Query         psy12290
Match_columns 530
No_of_seqs    307 out of 1762
Neff          5.4 
Searched_HMMs 46136
Date          Fri Aug 16 23:33:04 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy12290.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/12290hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG1565|consensus              100.0 1.3E-53 2.7E-58  458.3  18.9  270    2-428   197-469 (469)
  2 cd00094 HX Hemopexin-like repe 100.0 4.9E-48 1.1E-52  371.7  21.8  192  232-427     1-194 (194)
  3 cd00094 HX Hemopexin-like repe 100.0 7.3E-33 1.6E-37  266.5  16.3  165  286-471     8-175 (194)
  4 KOG1565|consensus               99.8 9.2E-19   2E-23  189.2  11.3  135  286-427   291-427 (469)
  5 PF00045 Hemopexin:  Hemopexin;  99.3 3.1E-12 6.8E-17   95.7   3.5   45  334-381     1-45  (45)
  6 PF00413 Peptidase_M10:  Matrix  99.2 3.1E-12 6.7E-17  117.4   2.0   53   14-82    100-153 (154)
  7 cd04278 ZnMc_MMP Zinc-dependen  99.2 8.7E-12 1.9E-16  116.2   4.6   63    3-82     93-156 (157)
  8 smart00120 HX Hemopexin-like r  99.1 6.8E-11 1.5E-15   87.5   5.1   44  334-380     1-44  (45)
  9 cd04279 ZnMc_MMP_like_1 Zinc-d  99.0 9.7E-11 2.1E-15  109.0   3.4   53   16-82    101-155 (156)
 10 PF00045 Hemopexin:  Hemopexin;  99.0 2.1E-10 4.5E-15   85.8   4.4   44  239-282     1-45  (45)
 11 smart00120 HX Hemopexin-like r  98.8   1E-08 2.2E-13   75.8   4.7   44  383-428     1-44  (45)
 12 cd04268 ZnMc_MMP_like Zinc-dep  98.6 3.2E-08 6.9E-13   92.0   2.9   56   18-82     93-165 (165)
 13 smart00235 ZnMc Zinc-dependent  98.0 2.2E-06 4.7E-11   78.1   0.7   48   20-82     87-138 (140)
 14 cd00203 ZnMc Zinc-dependent me  97.8 1.6E-05 3.4E-10   73.8   3.1   52   18-82     95-167 (167)
 15 cd04277 ZnMc_serralysin_like Z  97.5 7.6E-05 1.7E-09   71.4   3.5   24   16-41    110-134 (186)
 16 PF12388 Peptidase_M57:  Dual-a  96.8 0.00075 1.6E-08   66.7   2.5   44   25-82    137-211 (211)
 17 cd04276 ZnMc_MMP_like_2 Zinc-d  95.6  0.0098 2.1E-07   58.4   3.3   27   19-48    116-143 (197)
 18 cd04267 ZnMc_ADAM_like Zinc-de  94.4    0.03 6.5E-07   53.6   3.0   31   20-50    132-173 (192)
 19 PF05572 Peptidase_M43:  Pregna  94.4   0.012 2.7E-07   55.4   0.3   18   24-41     72-90  (154)
 20 cd04327 ZnMc_MMP_like_3 Zinc-d  94.2   0.018 3.9E-07   56.0   0.9   25   18-44     91-116 (198)
 21 TIGR03548 mutarot_permut cycli  93.6     2.8 6.2E-05   43.2  15.8  144  241-400    67-232 (323)
 22 PHA03098 kelch-like protein; P  93.5     2.6 5.6E-05   46.6  16.3  143  241-411   337-514 (534)
 23 PLN02153 epithiospecifier prot  93.2     3.3 7.2E-05   43.1  15.7   15  241-255    80-94  (341)
 24 COG1913 Predicted Zn-dependent  93.0   0.049 1.1E-06   52.5   1.6   25   22-46    125-150 (181)
 25 cd04273 ZnMc_ADAMTS_like Zinc-  92.9   0.055 1.2E-06   52.8   1.9   49   21-82    140-198 (207)
 26 PF13574 Reprolysin_2:  Metallo  92.7   0.034 7.4E-07   53.1   0.1   21   21-41    111-132 (173)
 27 PLN02153 epithiospecifier prot  92.5     5.1 0.00011   41.7  16.0   15  241-255    27-41  (341)
 28 TIGR03548 mutarot_permut cycli  92.0     3.6 7.7E-05   42.5  14.0   59  242-310   119-192 (323)
 29 PRK13267 archaemetzincin-like   91.9   0.069 1.5E-06   51.8   1.2   22   25-46    129-151 (179)
 30 PF13583 Reprolysin_4:  Metallo  91.6   0.073 1.6E-06   52.4   0.9   19   19-39    137-156 (206)
 31 PRK14131 N-acetylneuraminic ac  91.3     2.7 5.9E-05   44.6  12.6   84  273-363    18-117 (376)
 32 cd04271 ZnMc_ADAM_fungal Zinc-  91.3    0.14   3E-06   51.3   2.6   44   24-82    148-217 (228)
 33 cd04275 ZnMc_pappalysin_like Z  91.3   0.046   1E-06   54.7  -0.8   25   16-42    134-159 (225)
 34 PLN02193 nitrile-specifier pro  91.0     6.5 0.00014   43.3  15.4  151  241-413   170-356 (470)
 35 PHA03098 kelch-like protein; P  90.9     8.8 0.00019   42.4  16.5  146  241-412   289-468 (534)
 36 TIGR03547 muta_rot_YjhT mutatr  90.9     7.9 0.00017   40.2  15.3   55  242-304    13-72  (346)
 37 PHA02713 hypothetical protein;  90.7     6.1 0.00013   44.6  15.3   54  241-304   298-360 (557)
 38 cd04269 ZnMc_adamalysin_II_lik  90.7    0.14 2.9E-06   49.3   1.8   29   22-50    132-167 (194)
 39 PF13688 Reprolysin_5:  Metallo  90.4   0.088 1.9E-06   50.4   0.3   22   21-42    142-164 (196)
 40 PRK14131 N-acetylneuraminic ac  90.3     9.4  0.0002   40.5  15.5   22  241-262    33-57  (376)
 41 TIGR03547 muta_rot_YjhT mutatr  90.0     5.8 0.00013   41.2  13.4  103  278-399     2-126 (346)
 42 PF07998 Peptidase_M54:  Peptid  89.8    0.11 2.3E-06   51.1   0.3   21   25-46    149-170 (194)
 43 cd04270 ZnMc_TACE_like Zinc-de  89.1    0.18   4E-06   50.8   1.4   49   23-82    169-229 (244)
 44 PLN02193 nitrile-specifier pro  89.1      17 0.00037   40.0  16.8   51  343-400   328-386 (470)
 45 cd04272 ZnMc_salivary_gland_MP  87.5    0.52 1.1E-05   46.5   3.4   19   19-37    143-162 (220)
 46 cd04280 ZnMc_astacin_like Zinc  86.9    0.23   5E-06   47.8   0.6   20   20-41     75-95  (180)
 47 cd04283 ZnMc_hatching_enzyme Z  84.4    0.37 8.1E-06   46.8   0.7   19   20-40     78-97  (182)
 48 COG5549 Predicted Zn-dependent  84.2    0.48   1E-05   47.1   1.3   48   15-82    183-232 (236)
 49 PF01400 Astacin:  Astacin (Pep  83.2    0.41 8.8E-06   46.5   0.3   20   22-41     80-100 (191)
 50 PF02031 Peptidase_M7:  Strepto  82.5    0.37   8E-06   44.4  -0.3   55   14-82     72-129 (132)
 51 COG3824 Predicted Zn-dependent  81.6    0.55 1.2E-05   42.9   0.5   11   25-35    113-124 (136)
 52 PF01421 Reprolysin:  Reprolysi  81.2    0.53 1.1E-05   45.5   0.3   25   25-49    135-168 (199)
 53 cd04281 ZnMc_BMP1_TLD Zinc-dep  80.9    0.58 1.2E-05   46.2   0.5   19   20-40     88-107 (200)
 54 cd04282 ZnMc_meprin Zinc-depen  80.3     0.7 1.5E-05   46.6   0.8   18   23-40    122-140 (230)
 55 PHA02713 hypothetical protein;  80.1      33 0.00071   38.8  14.0   54  241-304   346-407 (557)
 56 PF10462 Peptidase_M66:  Peptid  78.9    0.78 1.7E-05   48.1   0.7   14   25-38    197-211 (305)
 57 KOG3658|consensus               77.7     1.5 3.3E-05   50.1   2.5   63   25-92    396-471 (764)
 58 PF05548 Peptidase_M11:  Gameto  74.3     1.3 2.8E-05   46.6   0.8   17   23-39    152-169 (314)
 59 KOG4441|consensus               70.0   2E+02  0.0044   32.8  18.9  141  239-401   325-485 (571)
 60 KOG3714|consensus               68.8     1.8   4E-05   47.1   0.5   19   20-40    160-179 (411)
 61 PF12044 Metallopep:  Putative   66.3     2.9 6.2E-05   45.9   1.3   24   25-50    320-344 (423)
 62 PHA02790 Kelch-like protein; P  64.3 2.2E+02  0.0047   31.5  15.5  133  243-407   268-422 (480)
 63 PHA02790 Kelch-like protein; P  62.9 2.5E+02  0.0053   31.1  15.6   49  342-400   406-455 (480)
 64 TIGR00181 pepF oligoendopeptid  51.5     5.7 0.00012   44.9   0.5   15   18-32    375-389 (591)
 65 PF06262 DUF1025:  Possibl zinc  50.5     5.8 0.00013   34.9   0.3   11   25-35     77-88  (97)
 66 PF08450 SGL:  SMP-30/Gluconola  50.3 2.2E+02  0.0049   27.7  11.5  147  246-409    51-214 (246)
 67 TIGR03296 M6dom_TIGR03296 M6 f  49.1     5.9 0.00013   41.0   0.1   19   22-40    166-185 (286)
 68 cd06455 M3A_TOP Peptidase M3 T  48.2     9.8 0.00021   42.0   1.7   16   17-32    259-274 (472)
 69 TIGR02290 M3_fam_3 oligoendope  46.8     7.5 0.00016   44.0   0.5   15   18-32    372-386 (587)
 70 KOG3607|consensus               45.9     8.5 0.00018   45.0   0.8   17   22-38    324-341 (716)
 71 PF09471 Peptidase_M64:  IgA Pe  45.5     7.2 0.00016   40.2   0.1   18   19-38    216-235 (264)
 72 cd06459 M3B_Oligoendopeptidase  45.3     8.3 0.00018   41.2   0.5   15   18-32    219-233 (427)
 73 KOG4693|consensus               44.0 4.2E+02  0.0091   28.1  13.1   77  326-409   176-277 (392)
 74 PF06114 DUF955:  Domain of unk  43.9     8.2 0.00018   32.8   0.2   14   25-38     46-59  (122)
 75 TIGR02289 M3_not_pepF oligoend  42.8     9.4  0.0002   43.0   0.5   15   18-32    334-348 (549)
 76 KOG2719|consensus               42.5     3.2   7E-05   45.4  -3.1   27   18-46    279-305 (428)
 77 PF01432 Peptidase_M3:  Peptida  42.4      10 0.00022   41.3   0.7   17   16-32    237-253 (458)
 78 PF04298 Zn_peptidase_2:  Putat  39.6      14 0.00031   37.2   1.1   24   14-38     82-105 (222)
 79 KOG4441|consensus               38.3 3.8E+02  0.0082   30.6  12.4  137  343-504   332-481 (571)
 80 COG2856 Predicted Zn peptidase  38.2      12 0.00025   37.6   0.3    9   24-32     75-83  (213)
 81 cd08988 GH43_ABN Glycosyl hydr  37.0      92   0.002   31.6   6.6   65  332-397   118-189 (279)
 82 KOG4693|consensus               36.5 2.1E+02  0.0046   30.2   8.9   98  383-493   184-289 (392)
 83 COG1164 Oligoendopeptidase F [  36.5      14 0.00029   42.4   0.5   15   18-32    377-391 (598)
 84 cd06456 M3A_DCP_Oligopeptidase  35.1      21 0.00045   39.0   1.7   19   16-34    203-223 (422)
 85 cd06258 Peptidase_M3_like The   35.1      21 0.00046   37.5   1.7   16   17-32    150-165 (365)
 86 KOG4499|consensus               34.1 2.3E+02  0.0051   29.4   8.7   77  335-413   160-246 (310)
 87 PF13964 Kelch_6:  Kelch motif   33.3      58  0.0013   24.0   3.4   21  343-363    11-39  (50)
 88 cd06457 M3A_MIP Peptidase M3 m  32.4      22 0.00047   39.2   1.3   17   16-32    243-259 (458)
 89 TIGR02604 Piru_Ver_Nterm putat  31.9 6.4E+02   0.014   26.7  13.6   93  294-397    81-200 (367)
 90 COG5549 Predicted Zn-dependent  31.7      22 0.00048   35.7   1.0   26   26-51    158-184 (236)
 91 PF02191 OLF:  Olfactomedin-lik  31.3 4.8E+02    0.01   26.6  10.7   72  288-365    24-102 (250)
 92 PF05547 Peptidase_M6:  Immune   30.4      14 0.00031   42.7  -0.6   19   20-40    222-241 (645)
 93 KOG4525|consensus               29.4      31 0.00068   38.1   1.8   26   25-52    305-331 (614)
 94 KOG1924|consensus               28.7 4.4E+02  0.0095   31.7  10.6    6  255-260   642-647 (1102)
 95 COG2738 Predicted Zn-dependent  28.4      21 0.00047   35.5   0.3   29   19-49     92-124 (226)
 96 PF01435 Peptidase_M48:  Peptid  28.1      18 0.00039   34.8  -0.2   21   18-40     88-108 (226)
 97 KOG0379|consensus               27.1   9E+02    0.02   26.9  14.0   53  343-400   173-233 (482)
 98 PF11350 DUF3152:  Protein of u  27.0      23 0.00051   35.2   0.3   24   14-40    135-159 (203)
 99 PF13398 Peptidase_M50B:  Pepti  26.3      22 0.00047   34.9  -0.0   13   18-32     21-33  (200)
100 PF08450 SGL:  SMP-30/Gluconola  25.3 4.3E+02  0.0092   25.7   8.9  108  240-361    90-214 (246)
101 cd05709 S2P-M50 Site-2 proteas  24.2      27 0.00059   33.0   0.2   12   19-32      8-19  (180)
102 PF02163 Peptidase_M50:  Peptid  23.9      27  0.0006   33.2   0.2   20   20-41      8-29  (192)
103 KOG3538|consensus               23.2      30 0.00066   41.2   0.4   33   19-51    315-354 (845)
104 PRK10911 oligopeptidase A; Pro  22.5      29 0.00063   40.4   0.0   16   19-34    461-478 (680)
105 PF14564 Membrane_bind:  Membra  20.3      92   0.002   28.1   2.7   33  333-365    50-83  (110)

No 1  
>KOG1565|consensus
Probab=100.00  E-value=1.3e-53  Score=458.27  Aligned_cols=270  Identities=31%  Similarity=0.644  Sum_probs=231.6

Q ss_pred             CCCCCCCCCCCcccccchhhhhhhhhhhccc-cccCCCCCCCeeeecccCCCCccccCCceeecCCCCCCChhHHHHhhc
Q psy12290          2 LDDGWELPEDDKMAIQSLYGMNHSWATYGHW-ALSFKMTTIEAEFKWFDGGNSTICTNLSTEVLSPRNQRKKEDRIGESQ   80 (530)
Q Consensus         2 ~de~W~~~~~~~~~~~~l~~va~~~HE~GH~-GL~Hs~~~~~iM~p~y~~~~~~~~~~~~~~~l~~~~~~~~dD~~gi~~   80 (530)
                      .||.|++.   +..|+||++||  +|||||+ ||.||++++|||||+|+...       +++.|+      +||+.|||+
T Consensus       197 ~dE~Wt~~---~~~g~~l~~Va--~HEiGH~LGL~HS~~~~aiM~P~y~~~~-------~~~~L~------~DDv~giq~  258 (469)
T KOG1565|consen  197 KDETWTYG---DSNGVDLFLVA--AHEIGHALGLGHSSDPDAIMYPFYQPDS-------GNFDLS------QDDVRGIQH  258 (469)
T ss_pred             cccceecc---CCccchhHHHh--hhhcccccccCCCCCcccccccccccCC-------CCcccC------hhhhhhhHH
Confidence            68999996   35699999999  9999999 99999999999999999732       258888      999999999


Q ss_pred             cccccccccccccccccccccCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q psy12290         81 PFRERTLSICDRKEEKSWAVIPRYSPSPDLTTRRPEVPRPRHPTHHHPEHHPTPESPRREPPPRHPNQYPETPQDSPRRE  160 (530)
Q Consensus        81 ly~~~~~~~~G~~~~~~~~~~~~~~~~~~~tt~~p~~~~~~~p~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  160 (530)
                      ||        |....  +.      .+                             +.                      
T Consensus       259 lY--------G~~~~--~~------~~-----------------------------~~----------------------  271 (469)
T KOG1565|consen  259 LY--------GGPPR--DY------FM-----------------------------PS----------------------  271 (469)
T ss_pred             Hh--------CCCcc--cc------cc-----------------------------cc----------------------
Confidence            99        74210  00      00                             00                      


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCccccCCCCCCCCcCCCCCCCCCCCCCCCCCCCCCCCCcce
Q psy12290        161 PSLRQPNQYPETPHEPRRDSPPRHPNQFPETPRKPPARYPDIARAEPRTTPTTTTPPATRRGESNPGPSDKPDTCDTSYD  240 (530)
Q Consensus       161 p~~~~~~~~p~~~~~~~~~~~~~~~~~~~~~~~~p~~~~p~~~~~~~~~~~~~~~p~~t~~~~~~~~~~~~pd~C~~~fD  240 (530)
                                               .+  ..+. +                   .           ++...+..|+..||
T Consensus       272 -------------------------~~--~~~~-p-------------------~-----------~~~~~~~~~s~~fd  293 (469)
T KOG1565|consen  272 -------------------------GQ--RNPT-P-------------------S-----------SSGPEPSRCSGHFD  293 (469)
T ss_pred             -------------------------cc--CCCC-C-------------------C-----------CCCCCCCcCCCCcc
Confidence                                     00  0000 0                   0           00123577888999


Q ss_pred             eeEEeC-CEEEEEECCeEEEEcCCCccCCCceecccccccCCCCCccccceEEeeCCcEEEEEceeEEEecceecCCCCC
Q psy12290        241 AIAVIR-TEVFVFKDRWMWRIGDKGVLPGYPVLIHQFWSELPHNLTHIDAVYQRIDNHIAFFIGRQYFLFEGIRLLPGYP  319 (530)
Q Consensus       241 Avt~ir-GeiyfFKG~~~WR~~~~~~~~gyP~~Is~~WpGLP~~~~~IDAAye~~~gktyFFKG~~yW~y~~~~l~~GYP  319 (530)
                      ||++++ |++||||+++|||+.... +.++|.+|+++|+|||..   |||||+ .++++|||||++||+|.+.++..|||
T Consensus       294 av~~~~~g~~~ffk~~~~Wr~~~~~-~~~~p~~I~~~w~glP~~---vdAa~e-~~~~~~ffkg~~~w~~~~~~~~~gyp  368 (469)
T KOG1565|consen  294 AVTTDRHGETYFFKGRHFWRLTTSG-DGREPRPISRFWPGLPGA---VDAAYE-WDGKIYFFKGAQFWSYAGYTLVPGYP  368 (469)
T ss_pred             eEeeccccceEEecCceeEeeeccC-cCCCcccHhhcCCCCcch---hhhhhh-ccCcEEEecCCeeEEEecccccCCCC
Confidence            999987 999999999999999887 778999999999999986   999999 89999999999999999999999999


Q ss_pred             ccccc-CCCCCcccccccEEEeccCCeEEEeeCCeEEEEeCCCCcccCCCCcccccCCCCCCCCCCEEEecCCCcEEEEE
Q psy12290        320 RPLTA-LGLPASLERIDAAMVWGYNSKTYLFSGTRYWKLDDETGRSEPDYPRNMTENWRGVGVDIDDAFQWKDGATYFFK  398 (530)
Q Consensus       320 K~Is~-~GlP~~~~~IDAAf~~~~ngktYFFkG~~YWryde~~~~vd~gYPk~Is~~w~GvP~~IDAAf~~~~G~~YFFk  398 (530)
                      |.|.+ .|++..+. ||||+.|..++++|||+|++|||||+..+.|+.+||+.|. .|+|+   +||+++ .++.+|||+
T Consensus       369 r~l~~~~~~~~~~~-idaa~~~~~~~kt~ff~g~~~wr~d~~~~~~d~~~p~~~~-~~~gi---~~a~~~-~~~~~Yff~  442 (469)
T KOG1565|consen  369 KKLYRSVGFPPRGR-IDAARFWPANGKTYFFSGRRYWRYDEKSRAMDWGYPKWIH-KFPGI---GDASFS-NGGSVYFFS  442 (469)
T ss_pred             cchhhccccCCCCc-eeeeEeccCCCceEEEecceeeeehhhhcccccCCCcchh-hccCc---cchhhh-cCceEEEEe
Confidence            99998 46776656 9999999999999999999999999999999999999999 99999   999999 667999999


Q ss_pred             CCeEEEEecccceeeccCCCcccccccCCC
Q psy12290        399 GKGFWKFKDVSMRVEKEKPSPSAQFWMKCP  428 (530)
Q Consensus       399 G~~Ywrfd~~~~~V~~~yPr~ia~~W~gCp  428 (530)
                      |++||+||....+|+.+||+++   ||+|+
T Consensus       443 g~~y~~~d~~~~~v~~~~~~~~---wl~C~  469 (469)
T KOG1565|consen  443 GPKYYRYDDRNLRVEPPYPRNI---WLGCT  469 (469)
T ss_pred             CCeeEeeCchHhhccccCCcce---eccCC
Confidence            9999999999999999999987   99996


No 2  
>cd00094 HX Hemopexin-like repeats.; Hemopexin is a heme-binding protein that transports heme to the liver. Hemopexin-like repeats occur in vitronectin and some matrix metalloproteinases family (matrixins). The HX repeats of some matrixins bind tissue inhibitor of metalloproteinases (TIMPs). This CD contains 4 instances of the repeat.
Probab=100.00  E-value=4.9e-48  Score=371.69  Aligned_cols=192  Identities=42%  Similarity=0.973  Sum_probs=180.2

Q ss_pred             CCCCCC-cceeeEEeCCEEEEEECCeEEEEcCCCccCCCceecccccccCCCCCccccceEEeeC-CcEEEEEceeEEEe
Q psy12290        232 PDTCDT-SYDAIAVIRTEVFVFKDRWMWRIGDKGVLPGYPVLIHQFWSELPHNLTHIDAVYQRID-NHIAFFIGRQYFLF  309 (530)
Q Consensus       232 pd~C~~-~fDAvt~irGeiyfFKG~~~WR~~~~~~~~gyP~~Is~~WpGLP~~~~~IDAAye~~~-gktyFFKG~~yW~y  309 (530)
                      ++.|+. .+|||++++|++|||||++||+++.. ...++|++|++.|++||..   |||||+..+ +++|||||++||+|
T Consensus         1 ~~~C~~~~iDA~~~~~g~~y~FkG~~~w~~~~~-~~~~~p~~I~~~w~~~p~~---IDAa~~~~~~~~~yfFkg~~yw~~   76 (194)
T cd00094           1 PDACDPLSFDAVTTLRGELYFFKGRYFWRLSPG-KPPGSPFLISSFWPSLPSP---VDAAFERPDTGKIYFFKGDKYWVY   76 (194)
T ss_pred             CCcCCCCcCCeEEEeCCEEEEEeCCEEEEEeCC-CCCCCCeEhhhhCCCCCCC---ccEEEEECCCCEEEEECCCEEEEE
Confidence            478988 89999998899999999999999877 5678999999999999975   999999875 99999999999999


Q ss_pred             cceecCCCCCcccccCCCCCcccccccEEEeccCCeEEEeeCCeEEEEeCCCCcccCCCCcccccCCCCCCCCCCEEEec
Q psy12290        310 EGIRLLPGYPRPLTALGLPASLERIDAAMVWGYNSKTYLFSGTRYWKLDDETGRSEPDYPRNMTENWRGVGVDIDDAFQW  389 (530)
Q Consensus       310 ~~~~l~~GYPK~Is~~GlP~~~~~IDAAf~~~~ngktYFFkG~~YWryde~~~~vd~gYPk~Is~~w~GvP~~IDAAf~~  389 (530)
                      ++..++.||||.|+++|+|..+++|||||.|+.++++|||||++||+||...++|+.+||+.|++.|+|||.+|||||++
T Consensus        77 ~~~~~~~~~Pk~i~~~~~~~~~~~iDAA~~~~~~~~~yfFkg~~y~ry~~~~~~v~~~yP~~i~~~w~g~p~~idaa~~~  156 (194)
T cd00094          77 TGKNLEPGYPKPISDLGFPPTVKQIDAALRWPDNGKTYFFKGDKYWRYDEKTQKMDPGYPKLIETDFPGVPDKVDAAFRW  156 (194)
T ss_pred             cCcccccCCCcchhhcCCCCCCCCccEEEEEcCCCEEEEEeCCEEEEEeCCCccccCCCCcchhhcCCCcCCCcceeEEe
Confidence            99888999999999888887668999999997789999999999999999989999999999999999999999999999


Q ss_pred             CCCcEEEEECCeEEEEecccceeeccCCCcccccccCC
Q psy12290        390 KDGATYFFKGKGFWKFKDVSMRVEKEKPSPSAQFWMKC  427 (530)
Q Consensus       390 ~~G~~YFFkG~~Ywrfd~~~~~V~~~yPr~ia~~W~gC  427 (530)
                      .+|++|||+|++||+||..+++|+.+||+.++..||+|
T Consensus       157 ~~~~~yfF~g~~y~~~d~~~~~~~~~~p~~~~~~w~~C  194 (194)
T cd00094         157 LDGYYYFFKGDQYWRFDPRSKEVRVGYPLKISSDWLGC  194 (194)
T ss_pred             CCCcEEEEECCEEEEEeCccceecCCcccCccccccCC
Confidence            88999999999999999999989999999999999999


No 3  
>cd00094 HX Hemopexin-like repeats.; Hemopexin is a heme-binding protein that transports heme to the liver. Hemopexin-like repeats occur in vitronectin and some matrix metalloproteinases family (matrixins). The HX repeats of some matrixins bind tissue inhibitor of metalloproteinases (TIMPs). This CD contains 4 instances of the repeat.
Probab=100.00  E-value=7.3e-33  Score=266.47  Aligned_cols=165  Identities=24%  Similarity=0.466  Sum_probs=138.3

Q ss_pred             cccceEEeeCCcEEEEEceeEEEecceecCCCCCcccccCCCCCcccccccEEEeccCCeEEEeeCCeEEEEeCCCCccc
Q psy12290        286 HIDAVYQRIDNHIAFFIGRQYFLFEGIRLLPGYPRPLTALGLPASLERIDAAMVWGYNSKTYLFSGTRYWKLDDETGRSE  365 (530)
Q Consensus       286 ~IDAAye~~~gktyFFKG~~yW~y~~~~l~~GYPK~Is~~GlP~~~~~IDAAf~~~~ngktYFFkG~~YWryde~~~~vd  365 (530)
                      .||||++.. |++|||||++||+++.. +..|+|+.|++ ++|+.+++|||||.+..+|++|||||++||+|+...  ++
T Consensus         8 ~iDA~~~~~-g~~y~FkG~~~w~~~~~-~~~~~p~~I~~-~w~~~p~~IDAa~~~~~~~~~yfFkg~~yw~~~~~~--~~   82 (194)
T cd00094           8 SFDAVTTLR-GELYFFKGRYFWRLSPG-KPPGSPFLISS-FWPSLPSPVDAAFERPDTGKIYFFKGDKYWVYTGKN--LE   82 (194)
T ss_pred             cCCeEEEeC-CEEEEEeCCEEEEEeCC-CCCCCCeEhhh-hCCCCCCCccEEEEECCCCEEEEECCCEEEEEcCcc--cc
Confidence            499999975 99999999999999987 67899999998 455555789999999777999999999999999875  88


Q ss_pred             CCCCcccccCCCCCC--CCCCEEEecC-CCcEEEEECCeEEEEecccceeeccCCCcccccccCCCCCCCCCcccccccc
Q psy12290        366 PDYPRNMTENWRGVG--VDIDDAFQWK-DGATYFFKGKGFWKFKDVSMRVEKEKPSPSAQFWMKCPEISSPEDRISERRV  442 (530)
Q Consensus       366 ~gYPk~Is~~w~GvP--~~IDAAf~~~-~G~~YFFkG~~Ywrfd~~~~~V~~~yPr~ia~~W~gCp~~~~~~~~i~~~~~  442 (530)
                      .+|||.|++ |.+.+  .+|||||++. +|++|||+|++||+|+....+|+.+||+.+++.|+|||.+++++   .... 
T Consensus        83 ~~~Pk~i~~-~~~~~~~~~iDAA~~~~~~~~~yfFkg~~y~ry~~~~~~v~~~yP~~i~~~w~g~p~~idaa---~~~~-  157 (194)
T cd00094          83 PGYPKPISD-LGFPPTVKQIDAALRWPDNGKTYFFKGDKYWRYDEKTQKMDPGYPKLIETDFPGVPDKVDAA---FRWL-  157 (194)
T ss_pred             cCCCcchhh-cCCCCCCCCccEEEEEcCCCEEEEEeCCEEEEEeCCCccccCCCCcchhhcCCCcCCCccee---EEeC-
Confidence            999999997 65544  8999999997 78999999999999999999999999999999999999877553   1111 


Q ss_pred             CceEEEeecCCCceecccccceEEEEecC
Q psy12290        443 GRAFSSRSTSGGLRQGASFKAQFYHVRCS  471 (530)
Q Consensus       443 g~~y~~~~t~~~~~~~~~~~~~~~~~~~~  471 (530)
                                ++...++| +.+||+....
T Consensus       158 ----------~~~~yfF~-g~~y~~~d~~  175 (194)
T cd00094         158 ----------DGYYYFFK-GDQYWRFDPR  175 (194)
T ss_pred             ----------CCcEEEEE-CCEEEEEeCc
Confidence                      13444555 6677877544


No 4  
>KOG1565|consensus
Probab=99.77  E-value=9.2e-19  Score=189.20  Aligned_cols=135  Identities=27%  Similarity=0.507  Sum_probs=117.8

Q ss_pred             cccceEEeeCCcEEEEEceeEEEecceecCCCCCcccccCCCCCcccccccEEEeccCCeEEEeeCCeEEEEeCCCCccc
Q psy12290        286 HIDAVYQRIDNHIAFFIGRQYFLFEGIRLLPGYPRPLTALGLPASLERIDAAMVWGYNSKTYLFSGTRYWKLDDETGRSE  365 (530)
Q Consensus       286 ~IDAAye~~~gktyFFKG~~yW~y~~~~l~~GYPK~Is~~GlP~~~~~IDAAf~~~~ngktYFFkG~~YWryde~~~~vd  365 (530)
                      .+||+.....++++|||+..||++.... +.++|+.|+. .+|+.+..||||++  ..+++|||||++||.|...  ++.
T Consensus       291 ~fdav~~~~~g~~~ffk~~~~Wr~~~~~-~~~~p~~I~~-~w~glP~~vdAa~e--~~~~~~ffkg~~~w~~~~~--~~~  364 (469)
T KOG1565|consen  291 HFDAVTTDRHGETYFFKGRHFWRLTTSG-DGREPRPISR-FWPGLPGAVDAAYE--WDGKIYFFKGAQFWSYAGY--TLV  364 (469)
T ss_pred             CcceEeeccccceEEecCceeEeeeccC-cCCCcccHhh-cCCCCcchhhhhhh--ccCcEEEecCCeeEEEecc--ccc
Confidence            5899998777999999999999999877 7799999998 33444458999998  5799999999999999986  578


Q ss_pred             CCCCcccccCCCCCCCC-CCEEEecC-CCcEEEEECCeEEEEecccceeeccCCCcccccccCC
Q psy12290        366 PDYPRNMTENWRGVGVD-IDDAFQWK-DGATYFFKGKGFWKFKDVSMRVEKEKPSPSAQFWMKC  427 (530)
Q Consensus       366 ~gYPk~Is~~w~GvP~~-IDAAf~~~-~G~~YFFkG~~Ywrfd~~~~~V~~~yPr~ia~~W~gC  427 (530)
                      .||||.|.+.....+.. ||||+.|. +|++|||+|++||+||.....++.+||+.+. .|.|.
T Consensus       365 ~gypr~l~~~~~~~~~~~idaa~~~~~~~kt~ff~g~~~wr~d~~~~~~d~~~p~~~~-~~~gi  427 (469)
T KOG1565|consen  365 PGYPKKLYRSVGFPPRGRIDAARFWPANGKTYFFSGRRYWRYDEKSRAMDWGYPKWIH-KFPGI  427 (469)
T ss_pred             CCCCcchhhccccCCCCceeeeEeccCCCceEEEecceeeeehhhhcccccCCCcchh-hccCc
Confidence            99999999766555543 99999997 6789999999999999999889999999998 88888


No 5  
>PF00045 Hemopexin:  Hemopexin;  InterPro: IPR018487 Hemopexin (3.2.1.35 from EC) is a serum glycoprotein that binds haem and transports it to the liver for breakdown and iron recovery, after which the free hemopexin returns to the circulation []. Hemopexin prevents haem-mediated oxidative stress. Structurally hemopexin consists of two similar halves of approximately two hundred amino acid residues connected by a histidine-rich hinge region. Each half is itself formed by the repetition of a basic unit of some 35 to 45 residues. Hemopexin-like domains have been found in two other types of proteins, vitronectin [], a cell adhesion and spreading factor found in plasma and tissues, and matrixins MMP-1, MMP-2, MMP-3, MMP-9, MMP-10, MMP-11, MMP-12, MMP-14, MMP-15 and MMP-16, members of the matrix metalloproteinase family that cleave extracellular matrix constituents []. These zinc endopeptidases, which belong to MEROPS peptidase subfamily M10A, have a single hemopexin-like domain in their C-terminal section. It is suggested that the hemopexin domain facilitates binding to a variety of molecules and proteins, for example the HX repeats of some matrixins bind tissue inhibitor of metallopeptidases (TIMPs). This entry represents the repeat found in hempoxein and related domains.; PDB: 1SU3_B 2CLT_B 3V6N_B 3C7X_A 1GXD_A 1RTG_A 1CK7_A 1GEN_A 1ITV_A 2JXY_A ....
Probab=99.26  E-value=3.1e-12  Score=95.71  Aligned_cols=45  Identities=44%  Similarity=1.139  Sum_probs=41.6

Q ss_pred             cccEEEeccCCeEEEeeCCeEEEEeCCCCcccCCCCcccccCCCCCCC
Q psy12290        334 IDAAMVWGYNSKTYLFSGTRYWKLDDETGRSEPDYPRNMTENWRGVGV  381 (530)
Q Consensus       334 IDAAf~~~~ngktYFFkG~~YWryde~~~~vd~gYPk~Is~~w~GvP~  381 (530)
                      |||||.+.. |++|||||++||+|++.  +++.|||+.|++.|+|||.
T Consensus         1 iDAa~~~~~-g~~yfFkg~~ywr~~~~--~~~~gyP~~i~~~w~glp~   45 (45)
T PF00045_consen    1 IDAAFQWGN-GKTYFFKGNQYWRFDES--KVDPGYPRPISDFWPGLPC   45 (45)
T ss_dssp             ESEEEEETT-TEEEEEETTEEEEEETT--EETTCEEEEHHHHSTTSTS
T ss_pred             CeEEEEeCC-CcEEEEECCEEEEEcCc--ccCCCcCEEhhhCCCcCCC
Confidence            799999854 99999999999999997  7899999999999999973


No 6  
>PF00413 Peptidase_M10:  Matrixin This Prosite motif covers only the active site.;  InterPro: IPR001818 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry based on a common structural fold:  Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases.   In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding.  Metalloproteases are the most diverse of the four main types of protease, with more than 50 families identified to date. In these enzymes, a divalent cation, usually zinc, activates the water molecule. The metal ion is held in place by amino acid ligands, usually three in number. The known metal ligands are His, Glu, Asp or Lys and at least one other residue is required for catalysis, which may play an electrophillic role. Of the known metalloproteases, around half contain an HEXXH motif, which has been shown in crystallographic studies to form part of the metal-binding site []. The HEXXH motif is relatively common, but can be more stringently defined for metalloproteases as 'abXHEbbHbc', where 'a' is most often valine or threonine and forms part of the S1' subsite in thermolysin and neprilysin, 'b' is an uncharged residue, and 'c' a hydrophobic residue. Proline is never found in this site, possibly because it would break the helical structure adopted by this motif in metalloproteases []. This group of metallopeptidases belong to the MEROPS peptidase family M10 (clan MA(M)).  The protein fold of the peptidase domain for members of this family resembles that of thermolysin, the type example for clan MA. Sequences having this domain are extracellular metalloproteases, such as collagenase and stromelysin, which degrade the extracellular matrix, are known as matrixins. They are zinc-dependent, calcium-activated proteases synthesised as inactive precursors (zymogens), which are proteolytically cleaved to yield the active enzyme [, ]. All matrixins and related proteins possess 2 domains: an N-terminal domain, and a zinc-binding active site domain. The N-terminal domain peptide, cleaved during the activation step, includes a conserved PRCGVPDV octapeptide, known as the cysteine switch, whose Cys residue chelates the active site zinc atom, rendering the enzyme inactive [, ]. The active enzyme degrades components of the extracellular matrix, playing a role in the initial steps of tissue remodelling during morphogenesis, wound healing, angiogenesis and tumour invasion [, ].; GO: 0004222 metalloendopeptidase activity, 0008270 zinc ion binding, 0006508 proteolysis, 0031012 extracellular matrix; PDB: 1Q3A_C 3V96_B 1HV5_D 1CXV_A 1SRP_A 1FBL_A 1ZVX_A 1JH1_A 1I76_A 2OY4_A ....
Probab=99.22  E-value=3.1e-12  Score=117.43  Aligned_cols=53  Identities=17%  Similarity=0.246  Sum_probs=46.5

Q ss_pred             ccccchhhhhhhhhhhccc-cccCCCCCCCeeeecccCCCCccccCCceeecCCCCCCChhHHHHhhccc
Q psy12290         14 MAIQSLYGMNHSWATYGHW-ALSFKMTTIEAEFKWFDGGNSTICTNLSTEVLSPRNQRKKEDRIGESQPF   82 (530)
Q Consensus        14 ~~~~~l~~va~~~HE~GH~-GL~Hs~~~~~iM~p~y~~~~~~~~~~~~~~~l~~~~~~~~dD~~gi~~ly   82 (530)
                      ..+.+|+.|+  +|||||+ ||.|+.++.++|+|+|.+.. .       ..|+      .+||.+||+||
T Consensus       100 ~~~~~~~~v~--~HEiGHaLGL~H~~~~~svM~~~~~~~~-~-------~~l~------~~Di~~i~~lY  153 (154)
T PF00413_consen  100 DSGNDLQSVA--IHEIGHALGLDHSNDPNSVMYPYYRGPD-N-------KTLS------EDDIDGIQYLY  153 (154)
T ss_dssp             SSSEEHHHHH--HHHHHHHTTBESSSSTTSTTSSSCTSSS-S-------TSTT------HHHHHHHHHHH
T ss_pred             hhhhhhhhhh--hhccccccCcCcCCCcccceeeecccCC-C-------CCCC------HHHHHHHHHHh
Confidence            3567899999  9999999 99999999999999998753 1       2566      99999999999


No 7  
>cd04278 ZnMc_MMP Zinc-dependent metalloprotease, matrix metalloproteinase (MMP) sub-family. MMPs are responsible for a great deal of pericellular proteolysis of extracellular matrix and cell surface molecules, playing crucial roles in morphogenesis, cell fate specification, cell migration, tissue repair, tumorigenesis, gain or loss of tissue-specific functions, and apoptosis. In many instances, they are anchored to cell membranes via trans-membrane domains, and their activity is controlled via TIMPs (tissue inhibitors of metalloproteinases).
Probab=99.21  E-value=8.7e-12  Score=116.23  Aligned_cols=63  Identities=19%  Similarity=0.318  Sum_probs=51.9

Q ss_pred             CCCCCCCCCCcccccchhhhhhhhhhhccc-cccCCCCCCCeeeecccCCCCccccCCceeecCCCCCCChhHHHHhhcc
Q psy12290          3 DDGWELPEDDKMAIQSLYGMNHSWATYGHW-ALSFKMTTIEAEFKWFDGGNSTICTNLSTEVLSPRNQRKKEDRIGESQP   81 (530)
Q Consensus         3 de~W~~~~~~~~~~~~l~~va~~~HE~GH~-GL~Hs~~~~~iM~p~y~~~~~~~~~~~~~~~l~~~~~~~~dD~~gi~~l   81 (530)
                      ++.|.+..  ...+.+++.|+  +|||||+ ||.|+.++.+||||+|.+...       ...|+      .+|+.+||+|
T Consensus        93 ~~~~~~~~--~~~~~~~~~~~--~HEiGHaLGL~H~~~~~~vM~~~~~~~~~-------~~~l~------~~D~~~~~~l  155 (157)
T cd04278          93 DEQWTLGS--DSGGTDLFSVA--AHEIGHALGLGHSSDPDSIMYPYYQGPVP-------KFKLS------QDDIRGIQAL  155 (157)
T ss_pred             CcccccCC--CCccchHHHHH--HHHhccccccCCCCCCcCeecccccCCCc-------CCCCC------HHHHHHHHHh
Confidence            45566643  23578899999  9999999 999999999999999987521       24677      9999999999


Q ss_pred             c
Q psy12290         82 F   82 (530)
Q Consensus        82 y   82 (530)
                      |
T Consensus       156 Y  156 (157)
T cd04278         156 Y  156 (157)
T ss_pred             c
Confidence            9


No 8  
>smart00120 HX Hemopexin-like repeats. Hemopexin is a heme-binding protein that transports heme to the liver. Hemopexin-like repeats occur in vitronectin and some matrix  metalloproteinases family (matrixins). The HX repeats of some matrixins  bind tissue inhibitor of metalloproteinases (TIMPs).
Probab=99.13  E-value=6.8e-11  Score=87.53  Aligned_cols=44  Identities=39%  Similarity=0.866  Sum_probs=40.6

Q ss_pred             cccEEEeccCCeEEEeeCCeEEEEeCCCCcccCCCCcccccCCCCCC
Q psy12290        334 IDAAMVWGYNSKTYLFSGTRYWKLDDETGRSEPDYPRNMTENWRGVG  380 (530)
Q Consensus       334 IDAAf~~~~ngktYFFkG~~YWryde~~~~vd~gYPk~Is~~w~GvP  380 (530)
                      ||||+.+. +|++|||||++||+|+..+  |+.+||+.|++.|+|+|
T Consensus         1 iDAa~~~~-~~~~yfFkg~~yw~~~~~~--~~~~~p~~i~~~~~~lp   44 (45)
T smart00120        1 IDAAFELR-NGKTYFFKGDKYWRFDPKR--VDPGYPKLISSFFPGLP   44 (45)
T ss_pred             CeEEEEeC-CCeEEEEeCCEEEEEcCCc--cCCCCCeEhhhcCCCCC
Confidence            79999986 8899999999999999864  88999999999999997


No 9  
>cd04279 ZnMc_MMP_like_1 Zinc-dependent metalloprotease; MMP_like sub-family 1. A group of bacterial, archaeal, and fungal metalloproteinase domains similar to matrix metalloproteinases and astacin.
Probab=99.04  E-value=9.7e-11  Score=108.99  Aligned_cols=53  Identities=17%  Similarity=0.176  Sum_probs=45.7

Q ss_pred             ccchhhhhhhhhhhccc-cccCCCCCC-CeeeecccCCCCccccCCceeecCCCCCCChhHHHHhhccc
Q psy12290         16 IQSLYGMNHSWATYGHW-ALSFKMTTI-EAEFKWFDGGNSTICTNLSTEVLSPRNQRKKEDRIGESQPF   82 (530)
Q Consensus        16 ~~~l~~va~~~HE~GH~-GL~Hs~~~~-~iM~p~y~~~~~~~~~~~~~~~l~~~~~~~~dD~~gi~~ly   82 (530)
                      +.+|++||  +|||||+ ||.|+.... ++|||++.....      .+..|+      .+|+.+|+.||
T Consensus       101 ~~~~~~~~--~HEiGHaLGL~H~~~~~~siM~p~~~~~~~------~~~~l~------~~D~~~i~~lY  155 (156)
T cd04279         101 AENLQAIA--LHELGHALGLWHHSDRPEDAMYPSQGQGPD------GNPTLS------ARDVATLKRLY  155 (156)
T ss_pred             chHHHHHH--HHHhhhhhcCCCCCCCccceeeeecccCCc------CcCCCC------HHHHHHHHHHh
Confidence            56899999  9999999 999999999 999999986422      134566      99999999999


No 10 
>PF00045 Hemopexin:  Hemopexin;  InterPro: IPR018487 Hemopexin (3.2.1.35 from EC) is a serum glycoprotein that binds haem and transports it to the liver for breakdown and iron recovery, after which the free hemopexin returns to the circulation []. Hemopexin prevents haem-mediated oxidative stress. Structurally hemopexin consists of two similar halves of approximately two hundred amino acid residues connected by a histidine-rich hinge region. Each half is itself formed by the repetition of a basic unit of some 35 to 45 residues. Hemopexin-like domains have been found in two other types of proteins, vitronectin [], a cell adhesion and spreading factor found in plasma and tissues, and matrixins MMP-1, MMP-2, MMP-3, MMP-9, MMP-10, MMP-11, MMP-12, MMP-14, MMP-15 and MMP-16, members of the matrix metalloproteinase family that cleave extracellular matrix constituents []. These zinc endopeptidases, which belong to MEROPS peptidase subfamily M10A, have a single hemopexin-like domain in their C-terminal section. It is suggested that the hemopexin domain facilitates binding to a variety of molecules and proteins, for example the HX repeats of some matrixins bind tissue inhibitor of metallopeptidases (TIMPs). This entry represents the repeat found in hempoxein and related domains.; PDB: 1SU3_B 2CLT_B 3V6N_B 3C7X_A 1GXD_A 1RTG_A 1CK7_A 1GEN_A 1ITV_A 2JXY_A ....
Probab=99.04  E-value=2.1e-10  Score=85.82  Aligned_cols=44  Identities=36%  Similarity=0.714  Sum_probs=41.1

Q ss_pred             ceeeEEeC-CEEEEEECCeEEEEcCCCccCCCceecccccccCCC
Q psy12290        239 YDAIAVIR-TEVFVFKDRWMWRIGDKGVLPGYPVLIHQFWSELPH  282 (530)
Q Consensus       239 fDAvt~ir-GeiyfFKG~~~WR~~~~~~~~gyP~~Is~~WpGLP~  282 (530)
                      ||||++.+ |++|||||++|||++...+..|||++|++.|+|||.
T Consensus         1 iDAa~~~~~g~~yfFkg~~ywr~~~~~~~~gyP~~i~~~w~glp~   45 (45)
T PF00045_consen    1 IDAAFQWGNGKTYFFKGNQYWRFDESKVDPGYPRPISDFWPGLPC   45 (45)
T ss_dssp             ESEEEEETTTEEEEEETTEEEEEETTEETTCEEEEHHHHSTTSTS
T ss_pred             CeEEEEeCCCcEEEEECCEEEEEcCcccCCCcCEEhhhCCCcCCC
Confidence            69999987 999999999999999887889999999999999984


No 11 
>smart00120 HX Hemopexin-like repeats. Hemopexin is a heme-binding protein that transports heme to the liver. Hemopexin-like repeats occur in vitronectin and some matrix  metalloproteinases family (matrixins). The HX repeats of some matrixins  bind tissue inhibitor of metalloproteinases (TIMPs).
Probab=98.76  E-value=1e-08  Score=75.77  Aligned_cols=44  Identities=39%  Similarity=0.841  Sum_probs=39.1

Q ss_pred             CCEEEecCCCcEEEEECCeEEEEecccceeeccCCCcccccccCCC
Q psy12290        383 IDDAFQWKDGATYFFKGKGFWKFKDVSMRVEKEKPSPSAQFWMKCP  428 (530)
Q Consensus       383 IDAAf~~~~G~~YFFkG~~Ywrfd~~~~~V~~~yPr~ia~~W~gCp  428 (530)
                      ||||+.+.+|++|||||++||+|+..+  ++.++|+.++..|.+.|
T Consensus         1 iDAa~~~~~~~~yfFkg~~yw~~~~~~--~~~~~p~~i~~~~~~lp   44 (45)
T smart00120        1 IDAAFELRNGKTYFFKGDKYWRFDPKR--VDPGYPKLISSFFPGLP   44 (45)
T ss_pred             CeEEEEeCCCeEEEEeCCEEEEEcCCc--cCCCCCeEhhhcCCCCC
Confidence            799999998899999999999999765  78899999999886654


No 12 
>cd04268 ZnMc_MMP_like Zinc-dependent metalloprotease, MMP_like subfamily. This group contains matrix metalloproteinases (MMPs), serralysins, and the astacin_like family of proteases.
Probab=98.56  E-value=3.2e-08  Score=92.01  Aligned_cols=56  Identities=11%  Similarity=-0.112  Sum_probs=41.8

Q ss_pred             chhhhhhhhhhhccc-cccCCCC----------------CCCeeeecccCCCCccccCCceeecCCCCCCChhHHHHhhc
Q psy12290         18 SLYGMNHSWATYGHW-ALSFKMT----------------TIEAEFKWFDGGNSTICTNLSTEVLSPRNQRKKEDRIGESQ   80 (530)
Q Consensus        18 ~l~~va~~~HE~GH~-GL~Hs~~----------------~~~iM~p~y~~~~~~~~~~~~~~~l~~~~~~~~dD~~gi~~   80 (530)
                      .++.|+  +|||||+ ||.|+..                ..|||+++.......       ....-+..++.+||.+||.
T Consensus        93 ~~~~~~--~HEiGHaLGL~H~~~~~~~~~~~~~~~~~~~~~SvM~y~~~~~~~~-------~~~~~~~~~~~~Di~ai~~  163 (165)
T cd04268          93 RLRNTA--EHELGHALGLRHNFAASDRDDNVDLLAEKGDTSSVMDYAPSNFSIQ-------LGDGQKYTIGPYDIAAIKK  163 (165)
T ss_pred             HHHHHH--HHHHHHHhcccccCcCCccCCcchhhccCCCCcccCCCCccccccc-------cccccCCCCCHHHHHHHHh
Confidence            467788  9999999 9999998                899999987642111       1111123455999999999


Q ss_pred             cc
Q psy12290         81 PF   82 (530)
Q Consensus        81 ly   82 (530)
                      ||
T Consensus       164 lY  165 (165)
T cd04268         164 LY  165 (165)
T ss_pred             cC
Confidence            98


No 13 
>smart00235 ZnMc Zinc-dependent metalloprotease. Neutral zinc metallopeptidases. This alignment represents a subset of known subfamilies. Highest similarity occurs in the HExxH zinc-binding site/ active site.
Probab=97.95  E-value=2.2e-06  Score=78.13  Aligned_cols=48  Identities=17%  Similarity=0.207  Sum_probs=40.6

Q ss_pred             hhhhhhhhhhccc-cccCCCCCCC---eeeecccCCCCccccCCceeecCCCCCCChhHHHHhhccc
Q psy12290         20 YGMNHSWATYGHW-ALSFKMTTIE---AEFKWFDGGNSTICTNLSTEVLSPRNQRKKEDRIGESQPF   82 (530)
Q Consensus        20 ~~va~~~HE~GH~-GL~Hs~~~~~---iM~p~y~~~~~~~~~~~~~~~l~~~~~~~~dD~~gi~~ly   82 (530)
                      +.|+  +|||||+ ||.|+..+.+   .|++.++....       .|.|+      .+|..+++.+|
T Consensus        87 ~~~~--~HEigHaLGl~H~~~~~drd~~~~~~~~~~~~-------~~~~~------~~~~~~~~~~y  138 (140)
T smart00235       87 TGVA--AHELGHALGLYHEQSRSDRDNYMYINYTNITR-------NFDLS------NDDSLGIPYDY  138 (140)
T ss_pred             cccH--HHHHHHHhcCCcCCCCCcccCeEEEehhhhhh-------ccccc------cccCCCchhcc
Confidence            4577  9999999 9999999888   99999986522       37777      88999999999


No 14 
>cd00203 ZnMc Zinc-dependent metalloprotease. This super-family of metalloproteases contains two major branches, the astacin-like proteases and the adamalysin/reprolysin-like proteases. Both branches have wide phylogenetic distribution, and contain sub-families, which are involved in vertebrate development and disease.
Probab=97.77  E-value=1.6e-05  Score=73.84  Aligned_cols=52  Identities=8%  Similarity=-0.174  Sum_probs=38.8

Q ss_pred             chhhhhhhhhhhccc-cccCCCC--------------------CCCeeeecccCCCCccccCCceeecCCCCCCChhHHH
Q psy12290         18 SLYGMNHSWATYGHW-ALSFKMT--------------------TIEAEFKWFDGGNSTICTNLSTEVLSPRNQRKKEDRI   76 (530)
Q Consensus        18 ~l~~va~~~HE~GH~-GL~Hs~~--------------------~~~iM~p~y~~~~~~~~~~~~~~~l~~~~~~~~dD~~   76 (530)
                      .+..|+  +|||||+ ||.|...                    ..+||.+......     ......++      ..|+.
T Consensus        95 ~~~~~~--~HElGH~LGl~H~~~~~~~~~~~~~~~~~~~~~~~~~siM~y~~~~~~-----~~~~~~fS------~~d~~  161 (167)
T cd00203          95 EGAQTI--AHELGHALGFYHDHDRKDRDDYPTIDDTLNAEDDDYYSVMSYTKGSFS-----DGQRKDFS------QCDID  161 (167)
T ss_pred             cchhhH--HHHHHHHhCCCccCcCCCCCCCccccccccCCCCCCCeEeccCccccC-----cccCCCcC------HHHHH
Confidence            455666  9999999 9999887                    4689998765421     01124566      99999


Q ss_pred             Hhhccc
Q psy12290         77 GESQPF   82 (530)
Q Consensus        77 gi~~ly   82 (530)
                      .||++|
T Consensus       162 ~i~~~Y  167 (167)
T cd00203         162 QINKLY  167 (167)
T ss_pred             HHHhhC
Confidence            999998


No 15 
>cd04277 ZnMc_serralysin_like Zinc-dependent metalloprotease, serralysin_like subfamily. Serralysins and related proteases are important virulence factors in pathogenic bacteria. They may be secreted into the medium via a mechanism found in gram-negative bacteria, that does not require n-terminal signal sequences which are cleaved after the transmembrane translocation. A calcium-binding domain c-terminal to the metalloprotease domain, which contains multiple tandem repeats of a nine-residue motif including the pattern GGxGxD, and which forms a parallel beta roll may be involved in the translocation mechanism and/or substrate binding. Serralysin family members may have a broad spectrum of substrates each, including host immunoglobulins, complement proteins, cell matrix and cytoskeletal proteins, as well as antimicrobial peptides.
Probab=97.49  E-value=7.6e-05  Score=71.45  Aligned_cols=24  Identities=17%  Similarity=-0.078  Sum_probs=19.6

Q ss_pred             ccchhhhhhhhhhhccc-cccCCCCCC
Q psy12290         16 IQSLYGMNHSWATYGHW-ALSFKMTTI   41 (530)
Q Consensus        16 ~~~l~~va~~~HE~GH~-GL~Hs~~~~   41 (530)
                      |...+.|+  +|||||+ ||.|..+..
T Consensus       110 g~~~~~t~--~HEiGHaLGL~H~~~~~  134 (186)
T cd04277         110 GSYGYQTI--IHEIGHALGLEHPGDYN  134 (186)
T ss_pred             ChhhHHHH--HHHHHHHhcCCCCCcCC
Confidence            45567777  9999999 999998653


No 16 
>PF12388 Peptidase_M57:  Dual-action HEIGH metallo-peptidase;  InterPro: IPR024653 This entry represents the metallopeptidases M10, M27 and M57. The catalytic triad for proteases in this entry is HE-H-H, which in many members is in the sequence motif HEIGH [].
Probab=96.78  E-value=0.00075  Score=66.75  Aligned_cols=44  Identities=11%  Similarity=0.103  Sum_probs=33.0

Q ss_pred             hhhhhccc-cccCCC------------------------------CCCCeeeecccCCCCccccCCceeecCCCCCCChh
Q psy12290         25 SWATYGHW-ALSFKM------------------------------TTIEAEFKWFDGGNSTICTNLSTEVLSPRNQRKKE   73 (530)
Q Consensus        25 ~~HE~GH~-GL~Hs~------------------------------~~~~iM~p~y~~~~~~~~~~~~~~~l~~~~~~~~d   73 (530)
                      |+|||||+ ||.|+.                              +..|||-.-|.....        -.++      ..
T Consensus       137 i~HEiGH~IGfRHTD~~~R~SCG~~~nEg~~~vGAi~IpGTPt~~d~~SiM~ac~~~~~~--------~~f~------~~  202 (211)
T PF12388_consen  137 ITHEIGHCIGFRHTDYFNRSSCGSGGNEGSAGVGAIHIPGTPTGADPNSIMNACFSSGED--------GEFT------SN  202 (211)
T ss_pred             HHHHhhhhccccccCcCCcccccccCCcCccccceEECCCCCCCCCCchhhhccccCCCC--------CCcC------hh
Confidence            49999999 999987                              455666665543322        2445      99


Q ss_pred             HHHHhhccc
Q psy12290         74 DRIGESQPF   82 (530)
Q Consensus        74 D~~gi~~ly   82 (530)
                      ||.+++.||
T Consensus       203 Di~Al~~lY  211 (211)
T PF12388_consen  203 DITALNYLY  211 (211)
T ss_pred             hHHHHHhhC
Confidence            999999998


No 17 
>cd04276 ZnMc_MMP_like_2 Zinc-dependent metalloprotease; MMP_like sub-family 2. A group of bacterial metalloproteinase domains similar to matrix metalloproteinases and astacin.
Probab=95.59  E-value=0.0098  Score=58.42  Aligned_cols=27  Identities=15%  Similarity=-0.012  Sum_probs=20.2

Q ss_pred             hhhhhhhhhhhccc-cccCCCCCCCeeeecc
Q psy12290         19 LYGMNHSWATYGHW-ALSFKMTTIEAEFKWF   48 (530)
Q Consensus        19 l~~va~~~HE~GH~-GL~Hs~~~~~iM~p~y   48 (530)
                      |..++  +||+||+ ||.|.. ..|.|+|.+
T Consensus       116 ~~~~~--~he~gh~lGl~hn~-~~s~~~~~~  143 (197)
T cd04276         116 LRYLL--AHEVGHTLGLRHNF-KASSDGSNE  143 (197)
T ss_pred             HHHHH--HHHHHHHhcCcccc-cccccCchh
Confidence            44455  9999999 999965 566777743


No 18 
>cd04267 ZnMc_ADAM_like Zinc-dependent metalloprotease, ADAM_like or reprolysin_like subgroup. The adamalysin_like or ADAM family of metalloproteases contains proteolytic domains from snake venoms, proteases from the mammalian reproductive tract, and the tumor necrosis factor alpha convertase, TACE. ADAMs (A Disintegrin And Metalloprotease) are glycoproteins, which play roles in cell signaling, cell fusion, and cell-cell interactions.
Probab=94.40  E-value=0.03  Score=53.65  Aligned_cols=31  Identities=10%  Similarity=-0.188  Sum_probs=22.5

Q ss_pred             hhhhhhhhhhccc-cccCCCCCC----------CeeeecccC
Q psy12290         20 YGMNHSWATYGHW-ALSFKMTTI----------EAEFKWFDG   50 (530)
Q Consensus        20 ~~va~~~HE~GH~-GL~Hs~~~~----------~iM~p~y~~   50 (530)
                      ....++|||+||+ ||.|-....          -||.+....
T Consensus       132 ~~~~~~aHElGH~lG~~HD~~~~~~~~c~~~~~~IM~~~~~~  173 (192)
T cd04267         132 LTALTMAHELGHNLGAEHDGGDELAFECDGGGNYIMAPVDSG  173 (192)
T ss_pred             eehhhhhhhHHhhcCCcCCCCCCccccCCCCCCeEEcccccC
Confidence            3344569999999 999987632          388876553


No 19 
>PF05572 Peptidase_M43:  Pregnancy-associated plasma protein-A;  InterPro: IPR008754 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry based on a common structural fold:  Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases.   In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding.  Metalloproteases are the most diverse of the four main types of protease, with more than 50 families identified to date. In these enzymes, a divalent cation, usually zinc, activates the water molecule. The metal ion is held in place by amino acid ligands, usually three in number. The known metal ligands are His, Glu, Asp or Lys and at least one other residue is required for catalysis, which may play an electrophillic role. Of the known metalloproteases, around half contain an HEXXH motif, which has been shown in crystallographic studies to form part of the metal-binding site []. The HEXXH motif is relatively common, but can be more stringently defined for metalloproteases as 'abXHEbbHbc', where 'a' is most often valine or threonine and forms part of the S1' subsite in thermolysin and neprilysin, 'b' is an uncharged residue, and 'c' a hydrophobic residue. Proline is never found in this site, possibly because it would break the helical structure adopted by this motif in metalloproteases []. This group of metallopeptidases belong to the MEROPS peptidase M43 (cytophagalysin family, clan MA(M)), subfamily M43. The predicted active site residues for members of this family and thermolysin, the type example for clan MA, occur in the motif HEXXH. The type example of this family is the pregnancy-associated plasma protein A (PAPP-A), which cleaves insulin-like growth factor (IGF) binding protein-4 (IGFBP-4), causing a dramatic reduction in its affinity for IGF-I and -II. Through this mechanism, PAPP-A is a regulator of IGF bioactivity in several systems, including the Homo sapiens ovary and the cardiovascular system [, , , ].; PDB: 3LUN_A 3LUM_B 2J83_A 2CKI_A.
Probab=94.39  E-value=0.012  Score=55.44  Aligned_cols=18  Identities=22%  Similarity=0.305  Sum_probs=10.4

Q ss_pred             hhhhhhccc-cccCCCCCC
Q psy12290         24 HSWATYGHW-ALSFKMTTI   41 (530)
Q Consensus        24 ~~~HE~GH~-GL~Hs~~~~   41 (530)
                      ||+||+||+ ||.|.-...
T Consensus        72 TltHEvGH~LGL~HtF~~~   90 (154)
T PF05572_consen   72 TLTHEVGHWLGLYHTFGGG   90 (154)
T ss_dssp             HHHHHHHHHTT---TT---
T ss_pred             chhhhhhhhhcccccccCC
Confidence            359999999 999987544


No 20 
>cd04327 ZnMc_MMP_like_3 Zinc-dependent metalloprotease; MMP_like sub-family 3. A group of bacterial and fungal metalloproteinase domains similar to matrix metalloproteinases and astacin.
Probab=94.16  E-value=0.018  Score=56.01  Aligned_cols=25  Identities=12%  Similarity=0.187  Sum_probs=19.6

Q ss_pred             chhhhhhhhhhhccc-cccCCCCCCCee
Q psy12290         18 SLYGMNHSWATYGHW-ALSFKMTTIEAE   44 (530)
Q Consensus        18 ~l~~va~~~HE~GH~-GL~Hs~~~~~iM   44 (530)
                      ++++|+  +|||||+ ||.|...+....
T Consensus        91 ~~~~~i--~HElgHaLG~~HEh~rpdrd  116 (198)
T cd04327          91 EFSRVV--LHEFGHALGFIHEHQSPAAN  116 (198)
T ss_pred             hHHHHH--HHHHHHHhcCcccccCCCCC
Confidence            345677  9999999 999988765554


No 21 
>TIGR03548 mutarot_permut cyclically-permuted mutatrotase family protein. Members of this protein family show essentially full-length homology, cyclically permuted, to YjhT from Escherichia coli. YjhT was shown to act as a mutarotase for sialic acid, and by this ability to be able to act as a virulence factor. Members of the YjhT family (TIGR03547) and this cyclically-permuted family have multiple repeats of the beta-propeller-forming Kelch repeat.
Probab=93.55  E-value=2.8  Score=43.19  Aligned_cols=144  Identities=15%  Similarity=0.169  Sum_probs=68.0

Q ss_pred             eeEEeCCEEEEEECC-------eEEEEcCCCccCCCceecccccccCCCCCccccceEEeeCCcEEEEEce-------eE
Q psy12290        241 AIAVIRTEVFVFKDR-------WMWRIGDKGVLPGYPVLIHQFWSELPHNLTHIDAVYQRIDNHIAFFIGR-------QY  306 (530)
Q Consensus       241 Avt~irGeiyfFKG~-------~~WR~~~~~~~~gyP~~Is~~WpGLP~~~~~IDAAye~~~gktyFFKG~-------~y  306 (530)
                      +++.+++.||+|-|.       .+|+++......   ...-...+.||...  -.++....++++|+|-|.       .+
T Consensus        67 ~~~~~~~~lyviGG~~~~~~~~~v~~~d~~~~~w---~~~~~~~~~lp~~~--~~~~~~~~~~~iYv~GG~~~~~~~~~v  141 (323)
T TIGR03548        67 ASVSVENGIYYIGGSNSSERFSSVYRITLDESKE---ELICETIGNLPFTF--ENGSACYKDGTLYVGGGNRNGKPSNKS  141 (323)
T ss_pred             EEEEECCEEEEEcCCCCCCCceeEEEEEEcCCce---eeeeeEcCCCCcCc--cCceEEEECCEEEEEeCcCCCccCceE
Confidence            445568999999873       566665321100   00001123455432  122222247899999773       57


Q ss_pred             EEecceecCCCCCcccccCCCCCcccccccEEEeccCCeEEEeeCC------eEEEEeCCCCcccCCCCcccccCCCCCC
Q psy12290        307 FLFEGIRLLPGYPRPLTALGLPASLERIDAAMVWGYNSKTYLFSGT------RYWKLDDETGRSEPDYPRNMTENWRGVG  380 (530)
Q Consensus       307 W~y~~~~l~~GYPK~Is~~GlP~~~~~IDAAf~~~~ngktYFFkG~------~YWryde~~~~vd~gYPk~Is~~w~GvP  380 (530)
                      |+|+-....  + ..+.  .+|.. ....++.. ..++++|+|.|.      ..++||..+++-..--+  +.  -...|
T Consensus       142 ~~yd~~~~~--W-~~~~--~~p~~-~r~~~~~~-~~~~~iYv~GG~~~~~~~~~~~yd~~~~~W~~~~~--~~--~~~~p  210 (323)
T TIGR03548       142 YLFNLETQE--W-FELP--DFPGE-PRVQPVCV-KLQNELYVFGGGSNIAYTDGYKYSPKKNQWQKVAD--PT--TDSEP  210 (323)
T ss_pred             EEEcCCCCC--e-eECC--CCCCC-CCCcceEE-EECCEEEEEcCCCCccccceEEEecCCCeeEECCC--CC--CCCCc
Confidence            777642100  0 0011  12211 11223322 246899999873      35788877654221100  00  00122


Q ss_pred             CC--CCEEEecCCCcEEEEECC
Q psy12290        381 VD--IDDAFQWKDGATYFFKGK  400 (530)
Q Consensus       381 ~~--IDAAf~~~~G~~YFFkG~  400 (530)
                      ..  --+++...++++|+|-|.
T Consensus       211 ~~~~~~~~~~~~~~~iyv~GG~  232 (323)
T TIGR03548       211 ISLLGAASIKINESLLLCIGGF  232 (323)
T ss_pred             eeccceeEEEECCCEEEEECCc
Confidence            11  123344446799999763


No 22 
>PHA03098 kelch-like protein; Provisional
Probab=93.45  E-value=2.6  Score=46.58  Aligned_cols=143  Identities=14%  Similarity=0.127  Sum_probs=71.5

Q ss_pred             eeEEeCCEEEEEECCe-------EEEEcCCCccCCCceecccccccCCCC-CccccceEEeeCCcEEEEEc--------e
Q psy12290        241 AIAVIRTEVFVFKDRW-------MWRIGDKGVLPGYPVLIHQFWSELPHN-LTHIDAVYQRIDNHIAFFIG--------R  304 (530)
Q Consensus       241 Avt~irGeiyfFKG~~-------~WR~~~~~~~~gyP~~Is~~WpGLP~~-~~~IDAAye~~~gktyFFKG--------~  304 (530)
                      +++.++|.+|+|-|..       +|+++..          ...|..++.- ...-.++....++++|+|-|        +
T Consensus       337 ~~~~~~~~lyv~GG~~~~~~~~~v~~yd~~----------~~~W~~~~~lp~~r~~~~~~~~~~~iYv~GG~~~~~~~~~  406 (534)
T PHA03098        337 GVTVFNNRIYVIGGIYNSISLNTVESWKPG----------ESKWREEPPLIFPRYNPCVVNVNNLIYVIGGISKNDELLK  406 (534)
T ss_pred             eEEEECCEEEEEeCCCCCEecceEEEEcCC----------CCceeeCCCcCcCCccceEEEECCEEEEECCcCCCCcccc
Confidence            4456799999998853       4444422          2234333221 01122333334789999977        3


Q ss_pred             eEEEecce--ecCCCCCcccccCCCCCcccccccEEEeccCCeEEEeeCC----------eEEEEeCCCCcccCCCCccc
Q psy12290        305 QYFLFEGI--RLLPGYPRPLTALGLPASLERIDAAMVWGYNSKTYLFSGT----------RYWKLDDETGRSEPDYPRNM  372 (530)
Q Consensus       305 ~yW~y~~~--~l~~GYPK~Is~~GlP~~~~~IDAAf~~~~ngktYFFkG~----------~YWryde~~~~vd~gYPk~I  372 (530)
                      .+++|+-.  +-..     +.  .+|...... +|+.  .++++|+|.|.          ..|+||..+++...-     
T Consensus       407 ~v~~yd~~t~~W~~-----~~--~~p~~r~~~-~~~~--~~~~iyv~GG~~~~~~~~~~~~v~~yd~~~~~W~~~-----  471 (534)
T PHA03098        407 TVECFSLNTNKWSK-----GS--PLPISHYGG-CAIY--HDGKIYVIGGISYIDNIKVYNIVESYNPVTNKWTEL-----  471 (534)
T ss_pred             eEEEEeCCCCeeee-----cC--CCCccccCc-eEEE--ECCEEEEECCccCCCCCcccceEEEecCCCCceeeC-----
Confidence            46677632  1111     11  122111112 2332  36899999873          278899876542211     


Q ss_pred             ccCCCCCCCCCCEEEecCCCcEEEEECC-------eEEEEecccce
Q psy12290        373 TENWRGVGVDIDDAFQWKDGATYFFKGK-------GFWKFKDVSMR  411 (530)
Q Consensus       373 s~~w~GvP~~IDAAf~~~~G~~YFFkG~-------~Ywrfd~~~~~  411 (530)
                      ..  ...+..--++.. .+|++|+|.|.       ..+.||..+.+
T Consensus       472 ~~--~~~~r~~~~~~~-~~~~iyv~GG~~~~~~~~~v~~yd~~~~~  514 (534)
T PHA03098        472 SS--LNFPRINASLCI-FNNKIYVVGGDKYEYYINEIEVYDDKTNT  514 (534)
T ss_pred             CC--CCcccccceEEE-ECCEEEEEcCCcCCcccceeEEEeCCCCE
Confidence            00  011111112233 36899999774       45667665543


No 23 
>PLN02153 epithiospecifier protein
Probab=93.15  E-value=3.3  Score=43.11  Aligned_cols=15  Identities=20%  Similarity=0.636  Sum_probs=11.2

Q ss_pred             eeEEeCCEEEEEECC
Q psy12290        241 AIAVIRTEVFVFKDR  255 (530)
Q Consensus       241 Avt~irGeiyfFKG~  255 (530)
                      +++.+++.||+|-|.
T Consensus        80 ~~~~~~~~iyv~GG~   94 (341)
T PLN02153         80 RMVAVGTKLYIFGGR   94 (341)
T ss_pred             EEEEECCEEEEECCC
Confidence            345578999999873


No 24 
>COG1913 Predicted Zn-dependent proteases [General function prediction only]
Probab=93.01  E-value=0.049  Score=52.53  Aligned_cols=25  Identities=16%  Similarity=0.008  Sum_probs=21.9

Q ss_pred             hhhhhhhhccc-cccCCCCCCCeeee
Q psy12290         22 MNHSWATYGHW-ALSFKMTTIEAEFK   46 (530)
Q Consensus        22 va~~~HE~GH~-GL~Hs~~~~~iM~p   46 (530)
                      +-.+.||+||. ||+|-.++.-+|.+
T Consensus       125 ~KEv~HElGH~~GL~HC~N~~CVM~F  150 (181)
T COG1913         125 VKEVLHELGHLLGLSHCPNPRCVMNF  150 (181)
T ss_pred             HHHHHHHhhhhcCcccCCCCCcEEeC
Confidence            33469999999 99999999999985


No 25 
>cd04273 ZnMc_ADAMTS_like Zinc-dependent metalloprotease, ADAMTS_like subgroup. ADAMs (A Disintegrin And Metalloprotease) are glycoproteins, which play roles in cell signaling, cell fusion, and cell-cell interactions. This particular subfamily represents domain architectures that combine ADAM-like metalloproteinases with thrombospondin type-1 repeats. ADAMTS (a disintegrin and metalloproteinase with thrombospondin motifs) proteinases are inhibited by TIMPs (tissue inhibitors of metalloproteinases), and they play roles in coagulation, angiogenesis, development and progression of arthritis. They hydrolyze the von Willebrand factor precursor and various components of the extracellular matrix.
Probab=92.87  E-value=0.055  Score=52.84  Aligned_cols=49  Identities=10%  Similarity=-0.102  Sum_probs=33.9

Q ss_pred             hhhhhhhhhccc-cccCCCC---------CCCeeeecccCCCCccccCCceeecCCCCCCChhHHHHhhccc
Q psy12290         21 GMNHSWATYGHW-ALSFKMT---------TIEAEFKWFDGGNSTICTNLSTEVLSPRNQRKKEDRIGESQPF   82 (530)
Q Consensus        21 ~va~~~HE~GH~-GL~Hs~~---------~~~iM~p~y~~~~~~~~~~~~~~~l~~~~~~~~dD~~gi~~ly   82 (530)
                      .+.++|||+||. ||.|-.+         ..-||.|.......       .+.+|      +--+.-++++.
T Consensus       140 ~a~~~aHElGH~LG~~HD~~~~~C~~~~~~~~IM~~~~~~~~~-------~~~fS------~CS~~~~~~~l  198 (207)
T cd04273         140 SAFTIAHELGHVLGMPHDGDGNSCGPEGKDGHIMSPTLGANTG-------PFTWS------KCSRRYLTSFL  198 (207)
T ss_pred             eEEeeeeechhhcCCCCCCCCCCCCCCCCCceeecccccCCCC-------CCCcC------HHHHHHHHHHH
Confidence            334469999999 9999986         37899998765311       24555      66666666555


No 26 
>PF13574 Reprolysin_2:  Metallo-peptidase family M12B Reprolysin-like; PDB: 1KAP_P 1JIW_P 1AKL_A 1OM7_A 1OM8_A 1O0T_A 1OM6_A 1H71_P 1O0Q_A 1OMJ_A ....
Probab=92.66  E-value=0.034  Score=53.13  Aligned_cols=21  Identities=14%  Similarity=0.181  Sum_probs=13.9

Q ss_pred             hhhhhhhhhccc-cccCCCCCC
Q psy12290         21 GMNHSWATYGHW-ALSFKMTTI   41 (530)
Q Consensus        21 ~va~~~HE~GH~-GL~Hs~~~~   41 (530)
                      .+-++|||+||. |+.|..+..
T Consensus       111 ~~~~~aHElGH~lGa~Hd~~~~  132 (173)
T PF13574_consen  111 GIDTFAHELGHQLGAPHDFDNG  132 (173)
T ss_dssp             HHHHHHHHHHHHHT---SSSS-
T ss_pred             eeeeehhhhHhhcCCCCCCCCC
Confidence            555569999999 999998764


No 27 
>PLN02153 epithiospecifier protein
Probab=92.49  E-value=5.1  Score=41.69  Aligned_cols=15  Identities=27%  Similarity=0.576  Sum_probs=11.0

Q ss_pred             eeEEeCCEEEEEECC
Q psy12290        241 AIAVIRTEVFVFKDR  255 (530)
Q Consensus       241 Avt~irGeiyfFKG~  255 (530)
                      +++.++++||+|-|.
T Consensus        27 ~~~~~~~~iyv~GG~   41 (341)
T PLN02153         27 GIAVVGDKLYSFGGE   41 (341)
T ss_pred             eEEEECCEEEEECCc
Confidence            345578999999774


No 28 
>TIGR03548 mutarot_permut cyclically-permuted mutatrotase family protein. Members of this protein family show essentially full-length homology, cyclically permuted, to YjhT from Escherichia coli. YjhT was shown to act as a mutarotase for sialic acid, and by this ability to be able to act as a virulence factor. Members of the YjhT family (TIGR03547) and this cyclically-permuted family have multiple repeats of the beta-propeller-forming Kelch repeat.
Probab=92.01  E-value=3.6  Score=42.46  Aligned_cols=59  Identities=17%  Similarity=0.250  Sum_probs=32.9

Q ss_pred             eEEeCCEEEEEECC-------eEEEEcCCCccCCCceecccccccCCCC-C-ccccceEEeeCCcEEEEEce------eE
Q psy12290        242 IAVIRTEVFVFKDR-------WMWRIGDKGVLPGYPVLIHQFWSELPHN-L-THIDAVYQRIDNHIAFFIGR------QY  306 (530)
Q Consensus       242 vt~irGeiyfFKG~-------~~WR~~~~~~~~gyP~~Is~~WpGLP~~-~-~~IDAAye~~~gktyFFKG~------~y  306 (530)
                      ++.+++.||+|-|.       .+|+++..          .+.|..++.- . ....++.-..++++|+|-|.      ..
T Consensus       119 ~~~~~~~iYv~GG~~~~~~~~~v~~yd~~----------~~~W~~~~~~p~~~r~~~~~~~~~~~iYv~GG~~~~~~~~~  188 (323)
T TIGR03548       119 ACYKDGTLYVGGGNRNGKPSNKSYLFNLE----------TQEWFELPDFPGEPRVQPVCVKLQNELYVFGGGSNIAYTDG  188 (323)
T ss_pred             EEEECCEEEEEeCcCCCccCceEEEEcCC----------CCCeeECCCCCCCCCCcceEEEECCEEEEEcCCCCccccce
Confidence            34578999999874       45666532          2235444321 0 11233333347899999773      24


Q ss_pred             EEec
Q psy12290        307 FLFE  310 (530)
Q Consensus       307 W~y~  310 (530)
                      ++|+
T Consensus       189 ~~yd  192 (323)
T TIGR03548       189 YKYS  192 (323)
T ss_pred             EEEe
Confidence            6665


No 29 
>PRK13267 archaemetzincin-like protein; Reviewed
Probab=91.94  E-value=0.069  Score=51.78  Aligned_cols=22  Identities=14%  Similarity=-0.157  Sum_probs=20.3

Q ss_pred             hhhhhccc-cccCCCCCCCeeee
Q psy12290         25 SWATYGHW-ALSFKMTTIEAEFK   46 (530)
Q Consensus        25 ~~HE~GH~-GL~Hs~~~~~iM~p   46 (530)
                      ++||+||. ||.|-.+..-+|+.
T Consensus       129 ~~HElGH~lGL~HC~~~~CvM~~  151 (179)
T PRK13267        129 VTHELGHTLGLEHCDNPRCVMNF  151 (179)
T ss_pred             HHHHHHHHcCCccCCCCCccCCC
Confidence            49999999 99999999999983


No 30 
>PF13583 Reprolysin_4:  Metallo-peptidase family M12B Reprolysin-like
Probab=91.57  E-value=0.073  Score=52.38  Aligned_cols=19  Identities=21%  Similarity=0.156  Sum_probs=15.7

Q ss_pred             hhhhhhhhhhhccc-cccCCCC
Q psy12290         19 LYGMNHSWATYGHW-ALSFKMT   39 (530)
Q Consensus        19 l~~va~~~HE~GH~-GL~Hs~~   39 (530)
                      .+.+.  +|||||. ||.|..+
T Consensus       137 ~~~~~--aHEiGH~lGl~H~~~  156 (206)
T PF13583_consen  137 GYQTF--AHEIGHNLGLRHDFD  156 (206)
T ss_pred             cchHH--HHHHHHHhcCCCCcc
Confidence            34444  9999999 9999987


No 31 
>PRK14131 N-acetylneuraminic acid mutarotase; Provisional
Probab=91.34  E-value=2.7  Score=44.56  Aligned_cols=84  Identities=18%  Similarity=0.331  Sum_probs=45.0

Q ss_pred             cccccccCCCCCccccceEEeeCCcEEEEEce---eEEEecceecCCCCCcccccCCCCCcccccccEEEeccCCeEEEe
Q psy12290        273 IHQFWSELPHNLTHIDAVYQRIDNHIAFFIGR---QYFLFEGIRLLPGYPRPLTALGLPASLERIDAAMVWGYNSKTYLF  349 (530)
Q Consensus       273 Is~~WpGLP~~~~~IDAAye~~~gktyFFKG~---~yW~y~~~~l~~GYPK~Is~~GlP~~~~~IDAAf~~~~ngktYFF  349 (530)
                      +...++.||..+....|+.  .++++|++-|.   .+|+|+-......+ ..+.  .+|... ....+... .++++|+|
T Consensus        18 ~~~~l~~lP~~~~~~~~~~--~~~~iyv~gG~~~~~~~~~d~~~~~~~W-~~l~--~~p~~~-r~~~~~v~-~~~~IYV~   90 (376)
T PRK14131         18 NAEQLPDLPVPFKNGTGAI--DNNTVYVGLGSAGTSWYKLDLNAPSKGW-TKIA--AFPGGP-REQAVAAF-IDGKLYVF   90 (376)
T ss_pred             ecccCCCCCcCccCCeEEE--ECCEEEEEeCCCCCeEEEEECCCCCCCe-EECC--cCCCCC-cccceEEE-ECCEEEEE
Confidence            4455678886543333333  47899998774   67888742111111 1121  222111 12222221 36899999


Q ss_pred             eC-------------CeEEEEeCCCCc
Q psy12290        350 SG-------------TRYWKLDDETGR  363 (530)
Q Consensus       350 kG-------------~~YWryde~~~~  363 (530)
                      .|             +.+|+||..+++
T Consensus        91 GG~~~~~~~~~~~~~~~v~~YD~~~n~  117 (376)
T PRK14131         91 GGIGKTNSEGSPQVFDDVYKYDPKTNS  117 (376)
T ss_pred             cCCCCCCCCCceeEcccEEEEeCCCCE
Confidence            77             247888877653


No 32 
>cd04271 ZnMc_ADAM_fungal Zinc-dependent metalloprotease, ADAM_fungal subgroup. The adamalysin_like or ADAM (A Disintegrin And Metalloprotease) family of metalloproteases are integral membrane proteases acting on a variety of extracellular targets. They are involved in shedding soluble peptides or proteins from the cell surface. This subfamily contains fungal ADAMs, whose precise function has yet to be determined.
Probab=91.29  E-value=0.14  Score=51.26  Aligned_cols=44  Identities=9%  Similarity=-0.195  Sum_probs=31.5

Q ss_pred             hhhhhhccc-cccCCCCC-------------------------CCeeeecccCCCCccccCCceeecCCCCCCChhHHHH
Q psy12290         24 HSWATYGHW-ALSFKMTT-------------------------IEAEFKWFDGGNSTICTNLSTEVLSPRNQRKKEDRIG   77 (530)
Q Consensus        24 ~~~HE~GH~-GL~Hs~~~-------------------------~~iM~p~y~~~~~~~~~~~~~~~l~~~~~~~~dD~~g   77 (530)
                      |||||+||. |+.|-.+.                         .=||+|.... .        .++++      .--+.-
T Consensus       148 t~AHElGHnLGm~HD~~~~~C~~~~~~~~~~Cp~~~~~C~~~~~~IM~~~~~~-~--------~~~FS------~CS~~~  212 (228)
T cd04271         148 VFAHEIGHTFGAVHDCTSGTCSDGSVGSQQCCPLSTSTCDANGQYIMNPSSSS-G--------ITEFS------PCTIGN  212 (228)
T ss_pred             ehhhhhhhhcCCCCCCCCCccccccccccccCCCcccccCCCCCEEeecCcCC-C--------CCccC------hhhHHH
Confidence            679999999 99997542                         1299997443 1        24566      777777


Q ss_pred             hhccc
Q psy12290         78 ESQPF   82 (530)
Q Consensus        78 i~~ly   82 (530)
                      |+.+.
T Consensus       213 ~~~~l  217 (228)
T cd04271         213 ICSLL  217 (228)
T ss_pred             HHHHH
Confidence            77777


No 33 
>cd04275 ZnMc_pappalysin_like Zinc-dependent metalloprotease, pappalysin_like subfamily. The pregnancy-associated plasma protein A (PAPP-A or pappalysin-1) cleaves insulin-like growth factor-binding proteins 4 and 5, thereby promoting cell growth by releasing bound growth factor. This model includes pappalysins and related metalloprotease domains from all three kingdoms of life. The three-dimensional structure of an archaeal representative, ulilysin, has been solved.
Probab=91.28  E-value=0.046  Score=54.74  Aligned_cols=25  Identities=20%  Similarity=0.214  Sum_probs=20.7

Q ss_pred             ccchhhhhhhhhhhccc-cccCCCCCCC
Q psy12290         16 IQSLYGMNHSWATYGHW-ALSFKMTTIE   42 (530)
Q Consensus        16 ~~~l~~va~~~HE~GH~-GL~Hs~~~~~   42 (530)
                      ..++-.++  +||+||+ ||.|......
T Consensus       134 ~~n~g~t~--~HEvGH~lGL~HtF~~~~  159 (225)
T cd04275         134 PYNLGDTA--THEVGHWLGLYHTFQGGS  159 (225)
T ss_pred             ccccccee--EEeccceeeeeeeecCCC
Confidence            35666777  9999999 9999987765


No 34 
>PLN02193 nitrile-specifier protein
Probab=90.95  E-value=6.5  Score=43.27  Aligned_cols=151  Identities=13%  Similarity=0.173  Sum_probs=74.3

Q ss_pred             eeEEeCCEEEEEECC---------eEEEEcCCCccCCCceecccccccC------CCCCccccceEEeeCCcEEEEEc--
Q psy12290        241 AIAVIRTEVFVFKDR---------WMWRIGDKGVLPGYPVLIHQFWSEL------PHNLTHIDAVYQRIDNHIAFFIG--  303 (530)
Q Consensus       241 Avt~irGeiyfFKG~---------~~WR~~~~~~~~gyP~~Is~~WpGL------P~~~~~IDAAye~~~gktyFFKG--  303 (530)
                      +++.+++.||+|-|.         .+|+++...          +.|..+      |.. ....++.-..++++|+|-|  
T Consensus       170 ~~~~~~~~iyv~GG~~~~~~~~~~~v~~yD~~~----------~~W~~~~~~g~~P~~-~~~~~~~v~~~~~lYvfGG~~  238 (470)
T PLN02193        170 GIAQVGNKIYSFGGEFTPNQPIDKHLYVFDLET----------RTWSISPATGDVPHL-SCLGVRMVSIGSTLYVFGGRD  238 (470)
T ss_pred             EEEEECCEEEEECCcCCCCCCeeCcEEEEECCC----------CEEEeCCCCCCCCCC-cccceEEEEECCEEEEECCCC
Confidence            445578899999774         367776432          123222      210 0112222224789999987  


Q ss_pred             -----eeEEEecceecCCCCCcccccCC-CCCcccccccEEEeccCCeEEEeeCC-------eEEEEeCCCCcccCCCCc
Q psy12290        304 -----RQYFLFEGIRLLPGYPRPLTALG-LPASLERIDAAMVWGYNSKTYLFSGT-------RYWKLDDETGRSEPDYPR  370 (530)
Q Consensus       304 -----~~yW~y~~~~l~~GYPK~Is~~G-lP~~~~~IDAAf~~~~ngktYFFkG~-------~YWryde~~~~vd~gYPk  370 (530)
                           +.+|+|+-....  + ..+..++ .|..... -+|..  .++++|+|-|.       ..+.||..+++...--+.
T Consensus       239 ~~~~~ndv~~yD~~t~~--W-~~l~~~~~~P~~R~~-h~~~~--~~~~iYv~GG~~~~~~~~~~~~yd~~t~~W~~~~~~  312 (470)
T PLN02193        239 ASRQYNGFYSFDTTTNE--W-KLLTPVEEGPTPRSF-HSMAA--DEENVYVFGGVSATARLKTLDSYNIVDKKWFHCSTP  312 (470)
T ss_pred             CCCCCccEEEEECCCCE--E-EEcCcCCCCCCCccc-eEEEE--ECCEEEEECCCCCCCCcceEEEEECCCCEEEeCCCC
Confidence                 457888742100  0 0011111 1211011 12222  36899999873       367888776543211000


Q ss_pred             ccccCCCCCCCCCCEEEecCCCcEEEEEC------CeEEEEecccceee
Q psy12290        371 NMTENWRGVGVDIDDAFQWKDGATYFFKG------KGFWKFKDVSMRVE  413 (530)
Q Consensus       371 ~Is~~w~GvP~~IDAAf~~~~G~~YFFkG------~~Ywrfd~~~~~V~  413 (530)
                        ...  ..+..--++.. .+|++|++-|      +..|.||..+++..
T Consensus       313 --~~~--~~~R~~~~~~~-~~gkiyviGG~~g~~~~dv~~yD~~t~~W~  356 (470)
T PLN02193        313 --GDS--FSIRGGAGLEV-VQGKVWVVYGFNGCEVDDVHYYDPVQDKWT  356 (470)
T ss_pred             --CCC--CCCCCCcEEEE-ECCcEEEEECCCCCccCceEEEECCCCEEE
Confidence              000  01111122333 3678999876      56888888776553


No 35 
>PHA03098 kelch-like protein; Provisional
Probab=90.92  E-value=8.8  Score=42.43  Aligned_cols=146  Identities=15%  Similarity=0.175  Sum_probs=71.5

Q ss_pred             eeEEeCCEEEEEECC--------eEEEEcCCCccCCCceecccccccCCCCC-ccccceEEeeCCcEEEEEce-------
Q psy12290        241 AIAVIRTEVFVFKDR--------WMWRIGDKGVLPGYPVLIHQFWSELPHNL-THIDAVYQRIDNHIAFFIGR-------  304 (530)
Q Consensus       241 Avt~irGeiyfFKG~--------~~WR~~~~~~~~gyP~~Is~~WpGLP~~~-~~IDAAye~~~gktyFFKG~-------  304 (530)
                      +++.+++.+|+|-|.        .+|+++..          ..-|..+|.-. ..-.++....++++|+|-|.       
T Consensus       289 ~~~~~~~~lyv~GG~~~~~~~~~~v~~yd~~----------~~~W~~~~~~~~~R~~~~~~~~~~~lyv~GG~~~~~~~~  358 (534)
T PHA03098        289 GSVVLNNVIYFIGGMNKNNLSVNSVVSYDTK----------TKSWNKVPELIYPRKNPGVTVFNNRIYVIGGIYNSISLN  358 (534)
T ss_pred             eEEEECCEEEEECCCcCCCCeeccEEEEeCC----------CCeeeECCCCCcccccceEEEECCEEEEEeCCCCCEecc
Confidence            455678999999773        35555532          22343333210 01222222347899999874       


Q ss_pred             eEEEecceecCCCCCcccccCCCCCcccccccEEEeccCCeEEEeeC--------CeEEEEeCCCCcccCCCCcccccCC
Q psy12290        305 QYFLFEGIRLLPGYPRPLTALGLPASLERIDAAMVWGYNSKTYLFSG--------TRYWKLDDETGRSEPDYPRNMTENW  376 (530)
Q Consensus       305 ~yW~y~~~~l~~GYPK~Is~~GlP~~~~~IDAAf~~~~ngktYFFkG--------~~YWryde~~~~vd~gYPk~Is~~w  376 (530)
                      .+|+|+-..-.  + ..+.  .+|..  .-.++.. ..++++|+|.|        +..++||..+++....-|-.     
T Consensus       359 ~v~~yd~~~~~--W-~~~~--~lp~~--r~~~~~~-~~~~~iYv~GG~~~~~~~~~~v~~yd~~t~~W~~~~~~p-----  425 (534)
T PHA03098        359 TVESWKPGESK--W-REEP--PLIFP--RYNPCVV-NVNNLIYVIGGISKNDELLKTVECFSLNTNKWSKGSPLP-----  425 (534)
T ss_pred             eEEEEcCCCCc--e-eeCC--CcCcC--CccceEE-EECCEEEEECCcCCCCcccceEEEEeCCCCeeeecCCCC-----
Confidence            25555531100  0 0011  12211  1122222 13689999988        45788998765432211110     


Q ss_pred             CCCCCCCCEEEecCCCcEEEEECCe----------EEEEeccccee
Q psy12290        377 RGVGVDIDDAFQWKDGATYFFKGKG----------FWKFKDVSMRV  412 (530)
Q Consensus       377 ~GvP~~IDAAf~~~~G~~YFFkG~~----------Ywrfd~~~~~V  412 (530)
                        .+..--+|.. .+|++|++-|..          .++||..+.+.
T Consensus       426 --~~r~~~~~~~-~~~~iyv~GG~~~~~~~~~~~~v~~yd~~~~~W  468 (534)
T PHA03098        426 --ISHYGGCAIY-HDGKIYVIGGISYIDNIKVYNIVESYNPVTNKW  468 (534)
T ss_pred             --ccccCceEEE-ECCEEEEECCccCCCCCcccceEEEecCCCCce
Confidence              1111123333 367999997732          56777655443


No 36 
>TIGR03547 muta_rot_YjhT mutatrotase, YjhT family. Members of this protein family contain multiple copies of the beta-propeller-forming Kelch repeat. All are full-length homologs to YjhT of Escherichia coli, which has been identified as a mutarotase for sialic acid. This protein improves bacterial ability to obtain host sialic acid, and thus serves as a virulence factor. Some bacteria carry what appears to be a cyclically permuted homolog of this protein.
Probab=90.85  E-value=7.9  Score=40.20  Aligned_cols=55  Identities=22%  Similarity=0.239  Sum_probs=30.6

Q ss_pred             eEEeCCEEEEEECC---eEEEEcCCCccCCCceecccccccCCCCC--ccccceEEeeCCcEEEEEce
Q psy12290        242 IAVIRTEVFVFKDR---WMWRIGDKGVLPGYPVLIHQFWSELPHNL--THIDAVYQRIDNHIAFFIGR  304 (530)
Q Consensus       242 vt~irGeiyfFKG~---~~WR~~~~~~~~gyP~~Is~~WpGLP~~~--~~IDAAye~~~gktyFFKG~  304 (530)
                      ++.+.++||++-|.   .+|+++...        -.+-|..|+.--  ....++....++++|++-|.
T Consensus        13 ~~~~~~~vyv~GG~~~~~~~~~d~~~--------~~~~W~~l~~~p~~~R~~~~~~~~~~~iYv~GG~   72 (346)
T TIGR03547        13 GAIIGDKVYVGLGSAGTSWYKLDLKK--------PSKGWQKIADFPGGPRNQAVAAAIDGKLYVFGGI   72 (346)
T ss_pred             EEEECCEEEEEccccCCeeEEEECCC--------CCCCceECCCCCCCCcccceEEEECCEEEEEeCC
Confidence            44568999999774   577776321        112344333210  12333333357899999873


No 37 
>PHA02713 hypothetical protein; Provisional
Probab=90.75  E-value=6.1  Score=44.57  Aligned_cols=54  Identities=20%  Similarity=0.294  Sum_probs=30.2

Q ss_pred             eeEEeCCEEEEEECC--------eEEEEcCCCccCCCceecccccccCCCCC-ccccceEEeeCCcEEEEEce
Q psy12290        241 AIAVIRTEVFVFKDR--------WMWRIGDKGVLPGYPVLIHQFWSELPHNL-THIDAVYQRIDNHIAFFIGR  304 (530)
Q Consensus       241 Avt~irGeiyfFKG~--------~~WR~~~~~~~~gyP~~Is~~WpGLP~~~-~~IDAAye~~~gktyFFKG~  304 (530)
                      +++.+++.||++-|.        .+|+++..          .+.|..+|.-. ..-.++.-..+|++|++-|.
T Consensus       298 ~~a~l~~~IYviGG~~~~~~~~~~v~~Yd~~----------~n~W~~~~~m~~~R~~~~~~~~~g~IYviGG~  360 (557)
T PHA02713        298 ASAIVDNEIIIAGGYNFNNPSLNKVYKINIE----------NKIHVELPPMIKNRCRFSLAVIDDTIYAIGGQ  360 (557)
T ss_pred             EEEEECCEEEEEcCCCCCCCccceEEEEECC----------CCeEeeCCCCcchhhceeEEEECCEEEEECCc
Confidence            456679999999773        24555432          23454444321 11222323347899999874


No 38 
>cd04269 ZnMc_adamalysin_II_like Zinc-dependent metalloprotease; adamalysin_II_like subfamily. Adamalysin II is a snake venom zinc endopeptidase. This subfamily contains other snake venom metalloproteinases, as well as membrane-anchored metalloproteases belonging to the ADAM family. ADAMs (A Disintegrin And Metalloprotease) are glycoproteins, which play roles in cell signaling, cell fusion, and cell-cell interactions.
Probab=90.67  E-value=0.14  Score=49.28  Aligned_cols=29  Identities=7%  Similarity=-0.151  Sum_probs=21.9

Q ss_pred             hhhhhhhhccc-cccCCC------CCCCeeeecccC
Q psy12290         22 MNHSWATYGHW-ALSFKM------TTIEAEFKWFDG   50 (530)
Q Consensus        22 va~~~HE~GH~-GL~Hs~------~~~~iM~p~y~~   50 (530)
                      +.++|||+||. ||.|-.      ...-||+|....
T Consensus       132 a~~~AHElGH~lG~~HD~~~c~C~~~~cIM~~~~~~  167 (194)
T cd04269         132 AVTMAHELGHNLGMEHDDGGCTCGRSTCIMAPSPSS  167 (194)
T ss_pred             HHHHHHHHHhhcCCCcCCCCCCCCCCCeEecCCCCC
Confidence            44579999999 999944      246799987653


No 39 
>PF13688 Reprolysin_5:  Metallo-peptidase family M12; PDB: 2FV5_B 3EWJ_A 3KME_A 3L0T_B 1BKC_E 3G42_D 2I47_D 2FV9_B 3LEA_A 1ZXC_B ....
Probab=90.40  E-value=0.088  Score=50.43  Aligned_cols=22  Identities=14%  Similarity=-0.044  Sum_probs=12.2

Q ss_pred             hhhhhhhhhccc-cccCCCCCCC
Q psy12290         21 GMNHSWATYGHW-ALSFKMTTIE   42 (530)
Q Consensus        21 ~va~~~HE~GH~-GL~Hs~~~~~   42 (530)
                      .+.++||||||. |+.|-.+...
T Consensus       142 ~~~~~AHEiGH~lGa~HD~~~~~  164 (196)
T PF13688_consen  142 GAITFAHEIGHNLGAPHDGDYSS  164 (196)
T ss_dssp             HHHHHHHHHHHHTT-----SSS-
T ss_pred             eehhhHHhHHHhcCCCCCCCCCC
Confidence            334469999999 9999877654


No 40 
>PRK14131 N-acetylneuraminic acid mutarotase; Provisional
Probab=90.27  E-value=9.4  Score=40.53  Aligned_cols=22  Identities=14%  Similarity=0.069  Sum_probs=16.6

Q ss_pred             eeEEeCCEEEEEECC---eEEEEcC
Q psy12290        241 AIAVIRTEVFVFKDR---WMWRIGD  262 (530)
Q Consensus       241 Avt~irGeiyfFKG~---~~WR~~~  262 (530)
                      |++.+++.||+|-|.   .+|+++-
T Consensus        33 ~~~~~~~~iyv~gG~~~~~~~~~d~   57 (376)
T PRK14131         33 TGAIDNNTVYVGLGSAGTSWYKLDL   57 (376)
T ss_pred             eEEEECCEEEEEeCCCCCeEEEEEC
Confidence            455679999999774   6787764


No 41 
>TIGR03547 muta_rot_YjhT mutatrotase, YjhT family. Members of this protein family contain multiple copies of the beta-propeller-forming Kelch repeat. All are full-length homologs to YjhT of Escherichia coli, which has been identified as a mutarotase for sialic acid. This protein improves bacterial ability to obtain host sialic acid, and thus serves as a virulence factor. Some bacteria carry what appears to be a cyclically permuted homolog of this protein.
Probab=90.03  E-value=5.8  Score=41.20  Aligned_cols=103  Identities=19%  Similarity=0.478  Sum_probs=52.3

Q ss_pred             ccCCCCCccccceEEeeCCcEEEEEc---eeEEEecceecCCCCCcccccCCCCCcccccccEEEeccCCeEEEeeCC--
Q psy12290        278 SELPHNLTHIDAVYQRIDNHIAFFIG---RQYFLFEGIRLLPGYPRPLTALGLPASLERIDAAMVWGYNSKTYLFSGT--  352 (530)
Q Consensus       278 pGLP~~~~~IDAAye~~~gktyFFKG---~~yW~y~~~~l~~GYPK~Is~~GlP~~~~~IDAAf~~~~ngktYFFkG~--  352 (530)
                      |.||..+...=||.  .++++|++-|   +.+|+|+-......+ +.+.  .+|.. ....+++.. .++++|++.|.  
T Consensus         2 ~~lp~~~~~~~~~~--~~~~vyv~GG~~~~~~~~~d~~~~~~~W-~~l~--~~p~~-~R~~~~~~~-~~~~iYv~GG~~~   74 (346)
T TIGR03547         2 PDLPVGFKNGTGAI--IGDKVYVGLGSAGTSWYKLDLKKPSKGW-QKIA--DFPGG-PRNQAVAAA-IDGKLYVFGGIGK   74 (346)
T ss_pred             CCCCccccCceEEE--ECCEEEEEccccCCeeEEEECCCCCCCc-eECC--CCCCC-CcccceEEE-ECCEEEEEeCCCC
Confidence            56665533222333  3689999877   468888732111111 0111  22211 122333322 36899999873  


Q ss_pred             -----------eEEEEeCCCCcccCCCCcccccCCCCC----CCCC-C-EEEecCCCcEEEEEC
Q psy12290        353 -----------RYWKLDDETGRSEPDYPRNMTENWRGV----GVDI-D-DAFQWKDGATYFFKG  399 (530)
Q Consensus       353 -----------~YWryde~~~~vd~gYPk~Is~~w~Gv----P~~I-D-AAf~~~~G~~YFFkG  399 (530)
                                 ..|+||..+++            |..+    |... . +|+...+|++|++-|
T Consensus        75 ~~~~~~~~~~~~v~~Yd~~~~~------------W~~~~~~~p~~~~~~~~~~~~~g~IYviGG  126 (346)
T TIGR03547        75 ANSEGSPQVFDDVYRYDPKKNS------------WQKLDTRSPVGLLGASGFSLHNGQAYFTGG  126 (346)
T ss_pred             CCCCCcceecccEEEEECCCCE------------EecCCCCCCCcccceeEEEEeCCEEEEEcC
Confidence                       47888877653            3222    1111 1 223234789999976


No 42 
>PF07998 Peptidase_M54:  Peptidase family M54;  InterPro: IPR012962 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry based on a common structural fold:  Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases.   In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding.  Metalloproteases are the most diverse of the four main types of protease, with more than 50 families identified to date. In these enzymes, a divalent cation, usually zinc, activates the water molecule. The metal ion is held in place by amino acid ligands, usually three in number. The known metal ligands are His, Glu, Asp or Lys and at least one other residue is required for catalysis, which may play an electrophillic role. Of the known metalloproteases, around half contain an HEXXH motif, which has been shown in crystallographic studies to form part of the metal-binding site []. The HEXXH motif is relatively common, but can be more stringently defined for metalloproteases as 'abXHEbbHbc', where 'a' is most often valine or threonine and forms part of the S1' subsite in thermolysin and neprilysin, 'b' is an uncharged residue, and 'c' a hydrophobic residue. Proline is never found in this site, possibly because it would break the helical structure adopted by this motif in metalloproteases []. This entry represents zinc-dependent peptidases belonging to the MEROPS peptidase family M54, more commonly known as the archaemetzincins. The family has a wide taxonomic distribution, being found in archaea, bacteria and eukaryotes. Two human homologues have been characterised []. ; GO: 0008237 metallopeptidase activity, 0008270 zinc ion binding; PDB: 3LMC_A 2XHQ_A 2X7M_A.
Probab=89.76  E-value=0.11  Score=51.12  Aligned_cols=21  Identities=14%  Similarity=-0.054  Sum_probs=15.1

Q ss_pred             hhhhhccc-cccCCCCCCCeeee
Q psy12290         25 SWATYGHW-ALSFKMTTIEAEFK   46 (530)
Q Consensus        25 ~~HE~GH~-GL~Hs~~~~~iM~p   46 (530)
                      ++||+||. ||+|=.+ .-+|++
T Consensus       149 a~HElGH~~GL~HC~~-~CvM~~  170 (194)
T PF07998_consen  149 AVHELGHLFGLDHCEN-RCVMNF  170 (194)
T ss_dssp             HHHHHHHHTT----SS-TSTTS-
T ss_pred             HHHHHHHHcCCcCCCC-CCccCC
Confidence            49999999 9999999 999987


No 43 
>cd04270 ZnMc_TACE_like Zinc-dependent metalloprotease; TACE_like subfamily. TACE, the tumor-necrosis factor-alpha converting enzyme, releases soluble TNF-alpha from transmembrane pro-TNF-alpha.
Probab=89.12  E-value=0.18  Score=50.80  Aligned_cols=49  Identities=10%  Similarity=0.010  Sum_probs=31.0

Q ss_pred             hhhhhhhccc-cccCCCC-----C------CCeeeecccCCCCccccCCceeecCCCCCCChhHHHHhhccc
Q psy12290         23 NHSWATYGHW-ALSFKMT-----T------IEAEFKWFDGGNSTICTNLSTEVLSPRNQRKKEDRIGESQPF   82 (530)
Q Consensus        23 a~~~HE~GH~-GL~Hs~~-----~------~~iM~p~y~~~~~~~~~~~~~~~l~~~~~~~~dD~~gi~~ly   82 (530)
                      .+||||+||. |+.|-..     +      .=||+|.-.....     .....++      .--+.-|++..
T Consensus       169 ~t~AHElGHnlGm~HD~~~~~C~~~~~~~~~cIM~~~~~~~~~-----~~~~~FS------~CS~~~~~~~L  229 (244)
T cd04270         169 LVTAHELGHNFGSPHDPDIAECAPGESQGGNYIMYARATSGDK-----ENNKKFS------PCSKKSISKVL  229 (244)
T ss_pred             HHHHHHHHHhcCCCCCCCCCCCCCCCCCCCceEecCccccCCC-----CCCCCCC------HhHHHHHHHHH
Confidence            4589999999 9999765     1      3599987532110     1124455      66666665555


No 44 
>PLN02193 nitrile-specifier protein
Probab=89.08  E-value=17  Score=40.01  Aligned_cols=51  Identities=10%  Similarity=0.062  Sum_probs=29.4

Q ss_pred             CCeEEEeeC------CeEEEEeCCCCcccCCCCcccccCCCCCC--CCCCEEEecCCCcEEEEECC
Q psy12290        343 NSKTYLFSG------TRYWKLDDETGRSEPDYPRNMTENWRGVG--VDIDDAFQWKDGATYFFKGK  400 (530)
Q Consensus       343 ngktYFFkG------~~YWryde~~~~vd~gYPk~Is~~w~GvP--~~IDAAf~~~~G~~YFFkG~  400 (530)
                      ++++|++-|      +..|.||..+++-..-     . ....+|  ...-+|... ++++|+|-|.
T Consensus       328 ~gkiyviGG~~g~~~~dv~~yD~~t~~W~~~-----~-~~g~~P~~R~~~~~~~~-~~~iyv~GG~  386 (470)
T PLN02193        328 QGKVWVVYGFNGCEVDDVHYYDPVQDKWTQV-----E-TFGVRPSERSVFASAAV-GKHIVIFGGE  386 (470)
T ss_pred             CCcEEEEECCCCCccCceEEEECCCCEEEEe-----c-cCCCCCCCcceeEEEEE-CCEEEEECCc
Confidence            678999877      6689999887543210     0 001122  122233333 5799999873


No 45 
>cd04272 ZnMc_salivary_gland_MPs Zinc-dependent metalloprotease, salivary_gland_MPs. Metalloproteases secreted by the salivary glands of arthropods.
Probab=87.49  E-value=0.52  Score=46.49  Aligned_cols=19  Identities=16%  Similarity=0.254  Sum_probs=16.0

Q ss_pred             hhhhhhhhhhhccc-cccCC
Q psy12290         19 LYGMNHSWATYGHW-ALSFK   37 (530)
Q Consensus        19 l~~va~~~HE~GH~-GL~Hs   37 (530)
                      +..+.++|||+||. |+.|-
T Consensus       143 ~~~~~~~AHElGH~lG~~HD  162 (220)
T cd04272         143 YYGVYTMTHELAHLLGAPHD  162 (220)
T ss_pred             cccHHHHHHHHHHHhCCCCC
Confidence            45567789999999 99995


No 46 
>cd04280 ZnMc_astacin_like Zinc-dependent metalloprotease, astacin_like subfamily or peptidase family M12A, a group of zinc-dependent proteolytic enzymes with a HExxH zinc-binding site/active site. Members of this family may have an amino terminal propeptide, which is cleaved to yield the active protease domain, which is consequently always found at the N-terminus in multi-domain architectures. This family includes: astacin, a digestive enzyme from Crayfish; meprin, a multiple domain membrane component that is constructed from a homologous alpha and beta chain, proteins involved in (bone) morphogenesis, tolloid from drosophila, and the sea urchin SPAN protein, which may also play a role in development.
Probab=86.92  E-value=0.23  Score=47.79  Aligned_cols=20  Identities=10%  Similarity=-0.031  Sum_probs=16.1

Q ss_pred             hhhhhhhhhhccc-cccCCCCCC
Q psy12290         20 YGMNHSWATYGHW-ALSFKMTTI   41 (530)
Q Consensus        20 ~~va~~~HE~GH~-GL~Hs~~~~   41 (530)
                      ++++  +|||||+ ||.|...+.
T Consensus        75 ~g~v--~HE~~HalG~~HEh~R~   95 (180)
T cd04280          75 LGTI--VHELMHALGFYHEQSRP   95 (180)
T ss_pred             Cchh--HHHHHHHhcCcchhccc
Confidence            3555  9999999 999987654


No 47 
>cd04283 ZnMc_hatching_enzyme Zinc-dependent metalloprotease, hatching enzyme-like subfamily. Hatching enzymes are secreted by teleost embryos to digest the egg envelope or chorion. In some teleosts, the hatching enzyme may be a system consisting of two evolutionary related  metalloproteases, high choriolytic enzyme and low choriolytic enzyme (HCE and LCE), which may have different  substrate specificities and cooperatively digest the chorion.
Probab=84.44  E-value=0.37  Score=46.84  Aligned_cols=19  Identities=16%  Similarity=0.030  Sum_probs=15.7

Q ss_pred             hhhhhhhhhhccc-cccCCCCC
Q psy12290         20 YGMNHSWATYGHW-ALSFKMTT   40 (530)
Q Consensus        20 ~~va~~~HE~GH~-GL~Hs~~~   40 (530)
                      ++++  +|||||+ ||.|-..+
T Consensus        78 ~G~i--~HEl~HaLG~~HEhsR   97 (182)
T cd04283          78 KGII--QHELLHALGFYHEQTR   97 (182)
T ss_pred             cchH--HHHHHHHhCCcccccc
Confidence            3555  9999999 99998765


No 48 
>COG5549 Predicted Zn-dependent protease [Posttranslational modification, protein turnover, chaperones]
Probab=84.20  E-value=0.48  Score=47.09  Aligned_cols=48  Identities=10%  Similarity=0.012  Sum_probs=36.2

Q ss_pred             cccchhhhhhhhhhhccc-ccc-CCCCCCCeeeecccCCCCccccCCceeecCCCCCCChhHHHHhhccc
Q psy12290         15 AIQSLYGMNHSWATYGHW-ALS-FKMTTIEAEFKWFDGGNSTICTNLSTEVLSPRNQRKKEDRIGESQPF   82 (530)
Q Consensus        15 ~~~~l~~va~~~HE~GH~-GL~-Hs~~~~~iM~p~y~~~~~~~~~~~~~~~l~~~~~~~~dD~~gi~~ly   82 (530)
                      .+-+|...|  -||+||+ ||. ||+-+ +.|++..+..           -++      ..|+.-+..+|
T Consensus       183 ~~e~L~~ta--rhElGhaLgi~ghsd~k-s~aly~~s~~-----------~is------~rdv~tL~r~Y  232 (236)
T COG5549         183 LRENLNPTA--RHELGHALGIWGHSDLK-SDALYGISWQ-----------GIS------RRDVKTLERKY  232 (236)
T ss_pred             chhhhhHHH--HHhhcchheecccccch-hhhhcchhhc-----------ccC------HHHHHHHHHHh
Confidence            456777888  9999999 998 87754 5666655532           255      99999999999


No 49 
>PF01400 Astacin:  Astacin (Peptidase family M12A) This Prosite motif covers only the active site.;  InterPro: IPR001506 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry based on a common structural fold:  Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases.   In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding.  Metalloproteases are the most diverse of the four main types of protease, with more than 50 families identified to date. In these enzymes, a divalent cation, usually zinc, activates the water molecule. The metal ion is held in place by amino acid ligands, usually three in number. The known metal ligands are His, Glu, Asp or Lys and at least one other residue is required for catalysis, which may play an electrophillic role. Of the known metalloproteases, around half contain an HEXXH motif, which has been shown in crystallographic studies to form part of the metal-binding site []. The HEXXH motif is relatively common, but can be more stringently defined for metalloproteases as 'abXHEbbHbc', where 'a' is most often valine or threonine and forms part of the S1' subsite in thermolysin and neprilysin, 'b' is an uncharged residue, and 'c' a hydrophobic residue. Proline is never found in this site, possibly because it would break the helical structure adopted by this motif in metalloproteases []. This group of metallopeptidases belong to the MEROPS peptidase family M12, subfamily M12A (astacin family, clan MA(M)). The protein fold of the peptidase domain for members of this family resembles that of thermolysin, the type example for clan MA and the predicted active site residues for members of this family and thermolysin occur in the motif HEXXH []. The astacin () family of metalloendopeptidases encompasses a range of proteins found in hydra to humans, in mature and developmental systems []. Their functions include activation of growth factors, degradation of polypeptides, and processing of extracellular proteins []. The proteins are synthesised with N-terminal signal and pro-enzyme sequences, and many contain multiple domains C-terminal to the protease domain. They are either secreted from cells, or are associated with the plasma membrane. The astacin molecule adopts a kidney shape, with a deep active-site cleft between its N- and C-terminal domains []. The zinc ion, which lies at the bottom of the cleft, exhibits a unique penta-coordinated mode of binding, involving 3 histidine residues, a tyrosine and a water molecule (which is also bound to the carboxylate side chain of Glu93) []. The N-terminal domain comprises 2 alpha-helices and a 5-stranded beta-sheet. The overall topology of this domain is shared by the archetypal zinc-endopeptidase thermolysin. Astacin protease domains also share common features with serralysins, matrix metalloendopeptidases, and snake venom proteases; they cleave peptide bonds in polypeptides such as insulin B chain and bradykinin, and in proteins such as casein and gelatin; and they have arylamidase activity [].; GO: 0004222 metalloendopeptidase activity, 0006508 proteolysis; PDB: 3LQB_A 3EDH_A 3EDG_A 3EDI_A 1IAE_A 1IAB_A 1IAA_A 1AST_A 1IAC_A 1QJJ_A ....
Probab=83.23  E-value=0.41  Score=46.54  Aligned_cols=20  Identities=10%  Similarity=0.061  Sum_probs=14.2

Q ss_pred             hhhhhhhhccc-cccCCCCCC
Q psy12290         22 MNHSWATYGHW-ALSFKMTTI   41 (530)
Q Consensus        22 va~~~HE~GH~-GL~Hs~~~~   41 (530)
                      +++++|||||+ ||.|-..+.
T Consensus        80 ~~~i~HEl~HaLG~~HEh~Rp  100 (191)
T PF01400_consen   80 VGTILHELGHALGFWHEHQRP  100 (191)
T ss_dssp             HHHHHHHHHHHHTB--GGGST
T ss_pred             ccchHHHHHHHHhhhhhhhcc
Confidence            44459999999 999988664


No 50 
>PF02031 Peptidase_M7:  Streptomyces extracellular neutral proteinase (M7) family;  InterPro: IPR000013 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry based on a common structural fold:  Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases.   In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding.  Metalloproteases are the most diverse of the four main types of protease, with more than 50 families identified to date. In these enzymes, a divalent cation, usually zinc, activates the water molecule. The metal ion is held in place by amino acid ligands, usually three in number. The known metal ligands are His, Glu, Asp or Lys and at least one other residue is required for catalysis, which may play an electrophillic role. Of the known metalloproteases, around half contain an HEXXH motif, which has been shown in crystallographic studies to form part of the metal-binding site []. The HEXXH motif is relatively common, but can be more stringently defined for metalloproteases as 'abXHEbbHbc', where 'a' is most often valine or threonine and forms part of the S1' subsite in thermolysin and neprilysin, 'b' is an uncharged residue, and 'c' a hydrophobic residue. Proline is never found in this site, possibly because it would break the helical structure adopted by this motif in metalloproteases []. This group of metallopeptidases belong to the MEROPS peptidase family M7 (snapalysin family, clan MA(M)). The protein fold of the peptidase domain for members of this family resembles that of thermolysin, the type example for clan MA. With a molecular weight of around 16kDa, Streptomyces extracellular neutral protease is one of the smallest known proteases []; it is capable of hydrolysing milk proteins []. The enzyme is synthesised as a proenzyme with a signal peptide, a propeptide and an active domain that contains the conserved HEXXH motif characteristic of metalloproteases. Although family M7 shows active site sequence similarity to other members, it differs in one major respect: the third zinc ligand appears to be an aspartate residue rather than the usual histidine.; GO: 0004222 metalloendopeptidase activity, 0008270 zinc ion binding, 0006508 proteolysis, 0005576 extracellular region; PDB: 1C7K_A 1KUH_A.
Probab=82.46  E-value=0.37  Score=44.44  Aligned_cols=55  Identities=20%  Similarity=0.128  Sum_probs=26.7

Q ss_pred             ccccchhhhhhhhhhhccc-ccc-CCCCC-CCeeeecccCCCCccccCCceeecCCCCCCChhHHHHhhccc
Q psy12290         14 MAIQSLYGMNHSWATYGHW-ALS-FKMTT-IEAEFKWFDGGNSTICTNLSTEVLSPRNQRKKEDRIGESQPF   82 (530)
Q Consensus        14 ~~~~~l~~va~~~HE~GH~-GL~-Hs~~~-~~iM~p~y~~~~~~~~~~~~~~~l~~~~~~~~dD~~gi~~ly   82 (530)
                      ..+.|-.-|+  +||+||. ||- |-.-+ .+||-=   +..+.-|+|.   .-+      ..++..+.+||
T Consensus        72 ~qgy~~~RIa--aHE~GHiLGLPD~y~GpCS~LMSG---~~aG~sCtN~---~Pn------a~E~a~V~~~~  129 (132)
T PF02031_consen   72 NQGYNSTRIA--AHELGHILGLPDHYPGPCSELMSG---GSAGTSCTNA---YPN------AAERARVNSLF  129 (132)
T ss_dssp             HHHS-HHHHH--HHHHHHHHT----TTS-TT-GGGT---TTT-TT-------S--------HHHHHHHHHHC
T ss_pred             hhCCccceee--eehhccccCCCCCCCCccHHhhcC---CCCCCCCCCC---CCC------HHHHHHHHHHh
Confidence            3456667788  9999999 995 33322 334432   1233446662   223      67777777777


No 51 
>COG3824 Predicted Zn-dependent protease [General function prediction only]
Probab=81.60  E-value=0.55  Score=42.87  Aligned_cols=11  Identities=36%  Similarity=0.395  Sum_probs=10.0

Q ss_pred             hhhhhccc-ccc
Q psy12290         25 SWATYGHW-ALS   35 (530)
Q Consensus        25 ~~HE~GH~-GL~   35 (530)
                      ++|||||+ ||+
T Consensus       113 liHEIgHhFGLs  124 (136)
T COG3824         113 LIHEIGHHFGLS  124 (136)
T ss_pred             hhhhhhhhcCCC
Confidence            59999999 996


No 52 
>PF01421 Reprolysin:  Reprolysin (M12B) family zinc metalloprotease  This Prosite motif covers only the active site.;  InterPro: IPR001590 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry based on a common structural fold:  Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases.   In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding.  Metalloproteases are the most diverse of the four main types of protease, with more than 50 families identified to date. In these enzymes, a divalent cation, usually zinc, activates the water molecule. The metal ion is held in place by amino acid ligands, usually three in number. The known metal ligands are His, Glu, Asp or Lys and at least one other residue is required for catalysis, which may play an electrophillic role. Of the known metalloproteases, around half contain an HEXXH motif, which has been shown in crystallographic studies to form part of the metal-binding site []. The HEXXH motif is relatively common, but can be more stringently defined for metalloproteases as 'abXHEbbHbc', where 'a' is most often valine or threonine and forms part of the S1' subsite in thermolysin and neprilysin, 'b' is an uncharged residue, and 'c' a hydrophobic residue. Proline is never found in this site, possibly because it would break the helical structure adopted by this motif in metalloproteases []. This group of metallopeptidases belong to the MEROPS peptidase family M12, subfamily M12B (adamalysin family, clan (MA(M)). The protein fold of the peptidase domain for members of this family resembles that of thermolysin, the type example for clan MA and the predicted active site residues for members of this family and thermolysin occur in the motif HEXXH []. The adamalysins are zinc dependent endopeptidases found in snake venom. There are some mammalian proteins such as P78325 from SWISSPROT, and fertilin Q28472 from SWISSPROT. Fertilin and closely related proteins appear to not have some active site residues and may not be active enzymes. CD156 (also called ADAM8 (3.4.24 from EC) or MS2 human) has been implicated in extravasation of leukocytes. CD molecules are leucocyte antigens on cell surfaces. CD antigens nomenclature is updated at Protein Reviews On The Web (http://prow.nci.nih.gov/). ; GO: 0004222 metalloendopeptidase activity, 0006508 proteolysis; PDB: 2E3X_A 2W15_A 2W14_A 2W13_A 2W12_A 1ND1_A 3K7L_A 2DW2_A 2DW0_B 2DW1_A ....
Probab=81.19  E-value=0.53  Score=45.46  Aligned_cols=25  Identities=8%  Similarity=-0.165  Sum_probs=17.4

Q ss_pred             hhhhhccc-cccCCCC--------CCCeeeeccc
Q psy12290         25 SWATYGHW-ALSFKMT--------TIEAEFKWFD   49 (530)
Q Consensus        25 ~~HE~GH~-GL~Hs~~--------~~~iM~p~y~   49 (530)
                      +|||+||. |+.|-..        ..-||.+...
T Consensus       135 ~AHelGH~lGm~HD~~~~C~C~~~~~cIM~~~~~  168 (199)
T PF01421_consen  135 IAHELGHNLGMPHDGDNGCKCPRRDGCIMSPSIG  168 (199)
T ss_dssp             HHHHHHHHTT---TTTCTHCSSSSSSSTTSSSSS
T ss_pred             HHHHHHHhcCCCCCCCCcCCcCCCCCcccccccc
Confidence            69999999 9999877        3668888544


No 53 
>cd04281 ZnMc_BMP1_TLD Zinc-dependent metalloprotease; BMP1/TLD-like subfamily. BMP1 (Bone morphogenetic protein 1) and TLD (tolloid)-like metalloproteases play vital roles in extracellular matrix formation, by cleaving precursor proteins such as enzymes, structural proteins, and proteins involved in the mineralization of the extracellular matrix. The drosophila protein tolloid and its Xenopus homologue xolloid cleave and inactivate Sog and chordin, respectively, which are inhibitors of Dpp (the Drosophila decapentaplegic gene product) and its homologue BMP4, involved in dorso-ventral patterning.
Probab=80.94  E-value=0.58  Score=46.20  Aligned_cols=19  Identities=21%  Similarity=0.349  Sum_probs=15.5

Q ss_pred             hhhhhhhhhhccc-cccCCCCC
Q psy12290         20 YGMNHSWATYGHW-ALSFKMTT   40 (530)
Q Consensus        20 ~~va~~~HE~GH~-GL~Hs~~~   40 (530)
                      ++++  +|||||+ ||-|-..+
T Consensus        88 ~Gti--~HEl~HaLGf~HEhsR  107 (200)
T cd04281          88 FGIV--VHELGHVIGFWHEHTR  107 (200)
T ss_pred             CchH--HHHHHHHhcCcchhcc
Confidence            3555  9999999 99998754


No 54 
>cd04282 ZnMc_meprin Zinc-dependent metalloprotease, meprin_like subfamily. Meprins are membrane-bound or secreted extracellular proteases, which cleave a variety of targets, including peptides such as parathyroid hormone, gastrin, and cholecystokinin, cytokines such as osteopontin, and proteins such as collagen IV, fibronectin, casein and gelatin. Meprins may also be able to release proteins from the cell surface. Closely related meprin alpha- and beta-subunits form homo- and hetero-oligomers; these complexes are found on epithelial cells of the intestine, for example, and are also expressed in certain cancer cells.
Probab=80.29  E-value=0.7  Score=46.62  Aligned_cols=18  Identities=6%  Similarity=-0.029  Sum_probs=14.9

Q ss_pred             hhhhhhhccc-cccCCCCC
Q psy12290         23 NHSWATYGHW-ALSFKMTT   40 (530)
Q Consensus        23 a~~~HE~GH~-GL~Hs~~~   40 (530)
                      .+++|||||+ ||-|-..+
T Consensus       122 Gti~HEl~HalGf~HEqsR  140 (230)
T cd04282         122 ATVEHEFLHALGFYHEQSR  140 (230)
T ss_pred             chHHHHHHHHhCCcccccc
Confidence            3449999999 99998765


No 55 
>PHA02713 hypothetical protein; Provisional
Probab=80.07  E-value=33  Score=38.81  Aligned_cols=54  Identities=19%  Similarity=0.210  Sum_probs=28.7

Q ss_pred             eeEEeCCEEEEEECCe-------EEEEcCCCccCCCceecccccccCCCCC-ccccceEEeeCCcEEEEEce
Q psy12290        241 AIAVIRTEVFVFKDRW-------MWRIGDKGVLPGYPVLIHQFWSELPHNL-THIDAVYQRIDNHIAFFIGR  304 (530)
Q Consensus       241 Avt~irGeiyfFKG~~-------~WR~~~~~~~~gyP~~Is~~WpGLP~~~-~~IDAAye~~~gktyFFKG~  304 (530)
                      +++.++|.||++-|..       +.+++          ...+.|..++.-. ....++.-.-+|++|++-|.
T Consensus       346 ~~~~~~g~IYviGG~~~~~~~~sve~Yd----------p~~~~W~~~~~mp~~r~~~~~~~~~g~IYviGG~  407 (557)
T PHA02713        346 SLAVIDDTIYAIGGQNGTNVERTIECYT----------MGDDKWKMLPDMPIALSSYGMCVLDQYIYIIGGR  407 (557)
T ss_pred             eEEEECCEEEEECCcCCCCCCceEEEEE----------CCCCeEEECCCCCcccccccEEEECCEEEEEeCC
Confidence            4556799999998741       22222          1234565444311 11112222247999999773


No 56 
>PF10462 Peptidase_M66:  Peptidase M66;  InterPro: IPR019503 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry based on a common structural fold:  Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases.   In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding.  Metalloproteases are the most diverse of the four main types of protease, with more than 50 families identified to date. In these enzymes, a divalent cation, usually zinc, activates the water molecule. The metal ion is held in place by amino acid ligands, usually three in number. The known metal ligands are His, Glu, Asp or Lys and at least one other residue is required for catalysis, which may play an electrophillic role. Of the known metalloproteases, around half contain an HEXXH motif, which has been shown in crystallographic studies to form part of the metal-binding site []. The HEXXH motif is relatively common, but can be more stringently defined for metalloproteases as 'abXHEbbHbc', where 'a' is most often valine or threonine and forms part of the S1' subsite in thermolysin and neprilysin, 'b' is an uncharged residue, and 'c' a hydrophobic residue. Proline is never found in this site, possibly because it would break the helical structure adopted by this motif in metalloproteases [].  This is a family of metallopeptidases belonging to MEROPS peptidase family M66 (StcE peptidase, clan MA). The StcE peptidase is a virulence factor found in Shiga toxigenic Escherichia coli strains. StcE peptidase cleaves C1 esterase inhibitor []. The SwissProt proteins in this entry have been name "Dictomallein". ; GO: 0004222 metalloendopeptidase activity; PDB: 3UJZ_A.
Probab=78.91  E-value=0.78  Score=48.11  Aligned_cols=14  Identities=21%  Similarity=0.057  Sum_probs=10.3

Q ss_pred             hhhhhccc-cccCCC
Q psy12290         25 SWATYGHW-ALSFKM   38 (530)
Q Consensus        25 ~~HE~GH~-GL~Hs~   38 (530)
                      ++||+||+ ||.|..
T Consensus       197 f~HE~GH~~GL~H~p  211 (305)
T PF10462_consen  197 FSHELGHNFGLGHYP  211 (305)
T ss_dssp             HHHHHHHTTT--SST
T ss_pred             eehhhhhhcCCCCCC
Confidence            49999999 999954


No 57 
>KOG3658|consensus
Probab=77.69  E-value=1.5  Score=50.07  Aligned_cols=63  Identities=14%  Similarity=0.150  Sum_probs=40.0

Q ss_pred             hhhhhccc-cccCCCC----------CCCeeeecccCCCCccccCCceeecCCCCCCChhHHHH--hhcccccccccccc
Q psy12290         25 SWATYGHW-ALSFKMT----------TIEAEFKWFDGGNSTICTNLSTEVLSPRNQRKKEDRIG--ESQPFRERTLSICD   91 (530)
Q Consensus        25 ~~HE~GH~-GL~Hs~~----------~~~iM~p~y~~~~~~~~~~~~~~~l~~~~~~~~dD~~g--i~~ly~~~~~~~~G   91 (530)
                      +||||||. |-.|-.+          -+=|||++-..+..   .|+.+|..=  -..+-.++..  .+.-+.++.-++||
T Consensus       396 ~AHEiGHNfGSpHDp~~ECsPg~~~~GnyiM~a~AtSGd~---~NN~kFSpC--S~ksI~~VL~~k~~~CFqE~~~sfCG  470 (764)
T KOG3658|consen  396 LAHEIGHNFGSPHDPDIECSPGESQGGNYIMYAYATSGDK---PNNKKFSPC--SLKSISKVLESKKRNCFQERESSFCG  470 (764)
T ss_pred             ehhhhccccCCCCCCCCccCCCCCCCCcEEEEEecccCcC---ccCcccCcc--hHHHHHHHHHHhhhhhccCccccccC
Confidence            69999999 9999776          23489998775543   245555431  1111223222  25567788889999


Q ss_pred             c
Q psy12290         92 R   92 (530)
Q Consensus        92 ~   92 (530)
                      .
T Consensus       471 N  471 (764)
T KOG3658|consen  471 N  471 (764)
T ss_pred             C
Confidence            4


No 58 
>PF05548 Peptidase_M11:  Gametolysin peptidase M11;  InterPro: IPR008752 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry based on a common structural fold:  Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases.   In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding.  Metalloproteases are the most diverse of the four main types of protease, with more than 50 families identified to date. In these enzymes, a divalent cation, usually zinc, activates the water molecule. The metal ion is held in place by amino acid ligands, usually three in number. The known metal ligands are His, Glu, Asp or Lys and at least one other residue is required for catalysis, which may play an electrophillic role. Of the known metalloproteases, around half contain an HEXXH motif, which has been shown in crystallographic studies to form part of the metal-binding site []. The HEXXH motif is relatively common, but can be more stringently defined for metalloproteases as 'abXHEbbHbc', where 'a' is most often valine or threonine and forms part of the S1' subsite in thermolysin and neprilysin, 'b' is an uncharged residue, and 'c' a hydrophobic residue. Proline is never found in this site, possibly because it would break the helical structure adopted by this motif in metalloproteases []. This group of metallopeptidases belong to the MEROPS peptidase family M11 (gametolysin family, clan MA(M)). The protein fold of the peptidase domain for members of this family resembles that of thermolysin, the type example for clan MA and the predicted active site residues for members of this family and thermolysin occur in the motif HEXXH []. The type example is gametolysin from the unicellular biflagellated alga, Chlamydomonas reinhardtii Gametolysin is a zinc-containing metallo-protease, which is responsible for the degradation of the cell wall. Homologues of gametolysin have also been reported in the simple multicellular organism, Volvox [, ].
Probab=74.30  E-value=1.3  Score=46.61  Aligned_cols=17  Identities=18%  Similarity=0.036  Sum_probs=14.4

Q ss_pred             hhhhhhhccc-cccCCCC
Q psy12290         23 NHSWATYGHW-ALSFKMT   39 (530)
Q Consensus        23 a~~~HE~GH~-GL~Hs~~   39 (530)
                      +++.||+||- ||.||..
T Consensus       152 ~~~~HElgHN~GL~Ha~~  169 (314)
T PF05548_consen  152 ATIMHELGHNLGLWHAGR  169 (314)
T ss_pred             HHHHHHhhhhccccccCC
Confidence            3459999999 9999973


No 59 
>KOG4441|consensus
Probab=70.05  E-value=2e+02  Score=32.78  Aligned_cols=141  Identities=18%  Similarity=0.119  Sum_probs=71.8

Q ss_pred             ceeeEEeCCEEEEEECCe--------EEEEcCCCccCCCceecccccccCCCCC-ccccceEEeeCCcEEEEEceeEEEe
Q psy12290        239 YDAIAVIRTEVFVFKDRW--------MWRIGDKGVLPGYPVLIHQFWSELPHNL-THIDAVYQRIDNHIAFFIGRQYFLF  309 (530)
Q Consensus       239 fDAvt~irGeiyfFKG~~--------~WR~~~~~~~~gyP~~Is~~WpGLP~~~-~~IDAAye~~~gktyFFKG~~yW~y  309 (530)
                      -.+++.++|.+|+.-|..        +|+++...          +-|..+++-. .+.+++....+|.+|..-|.--+.+
T Consensus       325 ~~~~~~~~~~lYv~GG~~~~~~~l~~ve~YD~~~----------~~W~~~a~M~~~R~~~~v~~l~g~iYavGG~dg~~~  394 (571)
T KOG4441|consen  325 RVGVAVLNGKLYVVGGYDSGSDRLSSVERYDPRT----------NQWTPVAPMNTKRSDFGVAVLDGKLYAVGGFDGEKS  394 (571)
T ss_pred             cccEEEECCEEEEEccccCCCcccceEEEecCCC----------CceeccCCccCccccceeEEECCEEEEEeccccccc
Confidence            456667889999887754        45554322          1276665421 2455555556899998877553322


Q ss_pred             cceecCCCC-CcccccCCCCC--cccccccEEEeccCCeEEEeeC--------CeEEEEeCCCCcccCCCCcccccCCCC
Q psy12290        310 EGIRLLPGY-PRPLTALGLPA--SLERIDAAMVWGYNSKTYLFSG--------TRYWKLDDETGRSEPDYPRNMTENWRG  378 (530)
Q Consensus       310 ~~~~l~~GY-PK~Is~~GlP~--~~~~IDAAf~~~~ngktYFFkG--------~~YWryde~~~~vd~gYPk~Is~~w~G  378 (530)
                      -. .++ -| |+ ...|..=.  ....--++.. ..+|++|.+.|        +.+-+||..+++....=|......+.|
T Consensus       395 l~-svE-~YDp~-~~~W~~va~m~~~r~~~gv~-~~~g~iYi~GG~~~~~~~l~sve~YDP~t~~W~~~~~M~~~R~~~g  470 (571)
T KOG4441|consen  395 LN-SVE-CYDPV-TNKWTPVAPMLTRRSGHGVA-VLGGKLYIIGGGDGSSNCLNSVECYDPETNTWTLIAPMNTRRSGFG  470 (571)
T ss_pred             cc-cEE-EecCC-CCcccccCCCCcceeeeEEE-EECCEEEEEcCcCCCccccceEEEEcCCCCceeecCCcccccccce
Confidence            11 011 01 11 12242211  0011112221 24799999988        456678877654332222222222111


Q ss_pred             CCCCCCEEEecCCCcEEEEECCe
Q psy12290        379 VGVDIDDAFQWKDGATYFFKGKG  401 (530)
Q Consensus       379 vP~~IDAAf~~~~G~~YFFkG~~  401 (530)
                            +|+.  +|++|...|..
T Consensus       471 ------~a~~--~~~iYvvGG~~  485 (571)
T KOG4441|consen  471 ------VAVL--NGKIYVVGGFD  485 (571)
T ss_pred             ------EEEE--CCEEEEECCcc
Confidence                  3443  68999998843


No 60 
>KOG3714|consensus
Probab=68.84  E-value=1.8  Score=47.07  Aligned_cols=19  Identities=11%  Similarity=0.072  Sum_probs=16.5

Q ss_pred             hhhhhhhhhhccc-cccCCCCC
Q psy12290         20 YGMNHSWATYGHW-ALSFKMTT   40 (530)
Q Consensus        20 ~~va~~~HE~GH~-GL~Hs~~~   40 (530)
                      ++++  +|||+|+ |+-|-..+
T Consensus       160 ~G~i--~HEl~HaLGf~HehsR  179 (411)
T KOG3714|consen  160 FGTI--VHELMHALGFWHEHSR  179 (411)
T ss_pred             Cchh--HHHHHHHhhhhhccCc
Confidence            7888  9999999 99998744


No 61 
>PF12044 Metallopep:  Putative peptidase family;  InterPro: IPR021917  This family of proteins is functionally uncharacterised. However, it does contain an HEXXH motif characteristic of metallopeptidases. This protein is found in bacteria and eukaryotes. Proteins in this family are typically between 625 to 773 amino acids in length. 
Probab=66.31  E-value=2.9  Score=45.88  Aligned_cols=24  Identities=13%  Similarity=0.145  Sum_probs=19.7

Q ss_pred             hhhhhccc-cccCCCCCCCeeeecccC
Q psy12290         25 SWATYGHW-ALSFKMTTIEAEFKWFDG   50 (530)
Q Consensus        25 ~~HE~GH~-GL~Hs~~~~~iM~p~y~~   50 (530)
                      ++||+||+ ||.|..+  -||--=|..
T Consensus       320 ~lHEiGH~fg~pH~~~--GIM~Rdy~~  344 (423)
T PF12044_consen  320 FLHEIGHLFGCPHQED--GIMLRDYDR  344 (423)
T ss_pred             HHHHHHHhcCCCCCCC--CeeeCCchh
Confidence            69999999 9999977  688765554


No 62 
>PHA02790 Kelch-like protein; Provisional
Probab=64.32  E-value=2.2e+02  Score=31.51  Aligned_cols=133  Identities=11%  Similarity=0.033  Sum_probs=61.8

Q ss_pred             EEeCCEEEEEECC-------eEEEEcCCCccCCCceecccccccCCCCC-ccccceEEeeCCcEEEEEce----eEEEec
Q psy12290        243 AVIRTEVFVFKDR-------WMWRIGDKGVLPGYPVLIHQFWSELPHNL-THIDAVYQRIDNHIAFFIGR----QYFLFE  310 (530)
Q Consensus       243 t~irGeiyfFKG~-------~~WR~~~~~~~~gyP~~Is~~WpGLP~~~-~~IDAAye~~~gktyFFKG~----~yW~y~  310 (530)
                      +.+++.+|++-|.       .+|+++..          ..-|-.++.-- ....++.-..++++|+.-|.    .+++|+
T Consensus       268 ~~~~~~lyviGG~~~~~~~~~v~~Ydp~----------~~~W~~~~~m~~~r~~~~~v~~~~~iYviGG~~~~~sve~yd  337 (480)
T PHA02790        268 THVGEVVYLIGGWMNNEIHNNAIAVNYI----------SNNWIPIPPMNSPRLYASGVPANNKLYVVGGLPNPTSVERWF  337 (480)
T ss_pred             EEECCEEEEEcCCCCCCcCCeEEEEECC----------CCEEEECCCCCchhhcceEEEECCEEEEECCcCCCCceEEEE
Confidence            3467888888773       35555432          12344443210 11222222247899998773    345554


Q ss_pred             ceecCCCCCcccccCCCCCcccccccEEEeccCCeEEEeeCC-----eEEEEeCCCCcccCCCCcccccCCCCCCC----
Q psy12290        311 GIRLLPGYPRPLTALGLPASLERIDAAMVWGYNSKTYLFSGT-----RYWKLDDETGRSEPDYPRNMTENWRGVGV----  381 (530)
Q Consensus       311 ~~~l~~GYPK~Is~~GlP~~~~~IDAAf~~~~ngktYFFkG~-----~YWryde~~~~vd~gYPk~Is~~w~GvP~----  381 (530)
                      ...  ..+ ..+.  .+|...... |+..  .+|++|++.|.     ..-+||..++            .|.-++.    
T Consensus       338 p~~--n~W-~~~~--~l~~~r~~~-~~~~--~~g~IYviGG~~~~~~~ve~ydp~~~------------~W~~~~~m~~~  397 (480)
T PHA02790        338 HGD--AAW-VNMP--SLLKPRCNP-AVAS--INNVIYVIGGHSETDTTTEYLLPNHD------------QWQFGPSTYYP  397 (480)
T ss_pred             CCC--CeE-EECC--CCCCCCccc-EEEE--ECCEEEEecCcCCCCccEEEEeCCCC------------EEEeCCCCCCc
Confidence            210  000 0011  222211111 2222  47899999873     2334555443            3433320    


Q ss_pred             CCC-EEEecCCCcEEEEECCeEEEEec
Q psy12290        382 DID-DAFQWKDGATYFFKGKGFWKFKD  407 (530)
Q Consensus       382 ~ID-AAf~~~~G~~YFFkG~~Ywrfd~  407 (530)
                      .-. +|.. -+|++|.+-|. .-.||.
T Consensus       398 r~~~~~~~-~~~~IYv~GG~-~e~ydp  422 (480)
T PHA02790        398 HYKSCALV-FGRRLFLVGRN-AEFYCE  422 (480)
T ss_pred             cccceEEE-ECCEEEEECCc-eEEecC
Confidence            111 2333 36899999763 334554


No 63 
>PHA02790 Kelch-like protein; Provisional
Probab=62.89  E-value=2.5e+02  Score=31.09  Aligned_cols=49  Identities=6%  Similarity=-0.046  Sum_probs=26.3

Q ss_pred             cCCeEEEeeCCeEEEEeCCCCcccCCCCcccccCCCCCCC-CCCEEEecCCCcEEEEECC
Q psy12290        342 YNSKTYLFSGTRYWKLDDETGRSEPDYPRNMTENWRGVGV-DIDDAFQWKDGATYFFKGK  400 (530)
Q Consensus       342 ~ngktYFFkG~~YWryde~~~~vd~gYPk~Is~~w~GvP~-~IDAAf~~~~G~~YFFkG~  400 (530)
                      .+|++|++.|. .-.||..+++-...         ..++. ...+....-+|++|.+-|.
T Consensus       406 ~~~~IYv~GG~-~e~ydp~~~~W~~~---------~~m~~~r~~~~~~v~~~~IYviGG~  455 (480)
T PHA02790        406 FGRRLFLVGRN-AEFYCESSNTWTLI---------DDPIYPRDNPELIIVDNKLLLIGGF  455 (480)
T ss_pred             ECCEEEEECCc-eEEecCCCCcEeEc---------CCCCCCccccEEEEECCEEEEECCc
Confidence            36899999764 45677665432111         11111 1222222236899999873


No 64 
>TIGR00181 pepF oligoendopeptidase F. This family represents the oligoendopeptidase F clade of the family of larger M3 or thimet (for thiol-dependent metallopeptidase) oligopeptidase family. Lactococcus lactis PepF hydrolyzed peptides of 7 and 17 amino acids with fairly broad specificity. The homolog of lactococcal PepF in group B Streptococcus was named PepB (PubMed:8757883), with the name difference reflecting a difference in species of origin rather activity; substrate profiles were quite similar. Differences in substrate specificity should be expected in other species. The gene is duplicated in Lactococcus lactis on the plasmid that bears it. A shortened second copy is found in Bacillus subtilis.
Probab=51.49  E-value=5.7  Score=44.86  Aligned_cols=15  Identities=20%  Similarity=0.122  Sum_probs=13.3

Q ss_pred             chhhhhhhhhhhccc
Q psy12290         18 SLYGMNHSWATYGHW   32 (530)
Q Consensus        18 ~l~~va~~~HE~GH~   32 (530)
                      ++..|.|++||+||+
T Consensus       375 ~~~dv~TLaHElGHa  389 (591)
T TIGR00181       375 TLNSVFTLAHELGHS  389 (591)
T ss_pred             CcchHHHHHHHhhhH
Confidence            467889999999999


No 65 
>PF06262 DUF1025:  Possibl zinc metallo-peptidase;  InterPro: IPR010428 This is a family of bacterial protein with undetermined function.; PDB: 3E11_A.
Probab=50.53  E-value=5.8  Score=34.93  Aligned_cols=11  Identities=18%  Similarity=0.151  Sum_probs=8.5

Q ss_pred             hhhhhccc-ccc
Q psy12290         25 SWATYGHW-ALS   35 (530)
Q Consensus        25 ~~HE~GH~-GL~   35 (530)
                      ++||+||. |++
T Consensus        77 lvhEiah~fG~~   88 (97)
T PF06262_consen   77 LVHEIAHHFGIS   88 (97)
T ss_dssp             HHHHHHHHTT--
T ss_pred             HHHHHHHHcCCC
Confidence            69999999 985


No 66 
>PF08450 SGL:  SMP-30/Gluconolaconase/LRE-like region;  InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species. These proteins include various enzymes, such as senescence marker protein 30 (SMP-30, Q15493 from SWISSPROT), gluconolactonase (Q01578 from SWISSPROT) and luciferin-regenerating enzyme (LRE, Q86DU5 from SWISSPROT). SMP-30 is known to hydrolyse diisopropyl phosphorofluoridate in the liver, and has been noted as having sequence similarity, in the region described in this family, with PON1 (P52430 from SWISSPROT) and LRE. ; PDB: 2GHS_A 2DG0_L 2DG1_D 2DSO_D 3E5Z_A 2IAT_A 2IAV_A 2GVV_A 3HLI_A 2GVU_A ....
Probab=50.26  E-value=2.2e+02  Score=27.71  Aligned_cols=147  Identities=14%  Similarity=0.153  Sum_probs=73.1

Q ss_pred             CCEEEEEECCeEEEEcCCCccCCCceecccccccCCCCCccc-cceEEeeCCcEEEEEc----------eeEEEecceec
Q psy12290        246 RTEVFVFKDRWMWRIGDKGVLPGYPVLIHQFWSELPHNLTHI-DAVYQRIDNHIAFFIG----------RQYFLFEGIRL  314 (530)
Q Consensus       246 rGeiyfFKG~~~WR~~~~~~~~gyP~~Is~~WpGLP~~~~~I-DAAye~~~gktyFFKG----------~~yW~y~~~~l  314 (530)
                      +|.+|+-...-...++..   .+.-..+.+...+- ..+... |.++ .++|++||=.-          .++|+++... 
T Consensus        51 ~g~l~v~~~~~~~~~d~~---~g~~~~~~~~~~~~-~~~~~~ND~~v-d~~G~ly~t~~~~~~~~~~~~g~v~~~~~~~-  124 (246)
T PF08450_consen   51 DGRLYVADSGGIAVVDPD---TGKVTVLADLPDGG-VPFNRPNDVAV-DPDGNLYVTDSGGGGASGIDPGSVYRIDPDG-  124 (246)
T ss_dssp             TSEEEEEETTCEEEEETT---TTEEEEEEEEETTC-SCTEEEEEEEE--TTS-EEEEEECCBCTTCGGSEEEEEEETTS-
T ss_pred             CCEEEEEEcCceEEEecC---CCcEEEEeeccCCC-cccCCCceEEE-cCCCCEEEEecCCCccccccccceEEECCCC-
Confidence            577777776666666422   12122232221111 011123 4444 35788777421          4577776541 


Q ss_pred             CCCCCccc-ccCCCCCcccccccEEEeccCCeEEEe---eCCeEEEEeCCCCcccCCCCcccccCCCCCCCCCCEEEecC
Q psy12290        315 LPGYPRPL-TALGLPASLERIDAAMVWGYNSKTYLF---SGTRYWKLDDETGRSEPDYPRNMTENWRGVGVDIDDAFQWK  390 (530)
Q Consensus       315 ~~GYPK~I-s~~GlP~~~~~IDAAf~~~~ngktYFF---kG~~YWryde~~~~vd~gYPk~Is~~w~GvP~~IDAAf~~~  390 (530)
                         -.+.+ ..+..|      .+ +.+..+++++++   ...+.|+|+..........++.+. .+.+.....|......
T Consensus       125 ---~~~~~~~~~~~p------NG-i~~s~dg~~lyv~ds~~~~i~~~~~~~~~~~~~~~~~~~-~~~~~~g~pDG~~vD~  193 (246)
T PF08450_consen  125 ---KVTVVADGLGFP------NG-IAFSPDGKTLYVADSFNGRIWRFDLDADGGELSNRRVFI-DFPGGPGYPDGLAVDS  193 (246)
T ss_dssp             ---EEEEEEEEESSE------EE-EEEETTSSEEEEEETTTTEEEEEEEETTTCCEEEEEEEE-E-SSSSCEEEEEEEBT
T ss_pred             ---eEEEEecCcccc------cc-eEECCcchheeecccccceeEEEeccccccceeeeeeEE-EcCCCCcCCCcceEcC
Confidence               01112 223333      22 233456665443   367899999754322111223232 2333334588888878


Q ss_pred             CCcEEEE--ECCeEEEEeccc
Q psy12290        391 DGATYFF--KGKGFWKFKDVS  409 (530)
Q Consensus       391 ~G~~YFF--kG~~Ywrfd~~~  409 (530)
                      +|.+|.-  .+.+.++|+...
T Consensus       194 ~G~l~va~~~~~~I~~~~p~G  214 (246)
T PF08450_consen  194 DGNLWVADWGGGRIVVFDPDG  214 (246)
T ss_dssp             TS-EEEEEETTTEEEEEETTS
T ss_pred             CCCEEEEEcCCCEEEEECCCc
Confidence            9999875  789999999873


No 67 
>TIGR03296 M6dom_TIGR03296 M6 family metalloprotease domain. This model describes a metalloproteinase domain, with a characteristic HExxH motif. Examples of this domain are found in proteins in the family of immune inhibitor A, which cleaves antibacterial peptides, and in other, only distantly related proteases. This model is built to be broader and more inclusive than Pfam model pfam05547.
Probab=49.10  E-value=5.9  Score=40.96  Aligned_cols=19  Identities=21%  Similarity=0.032  Sum_probs=14.7

Q ss_pred             hhhhhhhhccc-cccCCCCC
Q psy12290         22 MNHSWATYGHW-ALSFKMTT   40 (530)
Q Consensus        22 va~~~HE~GH~-GL~Hs~~~   40 (530)
                      |.+++||+||. ||-+-.+.
T Consensus       166 igv~~HE~gH~lGLPDlY~~  185 (286)
T TIGR03296       166 VGVIAHELGHDLGLPDLYDT  185 (286)
T ss_pred             eeeeehhhhcccCCCccccC
Confidence            44459999999 99886653


No 68 
>cd06455 M3A_TOP Peptidase M3 Thimet oligopeptidase (TOP; PZ-peptidase; endo-oligopeptidase A; endopeptidase 24.15; soluble metallo-endopeptidase; EC 3.4.24.15) family also includes neurolysin (endopeptidase 24.16, microsomal endopeptidase, mitochondrial oligopeptidase M, neurotensin endopeptidase, soluble angiotensin II-binding protein, thimet oligopeptidase II) which hydrolyzes oligopeptides such as neurotensin, bradykinin and dynorphin A. TOP and neurolysin are neuropeptidases expressed abundantly in the testis, but also found in the liver, lung and kidney. They are involved in the metabolism of neuropeptides under 20 amino acid residues long and cleave most bioactive peptides at the same sites, but recognize different positions on some naturally occurring and synthetic peptides; they cleave at distinct sites on the 13-residue bioactive peptide neurotensin, which modulates central dopaminergic and cholinergic circuits.  TOP has been shown to degrade peptides released by the proteasom
Probab=48.17  E-value=9.8  Score=42.01  Aligned_cols=16  Identities=13%  Similarity=0.208  Sum_probs=13.8

Q ss_pred             cchhhhhhhhhhhccc
Q psy12290         17 QSLYGMNHSWATYGHW   32 (530)
Q Consensus        17 ~~l~~va~~~HE~GH~   32 (530)
                      .++-.|.||+||+||+
T Consensus       259 l~~~~V~TLfHEfGHa  274 (472)
T cd06455         259 LRHDEVETFFHEFGHV  274 (472)
T ss_pred             CCHHHHHHHHHHHHHH
Confidence            4477899999999999


No 69 
>TIGR02290 M3_fam_3 oligoendopeptidase, pepF/M3 family. The M3 family of metallopeptidases contains several distinct clades. Oligoendopeptidase F as characterized in Lactococcus, the functionally equivalent oligoendopeptidase B of group B Streptococcus, and closely related sequences are described by TIGR00181. The present family is quite similar but forms a distinct clade, and a number of species have one member of each. A greater sequence difference separates members of TIGR02289, probable oligoendopeptidases of the M3 family that probably should not be designated PepF.
Probab=46.85  E-value=7.5  Score=44.02  Aligned_cols=15  Identities=20%  Similarity=0.067  Sum_probs=13.2

Q ss_pred             chhhhhhhhhhhccc
Q psy12290         18 SLYGMNHSWATYGHW   32 (530)
Q Consensus        18 ~l~~va~~~HE~GH~   32 (530)
                      ++..|.||+||+||+
T Consensus       372 ~~~~v~TL~HE~GHa  386 (587)
T TIGR02290       372 SRRDVSTLAHELGHA  386 (587)
T ss_pred             CchhHHHHHHHhhHH
Confidence            467788999999999


No 70 
>KOG3607|consensus
Probab=45.92  E-value=8.5  Score=44.97  Aligned_cols=17  Identities=12%  Similarity=-0.048  Sum_probs=14.9

Q ss_pred             hhhhhhhhccc-cccCCC
Q psy12290         22 MNHSWATYGHW-ALSFKM   38 (530)
Q Consensus        22 va~~~HE~GH~-GL~Hs~   38 (530)
                      +++||||+||. |+.|-.
T Consensus       324 a~v~AhelgH~lGm~hD~  341 (716)
T KOG3607|consen  324 AVVLAHELGHNLGMIHDE  341 (716)
T ss_pred             HHHHHHHHHhhcCccccc
Confidence            44589999999 999987


No 71 
>PF09471 Peptidase_M64:  IgA Peptidase M64;  InterPro: IPR019026 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry based on a common structural fold:  Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases.   In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding.  Metalloproteases are the most diverse of the four main types of protease, with more than 50 families identified to date. In these enzymes, a divalent cation, usually zinc, activates the water molecule. The metal ion is held in place by amino acid ligands, usually three in number. The known metal ligands are His, Glu, Asp or Lys and at least one other residue is required for catalysis, which may play an electrophillic role. Of the known metalloproteases, around half contain an HEXXH motif, which has been shown in crystallographic studies to form part of the metal-binding site []. The HEXXH motif is relatively common, but can be more stringently defined for metalloproteases as 'abXHEbbHbc', where 'a' is most often valine or threonine and forms part of the S1' subsite in thermolysin and neprilysin, 'b' is an uncharged residue, and 'c' a hydrophobic residue. Proline is never found in this site, possibly because it would break the helical structure adopted by this motif in metalloproteases [].  This is a family of highly selective metallo-endopeptidases belonging to the MEROPS peptidase family M64 (IgA peptidase, clan MA). The primary structure of the Clostridium ramosum IgA peptidase shows no significant overall similarity to any other known metallo-endopeptidase []. ; PDB: 3P1V_A 4DF9_D.
Probab=45.47  E-value=7.2  Score=40.18  Aligned_cols=18  Identities=17%  Similarity=0.211  Sum_probs=9.4

Q ss_pred             hhhhhhhhhhhccc--cccCCC
Q psy12290         19 LYGMNHSWATYGHW--ALSFKM   38 (530)
Q Consensus        19 l~~va~~~HE~GH~--GL~Hs~   38 (530)
                      .-.|+  +||+||+  ||+=-.
T Consensus       216 ~~~v~--vHE~GHsf~~LaDEY  235 (264)
T PF09471_consen  216 FKQVV--VHEFGHSFGGLADEY  235 (264)
T ss_dssp             HHHHH--HHHHHHHTT------
T ss_pred             cccee--eeecccccccccccc
Confidence            34566  9999998  786433


No 72 
>cd06459 M3B_Oligoendopeptidase_F Peptidase family M3B Oligopeptidase F (PepF; Pz-peptidase B; EC 3.4.24.-) is mostly bacterial and includes oligoendopeptidase F from Lactococcus lactis. This enzyme hydrolyzes peptides containing between 7 and 17 amino acids with fairly broad specificity. The PepF gene is duplicated in L. lactis on the plasmid that bears it, while a shortened second copy is found in Bacillus subtilis. Most bacterial PepFs are cytoplasmic endopeptidases; however, the PepF Bacillus amyloliquefaciens oligopeptidase is a secreted protein and may facilitate the process of sporulation. Specifically, the yjbG gene encoding the homolog of the PepF1 and PepF2 oligoendopeptidases of Lactococcus lactis has been identified in Bacillus subtilis as an inhibitor of sporulation initiation when over expressed from a multicopy plasmid.
Probab=45.32  E-value=8.3  Score=41.16  Aligned_cols=15  Identities=20%  Similarity=0.078  Sum_probs=12.6

Q ss_pred             chhhhhhhhhhhccc
Q psy12290         18 SLYGMNHSWATYGHW   32 (530)
Q Consensus        18 ~l~~va~~~HE~GH~   32 (530)
                      ++..|.||+||+||+
T Consensus       219 ~~~~v~tl~HE~GHa  233 (427)
T cd06459         219 TLDDVFTLAHELGHA  233 (427)
T ss_pred             ChhhHHHHHHHhhHH
Confidence            466788899999997


No 73 
>KOG4693|consensus
Probab=44.04  E-value=4.2e+02  Score=28.09  Aligned_cols=77  Identities=21%  Similarity=0.425  Sum_probs=41.6

Q ss_pred             CCCCcccccccEEEeccCCeEEEeeCC--eEEEEeCCCCcccCCCCcc------cccCCCCCC--------CCCCEEEec
Q psy12290        326 GLPASLERIDAAMVWGYNSKTYLFSGT--RYWKLDDETGRSEPDYPRN------MTENWRGVG--------VDIDDAFQW  389 (530)
Q Consensus       326 GlP~~~~~IDAAf~~~~ngktYFFkG~--~YWryde~~~~vd~gYPk~------Is~~w~GvP--------~~IDAAf~~  389 (530)
                      |.|..-...-+|...  ++..|+|.|.  +.=-|....    +.|=..      -.+.|...|        ..-.++|.+
T Consensus       176 g~PprwRDFH~a~~~--~~~MYiFGGR~D~~gpfHs~~----e~Yc~~i~~ld~~T~aW~r~p~~~~~P~GRRSHS~fvY  249 (392)
T KOG4693|consen  176 GDPPRWRDFHTASVI--DGMMYIFGGRSDESGPFHSIH----EQYCDTIMALDLATGAWTRTPENTMKPGGRRSHSTFVY  249 (392)
T ss_pred             CCCchhhhhhhhhhc--cceEEEeccccccCCCccchh----hhhcceeEEEeccccccccCCCCCcCCCcccccceEEE
Confidence            555544445566654  5899999763  222221111    111111      113455443        245678886


Q ss_pred             CCCcEEEEEC---------CeEEEEeccc
Q psy12290        390 KDGATYFFKG---------KGFWKFKDVS  409 (530)
Q Consensus       390 ~~G~~YFFkG---------~~Ywrfd~~~  409 (530)
                       ||++|.|-|         +..|.||..+
T Consensus       250 -ng~~Y~FGGYng~ln~HfndLy~FdP~t  277 (392)
T KOG4693|consen  250 -NGKMYMFGGYNGTLNVHFNDLYCFDPKT  277 (392)
T ss_pred             -cceEEEecccchhhhhhhcceeeccccc
Confidence             799999976         3457777654


No 74 
>PF06114 DUF955:  Domain of unknown function (DUF955);  InterPro: IPR010359 This is a family of bacterial and viral proteins with undetermined function. A conserved H-E-X-X-H motif is suggestive of a catalytic active site and shows similarity to IPR001915 from INTERPRO.; PDB: 3DTE_A 3DTK_A 3DTI_A.
Probab=43.88  E-value=8.2  Score=32.79  Aligned_cols=14  Identities=21%  Similarity=0.064  Sum_probs=10.2

Q ss_pred             hhhhhccccccCCC
Q psy12290         25 SWATYGHWALSFKM   38 (530)
Q Consensus        25 ~~HE~GH~GL~Hs~   38 (530)
                      ++|||||.=|+|..
T Consensus        46 laHELgH~~~~~~~   59 (122)
T PF06114_consen   46 LAHELGHILLHHGD   59 (122)
T ss_dssp             HHHHHHHHHHHH-H
T ss_pred             HHHHHHHHHhhhcc
Confidence            48999999665554


No 75 
>TIGR02289 M3_not_pepF oligoendopeptidase, M3 family. This family consists of probable oligoendopeptidases in the M3 family, related to lactococcal PepF and group B streptococcal PepB (TIGR00181) but in a distinct clade with considerable sequence differences. The likely substrate is small peptides and not whole proteins, as with PepF, but members are not characterized and the activity profile may differ. Several bacteria have both a member of this family and a member of the PepF family.
Probab=42.79  E-value=9.4  Score=42.95  Aligned_cols=15  Identities=13%  Similarity=-0.031  Sum_probs=12.8

Q ss_pred             chhhhhhhhhhhccc
Q psy12290         18 SLYGMNHSWATYGHW   32 (530)
Q Consensus        18 ~l~~va~~~HE~GH~   32 (530)
                      .+..|.||+||+||+
T Consensus       334 t~~dv~TL~HElGHa  348 (549)
T TIGR02289       334 TSGDIDVLTHEAGHA  348 (549)
T ss_pred             ChhHHHHHHHHhhHH
Confidence            466788899999999


No 76 
>KOG2719|consensus
Probab=42.48  E-value=3.2  Score=45.40  Aligned_cols=27  Identities=22%  Similarity=0.303  Sum_probs=22.6

Q ss_pred             chhhhhhhhhhhccccccCCCCCCCeeee
Q psy12290         18 SLYGMNHSWATYGHWALSFKMTTIEAEFK   46 (530)
Q Consensus        18 ~l~~va~~~HE~GH~GL~Hs~~~~~iM~p   46 (530)
                      .+.+|.  +||+|||-+.|-....++|+=
T Consensus       279 el~AVl--~HELGHW~~~H~~K~~ii~~~  305 (428)
T KOG2719|consen  279 ELVAVL--AHELGHWKLNHVLKNIIIMQI  305 (428)
T ss_pred             HHHHHH--HHHhhHHHHhhHHHHHHHHHH
Confidence            467777  999999999999888877763


No 77 
>PF01432 Peptidase_M3:  Peptidase family M3 This Prosite motif covers only the active site. This family belongs to family M3 of the peptidase classification.;  InterPro: IPR001567 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry based on a common structural fold:  Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases.   In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding.  Metalloproteases are the most diverse of the four main types of protease, with more than 50 families identified to date. In these enzymes, a divalent cation, usually zinc, activates the water molecule. The metal ion is held in place by amino acid ligands, usually three in number. The known metal ligands are His, Glu, Asp or Lys and at least one other residue is required for catalysis, which may play an electrophillic role. Of the known metalloproteases, around half contain an HEXXH motif, which has been shown in crystallographic studies to form part of the metal-binding site []. The HEXXH motif is relatively common, but can be more stringently defined for metalloproteases as 'abXHEbbHbc', where 'a' is most often valine or threonine and forms part of the S1' subsite in thermolysin and neprilysin, 'b' is an uncharged residue, and 'c' a hydrophobic residue. Proline is never found in this site, possibly because it would break the helical structure adopted by this motif in metalloproteases []. This group of metallopeptidases belong to MEROPS peptidase family M3 (clan MA(E)), subfamilies M3A and M3B. The protein fold of the peptidase domain for members of this family resembles that of thermolysin, the type example for clan MA. The Thimet oligopeptidase family, is a large family of archaeal, bacterial and eukaryotic oligopeptidases that cleave medium sized peptides. The group contains:  mitochondrial intermediate peptidase (3.4.24.59 from EC) Neurolysin, mitochondrial precursor, (3.4.24.16 from EC) Thimet oligopeptidase (3.4.24.15 from EC) Dipeptidyl carboxypeptidase (3.4.15.5 from EC) Oligopeptidase A (3.4.24.70 from EC) Oligoendopeptidase F ; GO: 0004222 metalloendopeptidase activity, 0006508 proteolysis; PDB: 2QR4_B 3CE2_A 1Y79_1 2H1J_A 2H1N_A 2O36_A 1S4B_P 2O3E_A 1I1I_P.
Probab=42.41  E-value=10  Score=41.28  Aligned_cols=17  Identities=18%  Similarity=0.309  Sum_probs=13.8

Q ss_pred             ccchhhhhhhhhhhccc
Q psy12290         16 IQSLYGMNHSWATYGHW   32 (530)
Q Consensus        16 ~~~l~~va~~~HE~GH~   32 (530)
                      ..++..|-|++||+||+
T Consensus       237 ll~~~~v~tLfHE~GHa  253 (458)
T PF01432_consen  237 LLSHDDVETLFHEFGHA  253 (458)
T ss_dssp             B-SHHHHHHHHHHHHHH
T ss_pred             ccChhhHHHHHHHHhHH
Confidence            34667889999999999


No 78 
>PF04298 Zn_peptidase_2:  Putative neutral zinc metallopeptidase;  InterPro: IPR007395 Members of this family of bacterial proteins are described as hypothetical proteins or zinc-dependent proteases. The majority have a HExxH zinc-binding motif characteristic of neutral zinc metallopeptidases, however there is no evidence to support their function as metallopeptidases.
Probab=39.64  E-value=14  Score=37.23  Aligned_cols=24  Identities=13%  Similarity=0.059  Sum_probs=16.3

Q ss_pred             ccccchhhhhhhhhhhccccccCCC
Q psy12290         14 MAIQSLYGMNHSWATYGHWALSFKM   38 (530)
Q Consensus        14 ~~~~~l~~va~~~HE~GH~GL~Hs~   38 (530)
                      ..+.++-+||.-+||.||+ +.|..
T Consensus        82 y~~~SiaAvaVAAHEvGHA-iQ~a~  105 (222)
T PF04298_consen   82 YNGRSIAAVAVAAHEVGHA-IQHAE  105 (222)
T ss_pred             CCCCCHHHHHHHHHHHhHH-Hhccc
Confidence            4567776544449999998 55543


No 79 
>KOG4441|consensus
Probab=38.31  E-value=3.8e+02  Score=30.64  Aligned_cols=137  Identities=17%  Similarity=0.124  Sum_probs=70.7

Q ss_pred             CCeEEEeeCC--------eEEEEeCCCCcccCCCCcccccCCCCCC----CCCCEEEecCCCcEEEEECCeEEEEecccc
Q psy12290        343 NSKTYLFSGT--------RYWKLDDETGRSEPDYPRNMTENWRGVG----VDIDDAFQWKDGATYFFKGKGFWKFKDVSM  410 (530)
Q Consensus       343 ngktYFFkG~--------~YWryde~~~~vd~gYPk~Is~~w~GvP----~~IDAAf~~~~G~~YFFkG~~Ywrfd~~~~  410 (530)
                      +|++|...|.        ..|+||...+            .|..++    ...++++..-+|.+|..-|..-+..-   .
T Consensus       332 ~~~lYv~GG~~~~~~~l~~ve~YD~~~~------------~W~~~a~M~~~R~~~~v~~l~g~iYavGG~dg~~~l---~  396 (571)
T KOG4441|consen  332 NGKLYVVGGYDSGSDRLSSVERYDPRTN------------QWTPVAPMNTKRSDFGVAVLDGKLYAVGGFDGEKSL---N  396 (571)
T ss_pred             CCEEEEEccccCCCcccceEEEecCCCC------------ceeccCCccCccccceeEEECCEEEEEecccccccc---c
Confidence            5688887653        3688887654            366554    35666666568999999886622221   2


Q ss_pred             eeeccCCCcccccccCCCCCCCCCcc-ccccccCceEEEeecCCCceecccccceEEEEecCCCCCCCccccccceeeCc
Q psy12290        411 RVEKEKPSPSAQFWMKCPEISSPEDR-ISERRVGRAFSSRSTSGGLRQGASFKAQFYHVRCSGKFGNGPVGRKSSISENP  489 (530)
Q Consensus       411 ~V~~~yPr~ia~~W~gCp~~~~~~~~-i~~~~~g~~y~~~~t~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  489 (530)
                      .|+..-|+  .+.|--+..-...+.. .----.|..|-+-|.++..+ .++ .-++|   +...+-|...+.=.+-+   
T Consensus       397 svE~YDp~--~~~W~~va~m~~~r~~~gv~~~~g~iYi~GG~~~~~~-~l~-sve~Y---DP~t~~W~~~~~M~~~R---  466 (571)
T KOG4441|consen  397 SVECYDPV--TNKWTPVAPMLTRRSGHGVAVLGGKLYIIGGGDGSSN-CLN-SVECY---DPETNTWTLIAPMNTRR---  466 (571)
T ss_pred             cEEEecCC--CCcccccCCCCcceeeeEEEEECCEEEEEcCcCCCcc-ccc-eEEEE---cCCCCceeecCCccccc---
Confidence            35444454  5678887643322111 11122355666666655333 332 22333   22222222222222222   


Q ss_pred             cccceeeecceeEEE
Q psy12290        490 AIKALKKWNIAWYCT  504 (530)
Q Consensus       490 ~~~a~~~~~~~~~~~  504 (530)
                      ..-++-..|.++|.-
T Consensus       467 ~~~g~a~~~~~iYvv  481 (571)
T KOG4441|consen  467 SGFGVAVLNGKIYVV  481 (571)
T ss_pred             ccceEEEECCEEEEE
Confidence            122366788888863


No 80 
>COG2856 Predicted Zn peptidase [Amino acid transport and metabolism]
Probab=38.25  E-value=12  Score=37.56  Aligned_cols=9  Identities=22%  Similarity=0.080  Sum_probs=7.6

Q ss_pred             hhhhhhccc
Q psy12290         24 HSWATYGHW   32 (530)
Q Consensus        24 ~~~HE~GH~   32 (530)
                      |+|||+||+
T Consensus        75 tlAHELGH~   83 (213)
T COG2856          75 TLAHELGHA   83 (213)
T ss_pred             HHHHHHhHH
Confidence            357999999


No 81 
>cd08988 GH43_ABN Glycosyl hydrolase family 43. This glycosyl hydrolase family 43 (GH43) includes mostly enzymes with alpha-L-arabinofuranosidase (AFN; EC 3.2.1.55) and endo-alpha-L-arabinanase (ABN; EC 3.2.1.99) activities. These are inverting enzymes (i.e. they invert the stereochemistry of the anomeric carbon atom of the substrate) that have an aspartate as the catalytic general base, a glutamate as the catalytic general acid and another aspartate that is responsible for pKa modulation and orienting the catalytic acid. The GH43 ABN enzymes hydrolyze alpha-1,5-L-arabinofuranoside linkages while the ABF enzymes cleave arabinose side chains so that the combined actions of these two enzymes reduce arabinan to L-arabinose and/or arabinooligosaccharides. These arabinan-degrading enzymes are important in the food industry for efficient production of L-arabinose from agricultural waste; L-arabinose is often used as a bioactive sweetener. A common structural feature of GH43 enzymes is a 5-bla
Probab=36.96  E-value=92  Score=31.62  Aligned_cols=65  Identities=23%  Similarity=0.445  Sum_probs=34.7

Q ss_pred             cccccEEEeccCCeEEEeeCC-----eEEEEeCCCCcc-cCCCCcccccCCCCCCCCCCEEEecC-CCcEEEE
Q psy12290        332 ERIDAAMVWGYNSKTYLFSGT-----RYWKLDDETGRS-EPDYPRNMTENWRGVGVDIDDAFQWK-DGATYFF  397 (530)
Q Consensus       332 ~~IDAAf~~~~ngktYFFkG~-----~YWryde~~~~v-d~gYPk~Is~~w~GvP~~IDAAf~~~-~G~~YFF  397 (530)
                      ..||+++....+|+.|++-|+     +.-+.+.....+ ..+..+.|...-. -..-++|....+ +|..|+|
T Consensus       118 ~~iDp~~f~DdDG~~Yl~~g~~~~gi~~~eL~~d~~~~~~~~~~~~i~~~~~-~~~~~Egp~i~k~~g~YYl~  189 (279)
T cd08988         118 NAIDPAIIFDQHGQPWLSFGSFWGGIKLFELDKDTMKPAEPGELHSIAGRER-SSAAIEAPFILYRGDYYYLF  189 (279)
T ss_pred             CccCCceEEcCCCCEEEEecccCCCEEEEEECcccCCccCCCcceEEeccCC-CCCceEeeEEEEcCCeEEEE
Confidence            469986655578999997554     223566554443 2344444432100 012356654443 6777766


No 82 
>KOG4693|consensus
Probab=36.52  E-value=2.1e+02  Score=30.17  Aligned_cols=98  Identities=18%  Similarity=0.072  Sum_probs=48.1

Q ss_pred             CCEEEecCCCcEEEEEC--CeEEEEecccc----eeeccCCCcccccccCCCCC-CCCCccccccccCceEEEeecCCCc
Q psy12290        383 IDDAFQWKDGATYFFKG--KGFWKFKDVSM----RVEKEKPSPSAQFWMKCPEI-SSPEDRISERRVGRAFSSRSTSGGL  455 (530)
Q Consensus       383 IDAAf~~~~G~~YFFkG--~~Ywrfd~~~~----~V~~~yPr~ia~~W~gCp~~-~~~~~~i~~~~~g~~y~~~~t~~~~  455 (530)
                      ..+|... +|.+|+|-|  ++.=-|.....    ++.  +=......|..||.+ .-+.|+-+       -+.... + +
T Consensus       184 FH~a~~~-~~~MYiFGGR~D~~gpfHs~~e~Yc~~i~--~ld~~T~aW~r~p~~~~~P~GRRS-------HS~fvY-n-g  251 (392)
T KOG4693|consen  184 FHTASVI-DGMMYIFGGRSDESGPFHSIHEQYCDTIM--ALDLATGAWTRTPENTMKPGGRRS-------HSTFVY-N-G  251 (392)
T ss_pred             hhhhhhc-cceEEEeccccccCCCccchhhhhcceeE--EEeccccccccCCCCCcCCCcccc-------cceEEE-c-c
Confidence            3455443 589999965  33333322211    111  001124689999765 34554311       111122 1 2


Q ss_pred             eecccccceEEEEecCCCCCCCcccccccee-eCccccc
Q psy12290        456 RQGASFKAQFYHVRCSGKFGNGPVGRKSSIS-ENPAIKA  493 (530)
Q Consensus       456 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~a  493 (530)
                      .++. |++.-=.++.--+|...-.|.++.|+ ..+.+|+
T Consensus       252 ~~Y~-FGGYng~ln~HfndLy~FdP~t~~W~~I~~~Gk~  289 (392)
T KOG4693|consen  252 KMYM-FGGYNGTLNVHFNDLYCFDPKTSMWSVISVRGKY  289 (392)
T ss_pred             eEEE-ecccchhhhhhhcceeecccccchheeeeccCCC
Confidence            2233 33311123333367777789999999 6666665


No 83 
>COG1164 Oligoendopeptidase F [Amino acid transport and metabolism]
Probab=36.46  E-value=14  Score=42.42  Aligned_cols=15  Identities=20%  Similarity=0.107  Sum_probs=12.8

Q ss_pred             chhhhhhhhhhhccc
Q psy12290         18 SLYGMNHSWATYGHW   32 (530)
Q Consensus        18 ~l~~va~~~HE~GH~   32 (530)
                      .+..|.||+||+||+
T Consensus       377 t~~dV~TLaHElGHs  391 (598)
T COG1164         377 TLRDVFTLAHELGHS  391 (598)
T ss_pred             chhHHHHHHHHccHH
Confidence            466788899999999


No 84 
>cd06456 M3A_DCP_Oligopeptidase_A Peptidase family M3 dipeptidyl carboxypeptidase (DCP; Dcp II; peptidyl dipeptidase; EC 3.4.15.5). This metal-binding M3A family also includes oligopeptidase A (OpdA; EC 3.4.24.70) enzyme. DCP cleaves dipeptides off the C-termini of various peptides and proteins, the smallest substrate being N-blocked tripeptides and unblocked tetrapeptides. DCP from E. coli is inhibited by the anti-hypertensive drug captopril, an inhibitor of the mammalian angiotensin converting enzyme (ACE, also called  peptidyl dipeptidase A). Oligopeptidase A (OpdA) may play a specific role in the degradation of signal peptides after they are released from precursor forms of secreted proteins. It can also cleave N-acetyl-L-Ala.
Probab=35.08  E-value=21  Score=39.04  Aligned_cols=19  Identities=16%  Similarity=0.298  Sum_probs=15.5

Q ss_pred             ccchhhhhhhhhhhccc--cc
Q psy12290         16 IQSLYGMNHSWATYGHW--AL   34 (530)
Q Consensus        16 ~~~l~~va~~~HE~GH~--GL   34 (530)
                      ..++..|.|+.|||||+  +|
T Consensus       203 lL~~~~v~tLfHEfGHalH~~  223 (422)
T cd06456         203 LLTHDEVTTLFHEFGHALHHL  223 (422)
T ss_pred             ccCHHHHHHHHHHHHHHHHHH
Confidence            34777888999999999  55


No 85 
>cd06258 Peptidase_M3_like The peptidase M3-like family, also called neurolysin-like family, is part of the "zincins" metallopeptidases, and includes M3, M2 and M32 families of metallopeptidases.  The M3 family is subdivided into two subfamilies: the widespread M3A, which comprises a number of high-molecular mass endo- and exopeptidases from bacteria, archaea, protozoa, fungi, plants and animals, and the small M3B, whose members are enzymes primarily from bacteria. Well-known mammalian/eukaryotic M3A endopeptidases are the thimet oligopeptidase (TOP; endopeptidase 3.4.24.15), neurolysin (alias endopeptidase 3.4.24.16), and the mitochondrial intermediate peptidase. The first two are intracellular oligopeptidases, which act only on relatively short substrates of less than 20 amino acid residues, while the latter cleaves N-terminal octapeptides from proteins during their import into the mitochondria. The M3A subfamily also contains several bacterial endopeptidases, collectively called olig
Probab=35.06  E-value=21  Score=37.53  Aligned_cols=16  Identities=19%  Similarity=0.312  Sum_probs=12.8

Q ss_pred             cchhhhhhhhhhhccc
Q psy12290         17 QSLYGMNHSWATYGHW   32 (530)
Q Consensus        17 ~~l~~va~~~HE~GH~   32 (530)
                      ...-.|.|++||+||+
T Consensus       150 l~~~~v~tl~HE~GHa  165 (365)
T cd06258         150 LGHDDINTLFHEFGHA  165 (365)
T ss_pred             CCHHHHHHHHHHHhHH
Confidence            3555677889999999


No 86 
>KOG4499|consensus
Probab=34.13  E-value=2.3e+02  Score=29.43  Aligned_cols=77  Identities=17%  Similarity=0.315  Sum_probs=43.0

Q ss_pred             ccEEEeccCC-eEEEeeCCeE----EEEeCCCCcccCCCCcccccCCCCCC---CCCCEEEecCCCcEEE--EECCeEEE
Q psy12290        335 DAAMVWGYNS-KTYLFSGTRY----WKLDDETGRSEPDYPRNMTENWRGVG---VDIDDAFQWKDGATYF--FKGKGFWK  404 (530)
Q Consensus       335 DAAf~~~~ng-ktYFFkG~~Y----Wryde~~~~vd~gYPk~Is~~w~GvP---~~IDAAf~~~~G~~YF--FkG~~Ywr  404 (530)
                      .-++.|..+. +.|++-...|    |.||-.++.+..  |+.|-+.=..-|   --.|..-.+.+|.+|.  |.|.+.++
T Consensus       160 sNgl~Wd~d~K~fY~iDsln~~V~a~dyd~~tG~~sn--r~~i~dlrk~~~~e~~~PDGm~ID~eG~L~Va~~ng~~V~~  237 (310)
T KOG4499|consen  160 SNGLAWDSDAKKFYYIDSLNYEVDAYDYDCPTGDLSN--RKVIFDLRKSQPFESLEPDGMTIDTEGNLYVATFNGGTVQK  237 (310)
T ss_pred             CccccccccCcEEEEEccCceEEeeeecCCCcccccC--cceeEEeccCCCcCCCCCCcceEccCCcEEEEEecCcEEEE
Confidence            3455675444 4566554444    777777665433  444432211111   1123322234788775  89999999


Q ss_pred             Eecccceee
Q psy12290        405 FKDVSMRVE  413 (530)
Q Consensus       405 fd~~~~~V~  413 (530)
                      +|..+.++.
T Consensus       238 ~dp~tGK~L  246 (310)
T KOG4499|consen  238 VDPTTGKIL  246 (310)
T ss_pred             ECCCCCcEE
Confidence            999886654


No 87 
>PF13964 Kelch_6:  Kelch motif
Probab=33.26  E-value=58  Score=24.03  Aligned_cols=21  Identities=33%  Similarity=0.515  Sum_probs=16.1

Q ss_pred             CCeEEEeeCC--------eEEEEeCCCCc
Q psy12290        343 NSKTYLFSGT--------RYWKLDDETGR  363 (530)
Q Consensus       343 ngktYFFkG~--------~YWryde~~~~  363 (530)
                      ++++|+|.|.        .+|+||..+++
T Consensus        11 ~~~iyv~GG~~~~~~~~~~v~~yd~~t~~   39 (50)
T PF13964_consen   11 GGKIYVFGGYDNSGKYSNDVERYDPETNT   39 (50)
T ss_pred             CCEEEEECCCCCCCCccccEEEEcCCCCc
Confidence            6799999874        45888887754


No 88 
>cd06457 M3A_MIP Peptidase M3 mitochondrial intermediate peptidase (MIP; EC 3.4.24.59) belongs to the widespread subfamily M3A, that show similarity to the Thimet oligopeptidase (TOP). It is one of three peptidases responsible for the proteolytic processing of both, nuclear and mitochondrial encoded precursor polypeptides targeted to the various subcompartments of the mitochondria. It cleaves intermediate-size proteins initially processed by mitochondrial processing peptidase (MPP) to yield a processing intermediate with a typical N-terminal octapeptide that is sequentially cleaved by MIP to mature-size protein.  MIP cleaves precursor proteins of respiratory components, including subunits of the electron transport chain and tri-carboxylic acid cycle enzymes, and components of the mitochondrial genetic machinery, including ribosomal proteins, translation factors, and proteins required for mitochondrial DNA metabolism. It has been suggested that the human MIP (HMIP polypeptide; gene symbo
Probab=32.39  E-value=22  Score=39.23  Aligned_cols=17  Identities=18%  Similarity=0.192  Sum_probs=13.9

Q ss_pred             ccchhhhhhhhhhhccc
Q psy12290         16 IQSLYGMNHSWATYGHW   32 (530)
Q Consensus        16 ~~~l~~va~~~HE~GH~   32 (530)
                      -..+-.|.||.|||||+
T Consensus       243 lL~~~~v~TLfHEfGHa  259 (458)
T cd06457         243 LLSPHEVETLFHEMGHA  259 (458)
T ss_pred             CcCHHHHHHHHHHHhHH
Confidence            34566788999999999


No 89 
>TIGR02604 Piru_Ver_Nterm putative membrane-bound dehydrogenase domain. All proteins that score above the trusted cutoff score of 45 to this model are large proteins of either Pirellula sp. 1 or Verrucomicrobium spinosum. These proteins all contain, in addition to this domain, several hundred residues of highly variable sequence, and then a well-conserved C-terminal domain (TIGR02603) that features a putative cytochrome c-type heme binding motif CXXCH. The membrane-bound L-sorbosone dehydrogenase from Acetobacter liquefaciens (Gluconacetobacter liquefaciens) is homologous to this domain but lacks additional sequence regions shared by members of this family and belongs to a different clade of the larger family of homologs. It and its closely related homologs are excluded from the this model by scoring between the trusted (45) and noise (18) cutoffs.
Probab=31.92  E-value=6.4e+02  Score=26.66  Aligned_cols=93  Identities=12%  Similarity=0.256  Sum_probs=48.0

Q ss_pred             eCCcEEEEEceeEEEecce---ecCCCCCcccccCCCCCc---ccccccEEEeccCCeEEEeeC----------------
Q psy12290        294 IDNHIAFFIGRQYFLFEGI---RLLPGYPRPLTALGLPAS---LERIDAAMVWGYNSKTYLFSG----------------  351 (530)
Q Consensus       294 ~~gktyFFKG~~yW~y~~~---~l~~GYPK~Is~~GlP~~---~~~IDAAf~~~~ngktYFFkG----------------  351 (530)
                      .++ +|+-...+.|+|...   ....|-.+.|.+ +++..   ..+.-..+.+..+|++||=.|                
T Consensus        81 ~~G-lyV~~~~~i~~~~d~~gdg~ad~~~~~l~~-~~~~~~~~~~~~~~~l~~gpDG~LYv~~G~~~~~~~~~~~~~~~~  158 (367)
T TIGR02604        81 VGG-VYVATPPDILFLRDKDGDDKADGEREVLLS-GFGGQINNHHHSLNSLAWGPDGWLYFNHGNTLASKVTRPGTSDES  158 (367)
T ss_pred             cCC-EEEeCCCeEEEEeCCCCCCCCCCccEEEEE-ccCCCCCcccccccCceECCCCCEEEecccCCCceeccCCCccCc
Confidence            355 887777788988531   122233334433 44431   011112344567889998555                


Q ss_pred             -----CeEEEEeCCCCcccCCCCcccccCCCCCCCCCCEEEecCCCcEEEE
Q psy12290        352 -----TRYWKLDDETGRSEPDYPRNMTENWRGVGVDIDDAFQWKDGATYFF  397 (530)
Q Consensus       352 -----~~YWryde~~~~vd~gYPk~Is~~w~GvP~~IDAAf~~~~G~~YFF  397 (530)
                           ...|||+.....++     .++   .|+.....-||. .+|.+|+-
T Consensus       159 ~~~~~g~i~r~~pdg~~~e-----~~a---~G~rnp~Gl~~d-~~G~l~~t  200 (367)
T TIGR02604       159 RQGLGGGLFRYNPDGGKLR-----VVA---HGFQNPYGHSVD-SWGDVFFC  200 (367)
T ss_pred             ccccCceEEEEecCCCeEE-----EEe---cCcCCCccceEC-CCCCEEEE
Confidence                 24678777654432     122   144334445554 36777654


No 90 
>COG5549 Predicted Zn-dependent protease [Posttranslational modification, protein turnover, chaperones]
Probab=31.66  E-value=22  Score=35.70  Aligned_cols=26  Identities=12%  Similarity=-0.024  Sum_probs=23.1

Q ss_pred             hhhhccc-cccCCCCCCCeeeecccCC
Q psy12290         26 WATYGHW-ALSFKMTTIEAEFKWFDGG   51 (530)
Q Consensus        26 ~HE~GH~-GL~Hs~~~~~iM~p~y~~~   51 (530)
                      -|++||. ||+|++.+..||++.+..+
T Consensus       158 ~efl~~~~~~~~lnhr~~i~~~pg~~~  184 (236)
T COG5549         158 YEFLGHALGLGHLNHRGDIMYPPGELR  184 (236)
T ss_pred             HHHhhhccCcccccccccccCCcccch
Confidence            6889999 9999999999999987653


No 91 
>PF02191 OLF:  Olfactomedin-like domain;  InterPro: IPR003112 The olfactomedin-domain was first identified in olfactomedin, an extracellular matrix protein of the olfactory neuroepithelium []. Members of this extracellular domain-family have since been shown to be present in several metazoan proteins, such as latrophilins, myocilins, optimedins and noelins, the latter being involved in the generation of neural crest cells. Myocilin is of considerable interest, as mutations in its olfactomedin-domain can lead to glaucoma []. The olfactomedin-domains in myocilin and optimedin are essential for the interaction between these two proteins [].; GO: 0005515 protein binding
Probab=31.30  E-value=4.8e+02  Score=26.62  Aligned_cols=72  Identities=17%  Similarity=0.151  Sum_probs=39.3

Q ss_pred             cceEEeeCCcEEEEE---ceeEEEecce-ec-CCCCCcccccCCCCCcccccccEEEeccCCeEEEeeC--CeEEEEeCC
Q psy12290        288 DAVYQRIDNHIAFFI---GRQYFLFEGI-RL-LPGYPRPLTALGLPASLERIDAAMVWGYNSKTYLFSG--TRYWKLDDE  360 (530)
Q Consensus       288 DAAye~~~gktyFFK---G~~yW~y~~~-~l-~~GYPK~Is~~GlP~~~~~IDAAf~~~~ngktYFFkG--~~YWryde~  360 (530)
                      |++ ....+++|++.   ++.+..|... .+ ..+-+....  .||-...+-..++   .||.+|+=+.  +..-|||..
T Consensus        24 D~~-~~~~~~iy~~~~~~~~~v~ey~~~~~f~~~~~~~~~~--~Lp~~~~GtG~vV---YngslYY~~~~s~~IvkydL~   97 (250)
T PF02191_consen   24 DPS-PSDSEKIYVTSGFSGNTVYEYRNYEDFLRNGRSSRTY--KLPYPWQGTGHVV---YNGSLYYNKYNSRNIVKYDLT   97 (250)
T ss_pred             CCC-CCCCCCEEEECccCCCEEEEEcCHhHHhhcCCCceEE--EEeceeccCCeEE---ECCcEEEEecCCceEEEEECc
Confidence            444 23356777754   4567777652 23 333222222  2332223334444   2688888554  778999998


Q ss_pred             CCccc
Q psy12290        361 TGRSE  365 (530)
Q Consensus       361 ~~~vd  365 (530)
                      ++.+.
T Consensus        98 t~~v~  102 (250)
T PF02191_consen   98 TRSVV  102 (250)
T ss_pred             CCcEE
Confidence            87654


No 92 
>PF05547 Peptidase_M6:  Immune inhibitor A peptidase M6;  InterPro: IPR008757 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry based on a common structural fold:  Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases.   In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding.  Metalloproteases are the most diverse of the four main types of protease, with more than 50 families identified to date. In these enzymes, a divalent cation, usually zinc, activates the water molecule. The metal ion is held in place by amino acid ligands, usually three in number. The known metal ligands are His, Glu, Asp or Lys and at least one other residue is required for catalysis, which may play an electrophillic role. Of the known metalloproteases, around half contain an HEXXH motif, which has been shown in crystallographic studies to form part of the metal-binding site []. The HEXXH motif is relatively common, but can be more stringently defined for metalloproteases as 'abXHEbbHbc', where 'a' is most often valine or threonine and forms part of the S1' subsite in thermolysin and neprilysin, 'b' is an uncharged residue, and 'c' a hydrophobic residue. Proline is never found in this site, possibly because it would break the helical structure adopted by this motif in metalloproteases []. This group of metallopeptidases belong to MEROPS peptidase family M6 (immune inhibitor A family, clan MA(M)). The predicted active site residues for members of this family and thermolysin, the type example for clan MA, occur in the motif HEXXH.  InhA of Bacillus thuringiensis (an entomopathogenic bacterium) specifically cleaves antibacterial peptides produced by insect hosts []. B. thuringiensis is highly resistant to the insect immune system due to its production of two factors, inhibitor A (InhA or InA) and inhibitor B (InhB or InB), which selectively block the humoral defence system developed by insects against Escherichia coli and Bacillus cereus []. B. thuringiensis is especially resistant to cecropins and attacins, which are the main classes of inducible antibacterial peptides in various lepidopterans and dipterans [], []. InhA has been shown to specifically hydrolyze cecropins and attacins in the immune hemolymph of Hyalophora cecropia (Cecropia moth) in vitro []. However, it has been suggested that the role of InhA in resistance to the humoral defence system is not consistent with the time course of InhA production []. B. thuringiensis has two proteins belonging to this group (InhA and InhA2), and it has been shown that InhA2 has a vital role in virulence when the host is infected via the oral route []. The B. cereus member has been found as an exosporium component from endospores []. B. thuringiensis InhA is induced at the onset of sporulation and is regulated by Spo0A and AbrB []. Vibrio cholerae PrtV is thought to be encoded in the pathogenicity island []. However, PrtV mutants did not exhibit a reduced virulence phenotype, and thus PrtV is not an indispensable virulence factor []. Annotation note: due to the presence of PKD repeats in some of the members of this group (e.g., V. cholerae VCA0223), spurious similarity hits may appear (involving unrelated proteins), which may lead to the erroneous transfer of functional annotations and protein names. Also, please note that related Bacillus subtilis Bacillopeptidase F (Bpr or Bpf) contains two different protease domains: N-terminal IPR000209 from INTERPRO (peptidase S8, subtilase, a subtilisin-like serine protease) and this C-terminal domain (peptidase M6), which may also complicate annotation.; GO: 0008233 peptidase activity, 0006508 proteolysis
Probab=30.41  E-value=14  Score=42.69  Aligned_cols=19  Identities=26%  Similarity=0.230  Sum_probs=14.2

Q ss_pred             hhhhhhhhhhccc-cccCCCCC
Q psy12290         20 YGMNHSWATYGHW-ALSFKMTT   40 (530)
Q Consensus        20 ~~va~~~HE~GH~-GL~Hs~~~   40 (530)
                      .+|.  +|||||. ||-=-.+.
T Consensus       222 iGVf--aHEfGH~LGLPDlYDT  241 (645)
T PF05547_consen  222 IGVF--AHEFGHDLGLPDLYDT  241 (645)
T ss_pred             eEEE--EeeccccCCCCCcccC
Confidence            4455  9999999 99755554


No 93 
>KOG4525|consensus
Probab=29.41  E-value=31  Score=38.09  Aligned_cols=26  Identities=15%  Similarity=0.146  Sum_probs=20.8

Q ss_pred             hhhhhccc-cccCCCCCCCeeeecccCCC
Q psy12290         25 SWATYGHW-ALSFKMTTIEAEFKWFDGGN   52 (530)
Q Consensus        25 ~~HE~GH~-GL~Hs~~~~~iM~p~y~~~~   52 (530)
                      |.||+||. |+.|-++  -+|---|...+
T Consensus       305 ~~HElGH~lgcpHq~~--GvMlrgy~~lN  331 (614)
T KOG4525|consen  305 VCHELGHCLGCPHQSE--GVMLRGYDYLN  331 (614)
T ss_pred             HHHHhhhccCCCCCCC--ceEecCchhhc
Confidence            79999999 9999764  58977776544


No 94 
>KOG1924|consensus
Probab=28.66  E-value=4.4e+02  Score=31.72  Aligned_cols=6  Identities=17%  Similarity=0.611  Sum_probs=2.6

Q ss_pred             CeEEEE
Q psy12290        255 RWMWRI  260 (530)
Q Consensus       255 ~~~WR~  260 (530)
                      +-||.-
T Consensus       642 ~cFWvk  647 (1102)
T KOG1924|consen  642 NCFWVK  647 (1102)
T ss_pred             cceeee
Confidence            344543


No 95 
>COG2738 Predicted Zn-dependent protease [General function prediction only]
Probab=28.38  E-value=21  Score=35.45  Aligned_cols=29  Identities=10%  Similarity=-0.126  Sum_probs=17.0

Q ss_pred             hhhhhhhhhhhccc-cccCCC---CCCCeeeeccc
Q psy12290         19 LYGMNHSWATYGHW-ALSFKM---TTIEAEFKWFD   49 (530)
Q Consensus        19 l~~va~~~HE~GH~-GL~Hs~---~~~~iM~p~y~   49 (530)
                      =.+||  +||.||+ -=.|..   .-...|.|.-.
T Consensus        92 ~~aVA--AHEVGHAiQd~~~Y~~L~~R~~lvPv~~  124 (226)
T COG2738          92 AIAVA--AHEVGHAIQDQEDYAFLVLRHALVPVAN  124 (226)
T ss_pred             HHHHH--HHHhhHHHhhhcccHHHHHhhcccceec
Confidence            34677  9999999 444433   22334555443


No 96 
>PF01435 Peptidase_M48:  Peptidase family M48 This is family M48 in the peptidase classification. ;  InterPro: IPR001915 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry based on a common structural fold:  Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases.   In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding.  Metalloproteases are the most diverse of the four main types of protease, with more than 50 families identified to date. In these enzymes, a divalent cation, usually zinc, activates the water molecule. The metal ion is held in place by amino acid ligands, usually three in number. The known metal ligands are His, Glu, Asp or Lys and at least one other residue is required for catalysis, which may play an electrophillic role. Of the known metalloproteases, around half contain an HEXXH motif, which has been shown in crystallographic studies to form part of the metal-binding site []. The HEXXH motif is relatively common, but can be more stringently defined for metalloproteases as 'abXHEbbHbc', where 'a' is most often valine or threonine and forms part of the S1' subsite in thermolysin and neprilysin, 'b' is an uncharged residue, and 'c' a hydrophobic residue. Proline is never found in this site, possibly because it would break the helical structure adopted by this motif in metalloproteases []. This group of metallopeptidases belong to MEROPS peptidase family M48 (Ste24 endopeptidase family, clan M-); members of both subfamily are represented. The members of this set of proteins are mostly described as probable protease htpX homologue (3.4.24 from EC) or CAAX prenyl protease 1, which proteolytically removes the C-terminal three residues of farnesylated proteins. They are integral membrane proteins associated with the endoplasmic reticulum and Golgi, binding one zinc ion per subunit. In Saccharomyces cerevisiae (Baker's yeast) Ste24p is required for the first NH2-terminal proteolytic processing event within the a-factor precursor, which takes place after COOH-terminal CAAX modification is complete. The Ste24p contains multiple predicted membrane spans, a zinc metalloprotease motif (HEXXH), and a COOH-terminal ER retrieval signal (KKXX). The HEXXH protease motif is critical for Ste24p activity, since Ste24p fails to function when conserved residues within this motif are mutated.  The Ste24p homologues occur in a diverse group of organisms, including Escherichia coli, Schizosaccharomyces pombe (Fission yeast), Haemophilus influenzae, and Homo sapiens (Human), which indicates that the gene is highly conserved throughout evolution. Ste24p and the proteins related to it define a subfamily of proteins that are likely to function as intracellular, membrane-associated zinc metalloproteases [].  HtpX is a zinc-dependent endoprotease member of the membrane-localized proteolytic system in E. coli, which participates in the proteolytic quality control of membrane proteins in conjunction with FtsH, a membrane-bound and ATP-dependent protease. Biochemical characterisation revealed that HtpX undergoes self-degradation upon cell disruption or membrane solubilization. It can also degraded casein and cleaves solubilized membrane proteins, for example, SecY []. Expression of HtpX in the plasma membrane is under the control of CpxR, with the metalloproteinase active site of HtpX located on the cytosolic side of the membrane. This suggests a potential role for HtpX in the response to mis-folded proteins [].; GO: 0004222 metalloendopeptidase activity, 0006508 proteolysis, 0016020 membrane; PDB: 3CQB_A 3C37_B.
Probab=28.12  E-value=18  Score=34.77  Aligned_cols=21  Identities=14%  Similarity=0.115  Sum_probs=16.8

Q ss_pred             chhhhhhhhhhhccccccCCCCC
Q psy12290         18 SLYGMNHSWATYGHWALSFKMTT   40 (530)
Q Consensus        18 ~l~~va~~~HE~GH~GL~Hs~~~   40 (530)
                      .|..|.  +||+||.-..|....
T Consensus        88 el~aVl--aHElgH~~~~h~~~~  108 (226)
T PF01435_consen   88 ELAAVL--AHELGHIKHRHILKS  108 (226)
T ss_dssp             HHHHHH--HHHHHHHHTTHCCCC
T ss_pred             HHHHHH--HHHHHHHHcCCcchH
Confidence            466777  999999977887665


No 97 
>KOG0379|consensus
Probab=27.10  E-value=9e+02  Score=26.89  Aligned_cols=53  Identities=17%  Similarity=0.033  Sum_probs=27.2

Q ss_pred             CCeEEEeeC--------CeEEEEeCCCCcccCCCCcccccCCCCCCCCCCEEEecCCCcEEEEECC
Q psy12290        343 NSKTYLFSG--------TRYWKLDDETGRSEPDYPRNMTENWRGVGVDIDDAFQWKDGATYFFKGK  400 (530)
Q Consensus       343 ngktYFFkG--------~~YWryde~~~~vd~gYPk~Is~~w~GvP~~IDAAf~~~~G~~YFFkG~  400 (530)
                      ..++|+|.|        +.+|.||..+.+..    +.......-.|..-.++..+. +++++|-|.
T Consensus       173 g~~l~vfGG~~~~~~~~ndl~i~d~~~~~W~----~~~~~g~~P~pR~gH~~~~~~-~~~~v~gG~  233 (482)
T KOG0379|consen  173 GTKLVVFGGIGGTGDSLNDLHIYDLETSTWS----ELDTQGEAPSPRYGHAMVVVG-NKLLVFGGG  233 (482)
T ss_pred             CCEEEEECCccCcccceeeeeeeccccccce----ecccCCCCCCCCCCceEEEEC-CeEEEEecc
Confidence            478999976        35677887765421    111112222233444555544 455555443


No 98 
>PF11350 DUF3152:  Protein of unknown function (DUF3152);  InterPro: IPR022603 This entry represents Actinobacteria proteins of unknown function. Some are annotated as membrane proteins, however this cannot be confirmed.
Probab=26.97  E-value=23  Score=35.20  Aligned_cols=24  Identities=21%  Similarity=0.210  Sum_probs=17.6

Q ss_pred             ccccchhhhhhhhhhhccc-cccCCCCC
Q psy12290         14 MAIQSLYGMNHSWATYGHW-ALSFKMTT   40 (530)
Q Consensus        14 ~~~~~l~~va~~~HE~GH~-GL~Hs~~~   40 (530)
                      ...+.-|.|+   ||.||+ |-+|-.=+
T Consensus       135 l~~YRqYvIN---HEVGH~LGh~H~~Cp  159 (203)
T PF11350_consen  135 LASYRQYVIN---HEVGHALGHGHEPCP  159 (203)
T ss_pred             HHHHHHHhhh---hhhhhhcccCCCcCC
Confidence            3445556666   999999 99998744


No 99 
>PF13398 Peptidase_M50B:  Peptidase M50B-like
Probab=26.32  E-value=22  Score=34.87  Aligned_cols=13  Identities=23%  Similarity=0.061  Sum_probs=9.9

Q ss_pred             chhhhhhhhhhhccc
Q psy12290         18 SLYGMNHSWATYGHW   32 (530)
Q Consensus        18 ~l~~va~~~HE~GH~   32 (530)
                      .++.|.  +||+||+
T Consensus        21 ~~l~t~--~HE~gHa   33 (200)
T PF13398_consen   21 RLLVTF--VHELGHA   33 (200)
T ss_pred             HHHHHH--HHHHHHH
Confidence            344555  9999999


No 100
>PF08450 SGL:  SMP-30/Gluconolaconase/LRE-like region;  InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species. These proteins include various enzymes, such as senescence marker protein 30 (SMP-30, Q15493 from SWISSPROT), gluconolactonase (Q01578 from SWISSPROT) and luciferin-regenerating enzyme (LRE, Q86DU5 from SWISSPROT). SMP-30 is known to hydrolyse diisopropyl phosphorofluoridate in the liver, and has been noted as having sequence similarity, in the region described in this family, with PON1 (P52430 from SWISSPROT) and LRE. ; PDB: 2GHS_A 2DG0_L 2DG1_D 2DSO_D 3E5Z_A 2IAT_A 2IAV_A 2GVV_A 3HLI_A 2GVU_A ....
Probab=25.31  E-value=4.3e+02  Score=25.73  Aligned_cols=108  Identities=14%  Similarity=0.151  Sum_probs=56.6

Q ss_pred             eeeEEeCCEEEEEEC----------CeEEEEcCCCccCCCceecccccccCCCCCccccceEEeeCCcEEEEE---ceeE
Q psy12290        240 DAIAVIRTEVFVFKD----------RWMWRIGDKGVLPGYPVLIHQFWSELPHNLTHIDAVYQRIDNHIAFFI---GRQY  306 (530)
Q Consensus       240 DAvt~irGeiyfFKG----------~~~WR~~~~~~~~gyP~~Is~~WpGLP~~~~~IDAAye~~~gktyFFK---G~~y  306 (530)
                      |.++.-+|.+||=-.          ..+||+...+.       +...+.++..    -..+.-.++++++++.   ..++
T Consensus        90 D~~vd~~G~ly~t~~~~~~~~~~~~g~v~~~~~~~~-------~~~~~~~~~~----pNGi~~s~dg~~lyv~ds~~~~i  158 (246)
T PF08450_consen   90 DVAVDPDGNLYVTDSGGGGASGIDPGSVYRIDPDGK-------VTVVADGLGF----PNGIAFSPDGKTLYVADSFNGRI  158 (246)
T ss_dssp             EEEE-TTS-EEEEEECCBCTTCGGSEEEEEEETTSE-------EEEEEEEESS----EEEEEEETTSSEEEEEETTTTEE
T ss_pred             eEEEcCCCCEEEEecCCCccccccccceEEECCCCe-------EEEEecCccc----ccceEECCcchheeeccccccee
Confidence            444445778776432          34788876521       2222323321    2333334577766554   4678


Q ss_pred             EEeccee--cCCCCCcccccCCCCCcccccccEEEeccCCeEEE--eeCCeEEEEeCCC
Q psy12290        307 FLFEGIR--LLPGYPRPLTALGLPASLERIDAAMVWGYNSKTYL--FSGTRYWKLDDET  361 (530)
Q Consensus       307 W~y~~~~--l~~GYPK~Is~~GlP~~~~~IDAAf~~~~ngktYF--FkG~~YWryde~~  361 (530)
                      |+|+-..  ...+.++.+.+  ++......|...+. .+|.+|.  +.+++.++||...
T Consensus       159 ~~~~~~~~~~~~~~~~~~~~--~~~~~g~pDG~~vD-~~G~l~va~~~~~~I~~~~p~G  214 (246)
T PF08450_consen  159 WRFDLDADGGELSNRRVFID--FPGGPGYPDGLAVD-SDGNLWVADWGGGRIVVFDPDG  214 (246)
T ss_dssp             EEEEEETTTCCEEEEEEEEE---SSSSCEEEEEEEB-TTS-EEEEEETTTEEEEEETTS
T ss_pred             EEEeccccccceeeeeeEEE--cCCCCcCCCcceEc-CCCCEEEEEcCCCEEEEECCCc
Confidence            8887431  11112333322  22211247777765 5889998  5789999999874


No 101
>cd05709 S2P-M50 Site-2 protease (S2P) class of zinc metalloproteases (MEROPS family M50) cleaves transmembrane domains of substrate proteins, regulating intramembrane proteolysis (RIP) of diverse signal transduction mechanisms. Members of this family use proteolytic activity within the membrane to transfer information across membranes to integrate gene expression with physiologic stresses occurring in another cellular compartment. The domain core structure appears to contain at least three transmembrane helices with a catalytic zinc atom coordinated by three conserved residues contained within the consensus sequence HExxH, together with a conserved aspartate residue. The S2P/M50 family of RIP proteases is widely distributed; in eukaryotic cells, they regulate such processes as sterol and lipid metabolism, and endoplasmic reticulum (ER) stress responses. In sterol-depleted mammalian cells, a two-step proteolytic process releases the N-terminal domains of sterol regulatory element-bindin
Probab=24.24  E-value=27  Score=33.03  Aligned_cols=12  Identities=25%  Similarity=0.315  Sum_probs=9.6

Q ss_pred             hhhhhhhhhhhccc
Q psy12290         19 LYGMNHSWATYGHW   32 (530)
Q Consensus        19 l~~va~~~HE~GH~   32 (530)
                      ++.|.  +||+||+
T Consensus         8 ~i~i~--iHE~gH~   19 (180)
T cd05709           8 LISVT--VHELGHA   19 (180)
T ss_pred             HHHHH--HHHHHHH
Confidence            34566  9999999


No 102
>PF02163 Peptidase_M50:  Peptidase family M50;  InterPro: IPR008915 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry based on a common structural fold:  Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases.   In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding.  Metalloproteases are the most diverse of the four main types of protease, with more than 50 families identified to date. In these enzymes, a divalent cation, usually zinc, activates the water molecule. The metal ion is held in place by amino acid ligands, usually three in number. The known metal ligands are His, Glu, Asp or Lys and at least one other residue is required for catalysis, which may play an electrophillic role. Of the known metalloproteases, around half contain an HEXXH motif, which has been shown in crystallographic studies to form part of the metal-binding site []. The HEXXH motif is relatively common, but can be more stringently defined for metalloproteases as 'abXHEbbHbc', where 'a' is most often valine or threonine and forms part of the S1' subsite in thermolysin and neprilysin, 'b' is an uncharged residue, and 'c' a hydrophobic residue. Proline is never found in this site, possibly because it would break the helical structure adopted by this motif in metalloproteases []. This entry contains metallopeptidases belonging to MEROPS peptidase family M50 (S2P protease family, clan MM).  Members of the M50 metallopeptidase family include: mammalian sterol-regulatory element binding protein (SREBP) site 2 protease, Escherichia coli protease EcfE, stage IV sporulation protein FB and various hypothetical bacterial and eukaryotic homologues. A number of proteins are classified as non-peptidase homologues as they either have been found experimentally to be without peptidase activity, or lack amino acid residues that are believed to be essential for the catalytic activity.; GO: 0004222 metalloendopeptidase activity, 0006508 proteolysis; PDB: 3B4R_A 3ID4_A 3ID2_A 2ZPL_B 3ID1_A 2ZPM_A 3ID3_B 2HGA_A.
Probab=23.87  E-value=27  Score=33.17  Aligned_cols=20  Identities=15%  Similarity=0.069  Sum_probs=12.2

Q ss_pred             hhhhhhhhhhccc--cccCCCCCC
Q psy12290         20 YGMNHSWATYGHW--ALSFKMTTI   41 (530)
Q Consensus        20 ~~va~~~HE~GH~--GL~Hs~~~~   41 (530)
                      .++.  +||+||+  +..+-....
T Consensus         8 i~i~--~HE~gH~~~a~~~G~~~~   29 (192)
T PF02163_consen    8 ISIV--LHELGHALAARLYGDKVP   29 (192)
T ss_dssp             HHHH--HHHHHHHHHHHTTT--B-
T ss_pred             cccc--cccccccccccccccccc
Confidence            3455  9999999  655544443


No 103
>KOG3538|consensus
Probab=23.23  E-value=30  Score=41.19  Aligned_cols=33  Identities=15%  Similarity=-0.052  Sum_probs=23.8

Q ss_pred             hhhhhhhhhhhccc-cccCCCCCC------CeeeecccCC
Q psy12290         19 LYGMNHSWATYGHW-ALSFKMTTI------EAEFKWFDGG   51 (530)
Q Consensus        19 l~~va~~~HE~GH~-GL~Hs~~~~------~iM~p~y~~~   51 (530)
                      |-+..|++||+||. |+.|-...+      .||.|-....
T Consensus       315 l~~aftiahE~GH~~gm~hd~~~~~C~~~~~im~~~~~~~  354 (845)
T KOG3538|consen  315 LPSAFTIAHELGHNFGMEHDGRGNSCGPTFHVMSSDTCGG  354 (845)
T ss_pred             CccceeeeeccccccCcccCCcCCCCCCcccccCcccccC
Confidence            33444569999999 999987665      4777766544


No 104
>PRK10911 oligopeptidase A; Provisional
Probab=22.51  E-value=29  Score=40.40  Aligned_cols=16  Identities=13%  Similarity=0.196  Sum_probs=12.9

Q ss_pred             hhhhhhhhhhhccc--cc
Q psy12290         19 LYGMNHSWATYGHW--AL   34 (530)
Q Consensus        19 l~~va~~~HE~GH~--GL   34 (530)
                      .-.|.|+.|||||+  +|
T Consensus       461 ~~~v~tlfHEfGHalH~~  478 (680)
T PRK10911        461 HDEVITLFHEFGHGLHHM  478 (680)
T ss_pred             HHHHHHHHHHHhHHHHHH
Confidence            35677899999998  55


No 105
>PF14564 Membrane_bind:  Membrane binding; PDB: 1YHP_A 2B1O_A.
Probab=20.26  E-value=92  Score=28.08  Aligned_cols=33  Identities=21%  Similarity=0.366  Sum_probs=24.8

Q ss_pred             ccccEEEeccCC-eEEEeeCCeEEEEeCCCCccc
Q psy12290        333 RIDAAMVWGYNS-KTYLFSGTRYWKLDDETGRSE  365 (530)
Q Consensus       333 ~IDAAf~~~~ng-ktYFFkG~~YWryde~~~~vd  365 (530)
                      .|.+++.....+ ..|.+.|.-|++||..++.++
T Consensus        50 ~iv~~I~Vr~~~~g~~v~nGsvYFkY~~s~g~V~   83 (110)
T PF14564_consen   50 EIVCQISVRDTDWGQYVANGSVYFKYNPSTGEVS   83 (110)
T ss_dssp             EEEEEEEEEESST-SEEEEEEEEEEEETTTTEEE
T ss_pred             cEEEEEEEEeccCCceEecceEEEEECCCCCeEE
Confidence            466666654444 799999999999999887765


Done!