_pred             cccccCh
Confidence            6777754


No 335
>TIGR03655 anti_R_Lar restriction alleviation protein, Lar family. Restriction alleviation proteins provide a countermeasure to host cell restriction enzyme defense against foreign DNA such as phage or plasmids. This family consists of homologs to the phage antirestriction protein Lar, and most members belong to phage genomes or prophage regions of bacterial genomes.
Probab=21.28  E-value=32  Score=13.82  Aligned_cols=6  Identities=50%  Similarity=1.885  Sum_probs=3.3

Q ss_pred             eCChhh
Q psy12265         50 QCEYCG   55 (71)
Q Consensus        50 ~C~~c~   55 (71)
                      .|+.||
T Consensus         3 PCPfCG    8 (53)
T TIGR03655         3 PCPFCG    8 (53)
T ss_pred             CCCCCC
Confidence            455565


No 336
>PF03367 zf-ZPR1:  ZPR1 zinc-finger domain;  InterPro: IPR004457 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents ZPR1-type zinc finger domains. An orthologous protein found once in each of the completed archaeal genomes corresponds to a zinc finger-containing domain repeated as the N-terminal and C-terminal halves of the mouse protein ZPR1. ZPR1 is an experimentally proven zinc-binding protein that binds the tyrosine kinase domain of the epidermal growth factor receptor (EGFR); binding is inhibited by EGF stimulation and tyrosine phosphorylation, and activation by EGF is followed by some redistribution of ZPR1 to the nucleus. By analogy, other proteins with the ZPR1 zinc finger domain may be regulatory proteins that sense protein phosphorylation state and/or participate in signal transduction (see also IPR004470 from INTERPRO). Deficiencies in ZPR1 may contribute to neurodegenerative disorders. ZPR1 appears to be down-regulated in patients with spinal muscular atrophy (SMA), a disease characterised by degeneration of the alpha-motor neurons in the spinal cord that can arise from mutations affecting the expression of Survival Motor Neurons (SMN) []. ZPR1 interacts with complexes formed by SMN [], and may act as a modifier that effects the severity of SMA. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 2QKD_A.
Probab=21.25  E-value=30  Score=17.65  Aligned_cols=13  Identities=38%  Similarity=0.882  Sum_probs=6.7

Q ss_pred             CceeCChhhHhhh
Q psy12265         47 KAFQCEYCGKDFA   59 (71)
Q Consensus        47 ~~~~C~~c~~~f~   59 (71)
                      ..|.|+.||....
T Consensus        29 ~sf~C~~CGyk~~   41 (161)
T PF03367_consen   29 MSFECEHCGYKNN   41 (161)
T ss_dssp             EEEE-TTT--EEE
T ss_pred             EEeECCCCCCEee
Confidence            3479999987543


No 337
>PF14599 zinc_ribbon_6:  Zinc-ribbon; PDB: 2K2D_A.
Probab=20.60  E-value=29  Score=14.74  Aligned_cols=10  Identities=20%  Similarity=0.451  Sum_probs=5.3

Q ss_pred             eecccccccc
Q psy12265         20 YGCEVCGRHF   29 (71)
Q Consensus        20 ~~c~~c~~~~   29 (71)
                      ..|..|+...
T Consensus        31 IlCNDC~~~s   40 (61)
T PF14599_consen   31 ILCNDCNAKS   40 (61)
T ss_dssp             EEESSS--EE
T ss_pred             EECCCCCCcc
Confidence            5678887654


No 338
>TIGR00340 zpr1_rel ZPR1-related zinc finger protein. A model ZPR1_znf (TIGR00310) has been created to describe the domain shared by this protein and ZPR1.
Probab=20.57  E-value=38  Score=17.45  Aligned_cols=12  Identities=33%  Similarity=0.841  Sum_probs=9.0

Q ss_pred             ceeCChhhHhhh
Q psy12265         48 AFQCEYCGKDFA   59 (71)
Q Consensus        48 ~~~C~~c~~~f~   59 (71)
                      .|.|+.||....
T Consensus        28 sf~C~~CGyr~~   39 (163)
T TIGR00340        28 TYICEKCGYRST   39 (163)
T ss_pred             EEECCCCCCchh
Confidence            478999987644


No 339
>PF01363 FYVE:  FYVE zinc finger;  InterPro: IPR000306 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The FYVE zinc finger is named after four proteins that it has been found in: Fab1, YOTB/ZK632.12, Vac1, and EEA1. The FYVE finger has been shown to bind two zinc ions []. The FYVE finger has eight potential zinc coordinating cysteine positions. Many members of this family also include two histidines in a motif R+HHC+XCG, where + represents a charged residue and X any residue. FYVE-type domains are divided into two known classes: FYVE domains that specifically bind to phosphatidylinositol 3-phosphate in lipid bilayers and FYVE-related domains of undetermined function []. Those that bind to phosphatidylinositol 3-phosphate are often found in proteins targeted to lipid membranes that are involved in regulating membrane traffic [, , ]. Most FYVE domains target proteins to endosomes by binding specifically to phosphatidylinositol-3-phosphate at the membrane surface. By contrast, the CARP2 FYVE-like domain is not optimized to bind to phosphoinositides or insert into lipid bilayers. FYVE domains are distinguished from other zinc fingers by three signature sequences: an N-terminal WxxD motif, a basic R(R/K)HHCR patch, and a C-terminal RVC motif. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0046872 metal ion binding; PDB: 1HYI_A 1JOC_B 1HYJ_A 1DVP_A 3ZYQ_A 4AVX_A 1VFY_A 3T7L_A 1X4U_A 1WFK_A ....
Probab=20.51  E-value=35  Score=14.26  Aligned_cols=10  Identities=50%  Similarity=1.311  Sum_probs=4.3

Q ss_pred             eCChhhHhhh
Q psy12265         50 QCEYCGKDFA   59 (71)
Q Consensus        50 ~C~~c~~~f~   59 (71)
                      .|..|++.|.
T Consensus        11 ~C~~C~~~F~   20 (69)
T PF01363_consen   11 NCMICGKKFS   20 (69)
T ss_dssp             B-TTT--B-B
T ss_pred             cCcCcCCcCC
Confidence            5777888774


No 340
>PF12677 DUF3797:  Domain of unknown function (DUF3797);  InterPro: IPR024256 This presumed domain is functionally uncharacterised. This domain family is found in bacteria and viruses, and is approximately 50 amino acids in length. There is a conserved CGN sequence motif.
Probab=20.42  E-value=36  Score=13.86  Aligned_cols=8  Identities=38%  Similarity=1.186  Sum_probs=5.5

Q ss_pred             eeCChhhH
Q psy12265         49 FQCEYCGK   56 (71)
Q Consensus        49 ~~C~~c~~   56 (71)
                      -.|+.||-
T Consensus        14 ~~Cp~CGN   21 (49)
T PF12677_consen   14 CKCPKCGN   21 (49)
T ss_pred             ccCcccCC
Confidence            36888874


No 341
>COG4847 Uncharacterized protein conserved in archaea [Function unknown]
Probab=20.26  E-value=49  Score=15.55  Aligned_cols=12  Identities=50%  Similarity=1.074  Sum_probs=8.8

Q ss_pred             CCceeccccccc
Q psy12265         17 LKPYGCEVCGRH   28 (71)
Q Consensus        17 ~~~~~c~~c~~~   28 (71)
                      -+.|.|..|+..
T Consensus         4 lkewkC~VCg~~   15 (103)
T COG4847           4 LKEWKCYVCGGT   15 (103)
T ss_pred             cceeeEeeeCCE
Confidence            356889888864


No 342
>PF04032 Rpr2:  RNAse P Rpr2/Rpp21/SNM1 subunit domain;  InterPro: IPR007175 This family contains a ribonuclease P subunit of human and yeast. Other members of the family include the probable archaeal homologues. This subunit possibly binds the precursor tRNA [].; PDB: 2K3R_A 2KI7_B 2ZAE_B 1X0T_A.
Probab=20.20  E-value=12  Score=16.44  Aligned_cols=13  Identities=31%  Similarity=0.577  Sum_probs=4.9

Q ss_pred             Cceeccccccccc
Q psy12265         18 KPYGCEVCGRHFR   30 (71)
Q Consensus        18 ~~~~c~~c~~~~~   30 (71)
                      +...|..|+..+.
T Consensus        45 kr~~Ck~C~~~li   57 (85)
T PF04032_consen   45 KRTICKKCGSLLI   57 (85)
T ss_dssp             CCTB-TTT--B--
T ss_pred             hcccccCCCCEEe
Confidence            4456777775443


No 343
>KOG2932|consensus
Probab=20.14  E-value=73  Score=18.57  Aligned_cols=24  Identities=13%  Similarity=0.276  Sum_probs=19.0

Q ss_pred             cCceeCC---hhhHhhhchHHHHHhhh
Q psy12265         46 VKAFQCE---YCGKDFARKYQAHSYHQ   69 (71)
Q Consensus        46 ~~~~~C~---~c~~~f~~~~~l~~h~~   69 (71)
                      .-.|-|.   -|.++|-...+|+-|+-
T Consensus       142 g~iFmC~~~~GC~RTyLsqrDlqAHIn  168 (389)
T KOG2932|consen  142 GGIFMCAAPHGCLRTYLSQRDLQAHIN  168 (389)
T ss_pred             cceEEeecchhHHHHHhhHHHHHHHhh
Confidence            4467775   39999999999998874


No 344
>PF09943 DUF2175:  Uncharacterized protein conserved in archaea (DUF2175);  InterPro: IPR018686  This family of various hypothetical archaeal proteins has no known function. 
Probab=20.01  E-value=49  Score=15.71  Aligned_cols=10  Identities=30%  Similarity=1.132  Sum_probs=7.4

Q ss_pred             ceeccccccc
Q psy12265         19 PYGCEVCGRH   28 (71)
Q Consensus        19 ~~~c~~c~~~   28 (71)
                      .|.|..|++.
T Consensus         2 kWkC~iCg~~   11 (101)
T PF09943_consen    2 KWKCYICGKP   11 (101)
T ss_pred             ceEEEecCCe
Confidence            4788888864


Done!