Diaphorina citri psyllid: psy12287


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70------
MKYLYKVCFNLGGTEGINLRKVEPWNSVRVTFTIPKEAAVRLRQLAQQGNATLLQLGILSVQVEGDELILTLHQAI
cHHHHHHHHHcccccccEEEEEccccCEEEEEEccHHHHHHHHHHHHHccHHHHHccEEEEEEccccEEEHHHHHc
*KYLYKVCFNLGGTEGINLRKVEPWNSVRVTFTIPKEAAVRLRQLAQQGNATLLQLGILSVQVEGDELILTLHQAI
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKYLYKVCFNLGGTEGINLRKVEPWNSVRVTFTIPKEAAVRLRQLAQQGNATLLQLGILSVQVEGDELILTLHQAI

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Nuclear receptor coactivator 6 Nuclear receptor coactivator that directly binds nuclear receptors and stimulates the transcriptional activities in a hormone-dependent fashion. Coactivates expression in an agonist-and AF2-dependent manner. Involved in the coactivation of different nuclear receptors, such as for steroids (GR and ERs), retinoids (RARs and RXRs), thyroid hormone (TRs), vitamin D3 (VDR) and prostanoids (PPARs). Probably functions as a general coactivator, rather than just a nuclear receptor coactivator. May also be involved in the coactivation of the NF-kappa-B pathway. May coactivate expression via a remodeling of chromatin and its interaction with histone acetyltransferase proteins.confidentQ14686
Nuclear receptor coactivator 6 Nuclear receptor coactivator that directly binds nuclear receptors and stimulates the transcriptional activities in a hormone-dependent fashion. Coactivates expression in an agonist-and AF2-dependent manner. Involved in the coactivation of different nuclear receptors, such as for steroids (GR and ERs), retinoids (RARs and RXRs), thyroid hormone (TRs), vitamin D3 (VDR) and prostanoids (PPARs). Probably functions as a general coactivator, rather than just a nuclear receptor coactivator. May also be involved in the coactivation of the NF-kappa-B pathway. May coactivate expression via a remodeling of chromatin and its interaction with histone acetyltransferase proteins. Involved in placental, cardiac, hepatic and embryonic development.confidentQ9JL19

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0051568 [BP]histone H3-K4 methylationprobableGO:0006479, GO:0008213, GO:0044699, GO:0044267, GO:0044260, GO:0006325, GO:0071840, GO:0016043, GO:0071704, GO:0034968, GO:0016571, GO:0016570, GO:0032259, GO:0009987, GO:0006464, GO:0043412, GO:0036211, GO:0043414, GO:0008152, GO:0006996, GO:0044238, GO:0051276, GO:0019538, GO:0044763, GO:0044237, GO:0043170, GO:0008150, GO:0016568, GO:0016569
GO:0003713 [MF]transcription coactivator activityprobableGO:0003674, GO:0003712, GO:0000989, GO:0000988
GO:0005667 [CC]transcription factor complexprobableGO:0043234, GO:0044446, GO:0032991, GO:0005575, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0005623, GO:0005622, GO:0005654, GO:0070013, GO:0043229, GO:0044428, GO:0031974, GO:0044424, GO:0044451, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0046966 [MF]thyroid hormone receptor bindingprobableGO:0008134, GO:0035257, GO:0003674, GO:0005488, GO:0005515, GO:0051427, GO:0005102
GO:0006352 [BP]DNA-dependent transcription, initiationprobableGO:0032774, GO:0090304, GO:0044249, GO:0034641, GO:0006807, GO:0034645, GO:1901362, GO:1901360, GO:1901576, GO:0044260, GO:0071704, GO:0010467, GO:0018130, GO:0006139, GO:0009987, GO:0006725, GO:0009058, GO:0009059, GO:0008150, GO:0008152, GO:0034654, GO:0046483, GO:0016070, GO:0044238, GO:0044271, GO:0044237, GO:0043170, GO:0006351, GO:0019438
GO:0005730 [CC]nucleolusprobableGO:0005575, GO:0043232, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0006974 [BP]response to DNA damage stimulusprobableGO:0051716, GO:0050896, GO:0009987, GO:0006950, GO:0044763, GO:0033554, GO:0008150, GO:0044699
GO:0045944 [BP]positive regulation of transcription from RNA polymerase II promoterprobableGO:0009893, GO:0019222, GO:0031328, GO:0031326, GO:0031325, GO:2001141, GO:0031323, GO:0010628, GO:0050789, GO:0080090, GO:0010604, GO:0051171, GO:0009891, GO:2000112, GO:0019219, GO:0010556, GO:0065007, GO:0048518, GO:0010468, GO:0045935, GO:0060255, GO:0009889, GO:0050794, GO:0008150, GO:0045893, GO:0051173, GO:0051252, GO:0051254, GO:0006355, GO:0010557, GO:0006357, GO:0048522
GO:0030099 [BP]myeloid cell differentiationprobableGO:0032502, GO:0002376, GO:0009987, GO:0044707, GO:0048856, GO:0048869, GO:0032501, GO:0030154, GO:0044767, GO:0048513, GO:0044763, GO:0008150, GO:0048731, GO:0030097, GO:0048534, GO:0007275, GO:0044699, GO:0002520
GO:0003682 [MF]chromatin bindingprobableGO:0003674, GO:0005488
GO:0044666 [CC]MLL3/4 complexprobableGO:0031974, GO:0043229, GO:0005623, GO:0043227, GO:0043226, GO:0034708, GO:0005575, GO:0031981, GO:0005634, GO:0005654, GO:0044451, GO:0043234, GO:0032991, GO:0043231, GO:0043233, GO:0044464, GO:0035097, GO:0005622, GO:0044446, GO:0070013, GO:0044428, GO:0044424, GO:0044422

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2K9I, chain A
Confidence level:probable
Coverage over the Query: 26-55
View the alignment between query and template
View the model in PyMOL