BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= psy12275
         (232 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|1AB8|A Chain A, Rat Type Ii Adenylyl Cyclase C2 DomainFORSKOLIN COMPLEX
 pdb|1AB8|B Chain B, Rat Type Ii Adenylyl Cyclase C2 DomainFORSKOLIN COMPLEX
          Length = 220

 Score = 37.7 bits (86), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 18/32 (56%), Positives = 22/32 (68%)

Query: 132 IIVLVEFAIALVTILDQINRESFQRFRLRMAI 163
           I  +VEFA ALV  LD IN+ SF  F+LR+ I
Sbjct: 99  IGTMVEFAYALVGKLDAINKHSFNDFKLRVGI 130


>pdb|1CUL|B Chain B, Complex Of Gs-Alpha With The Catalytic Domains Of
           Mammalian Adenylyl Cyclase: Complex With
           2',5'-Dideoxy-Adenosine 3'- Triphosphate And Mg
          Length = 208

 Score = 37.7 bits (86), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 18/32 (56%), Positives = 22/32 (68%)

Query: 132 IIVLVEFAIALVTILDQINRESFQRFRLRMAI 163
           I  +VEFA ALV  LD IN+ SF  F+LR+ I
Sbjct: 96  IGTMVEFAYALVGKLDAINKHSFNDFKLRVGI 127


>pdb|1AZS|B Chain B, Complex Of Gs-Alpha With The Catalytic Domains Of
           Mammalian Adenylyl Cyclase
 pdb|1CJK|B Chain B, Complex Of Gs-Alpha With The Catalytic Domains Of
           Mammalian Adenylyl Cyclase: Complex With Adenosine
           5'-(Alpha Thio)-Triphosphate (Rp), Mg, And Mn
 pdb|1CJT|B Chain B, Complex Of Gs-Alpha With The Catalytic Domains Of
           Mammalian Adenylyl Cyclase: Complex With
           Beta-L-2',3'-Dideoxyatp, Mn, And Mg
 pdb|1CJU|B Chain B, Complex Of Gs-Alpha With The Catalytic Domains Of
           Mammalian Adenylyl Cyclase: Complex With
           Beta-L-2',3'-Dideoxyatp And Mg
 pdb|1CJV|B Chain B, Complex Of Gs-Alpha With The Catalytic Domains Of
           Mammalian Adenylyl Cyclase: Complex With
           Beta-L-2',3'-Dideoxyatp, Mg, And Zn
 pdb|1CS4|B Chain B, Complex Of Gs-Alpha With The Catalytic Domains Of
           Mammalian Adenylyl Cyclase: Complex With
           2'-Deoxy-Adenosine 3'- Monophosphate, Pyrophosphate And
           Mg
 pdb|1TL7|B Chain B, Complex Of Gs- With The Catalytic Domains Of Mammalian
           Adenylyl Cyclase: Complex With 2'(3')-O-(N-
           Methylanthraniloyl)-Guanosine 5'-Triphosphate And Mn
 pdb|1U0H|B Chain B, Structural Basis For The Inhibition Of Mammalian Adenylyl
           Cyclase By Mant-gtp
 pdb|2GVD|B Chain B, Complex Of Gs- With The Catalytic Domains Of Mammalian
           Adenylyl Cyclase: Complex With Tnp-Atp And Mn
 pdb|2GVZ|B Chain B, Crystal Structure Of Complex Of Gs- With The Catalytic
           Domains Of Mammalian Adenylyl Cyclase: Complex With
           Mant- Atp And Mn
 pdb|3C14|B Chain B, Complex Of Gs-Alpha With The Catalytic Domains Of
           Mammalian Adenylyl Cyclase: Complex With Pyrophosphate
           And Ca
 pdb|3C15|B Chain B, Complex Of Gs-Alpha With The Catalytic Domains Of
           Mammalian Adenylyl Cyclase: Complex With Pyrophosphate
           And Mg
 pdb|3C16|B Chain B, Complex Of Gs-Alpha With The Catalytic Domains Of
           Mammalian Adenylyl Cyclase: Complex With
           Adenosine-5'-Triphosphate And Ca
 pdb|3G82|B Chain B, Complex Of Gs-Alpha With The Catalytic Domains Of
           Mammalian Adenylyl Cyclase: Complex With Mant-Itp And Mn
 pdb|3MAA|B Chain B, Complex Of Gs-alpha With The Catalytic Domains Of
           Mammalian Adenylyl Cyclase: Complex With Adenosine
           5-o-(l-thiophosphate) And Low Ca Concentration
          Length = 212

 Score = 37.7 bits (86), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 18/32 (56%), Positives = 22/32 (68%)

Query: 132 IIVLVEFAIALVTILDQINRESFQRFRLRMAI 163
           I  +VEFA ALV  LD IN+ SF  F+LR+ I
Sbjct: 100 IGTMVEFAYALVGKLDAINKHSFNDFKLRVGI 131


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.326    0.141    0.399 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 3,745,399
Number of Sequences: 62578
Number of extensions: 90322
Number of successful extensions: 188
Number of sequences better than 100.0: 3
Number of HSP's better than 100.0 without gapping: 3
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 185
Number of HSP's gapped (non-prelim): 3
length of query: 232
length of database: 14,973,337
effective HSP length: 96
effective length of query: 136
effective length of database: 8,965,849
effective search space: 1219355464
effective search space used: 1219355464
T: 11
A: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 50 (23.9 bits)