Diaphorina citri psyllid: psy12298


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------
MSVTNNTATADQLGVIKPQPPPKRPIRRAGKPPPDRPQRALFCLTLKNPLRKMCIDVVEWKYPLSSKS
cccccccccccccccccccccccccccccccccccccccEEEEEccccHHHHHHHHHHcccccccccc
***************************************ALFCLTLKNPLRKMCIDVVEWKYPLS***
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSVTNNTATADQLGVIKPQPPPKRPIRRAGKPPPDRPQRALFCLTLKNPLRKMCIDVVEWKYPLSSKS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Voltage-dependent calcium channel type D subunit alpha-1 Voltage-sensitive calcium channels (VSCC) mediate the entry of calcium ions into excitable cells and are also involved in a variety of calcium-dependent processes, including muscle contraction, hormone or neurotransmitter release, gene expression, cell motility, cell division and cell death. Encodes a dihydropyridine- and diltiazem-sensitive current in larval body wall muscle. Vital for embryonic development.confidentQ24270
Voltage-dependent L-type calcium channel subunit alpha-1S Voltage-sensitive calcium channels (VSCC) mediate the entry of calcium ions into excitable cells and are also involved in a variety of calcium-dependent processes, including muscle contraction, hormone or neurotransmitter release, gene expression, cell motility, cell division and cell death. The isoform alpha-1S gives rise to L-type calcium currents. Long-lasting (L-type) calcium channels belong to the 'high-voltage activated' (HVA) group. They are blocked by dihydropyridines (DHP), phenylalkylamines, benzothiazepines, and by omega-agatoxin-IIIA (omega-Aga-IIIA). They are however insensitive to omega-conotoxin-GVIA (omega-CTx-GVIA) and omega-agatoxin-IVA (omega-Aga-IVA). Calcium channels containing the alpha-1S subunit play an important role in excitation-contraction coupling in skeletal muscle.confidentQ02789
Voltage-dependent L-type calcium channel subunit alpha-1S Voltage-sensitive calcium channels (VSCC) mediate the entry of calcium ions into excitable cells and are also involved in a variety of calcium-dependent processes, including muscle contraction, hormone or neurotransmitter release, gene expression, cell motility, cell division and cell death. The isoform alpha-1S gives rise to L-type calcium currents. Long-lasting (L-type) calcium channels belong to the 'high-voltage activated' (HVA) group. They are blocked by dihydropyridines (DHP), phenylalkylamines, benzothiazepines, and by omega-agatoxin-IIIA (omega-Aga-IIIA). They are however insensitive to omega-conotoxin-GVIA (omega-CTx-GVIA) and omega-agatoxin-IVA (omega-Aga-IVA). Calcium channels containing the alpha-1S subunit play an important role in excitation-contraction coupling in skeletal muscle.confidentQ13698

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0044464 [CC]cell partconfidentGO:0005575, GO:0005623
GO:0016529 [CC]sarcoplasmic reticulumprobableGO:0005737, GO:0005783, GO:0043229, GO:0044464, GO:0016528, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226, GO:0043231
GO:0005891 [CC]voltage-gated calcium channel complexprobableGO:0043234, GO:0032991, GO:0016021, GO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0034704, GO:0071944, GO:0034702, GO:0034703, GO:0005886, GO:0044425, GO:0044459, GO:0031224
GO:0030315 [CC]T-tubuleprobableGO:0042383, GO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0071944, GO:0005886, GO:0044425, GO:0044459
GO:0008331 [MF]high voltage-gated calcium channel activityprobableGO:0005261, GO:0005262, GO:0003674, GO:0015085, GO:0072509, GO:0022843, GO:0022803, GO:0046873, GO:0005215, GO:0005216, GO:0008324, GO:0022839, GO:0022891, GO:0022890, GO:0022892, GO:0005244, GO:0015075, GO:0022832, GO:0022857, GO:0015267, GO:0022836, GO:0005245, GO:0022838
GO:0016324 [CC]apical plasma membraneprobableGO:0045177, GO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0071944, GO:0005886, GO:0044425, GO:0044459
GO:0001501 [BP]skeletal system developmentprobableGO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0008150, GO:0048731, GO:0007275, GO:0044699
GO:0007528 [BP]neuromuscular junction developmentprobableGO:0050808, GO:0030154, GO:0048468, GO:0014706, GO:0051146, GO:0061061, GO:0007275, GO:0071840, GO:0007517, GO:0048869, GO:0007519, GO:0016043, GO:0048513, GO:0044699, GO:0032502, GO:0055001, GO:0055002, GO:0032501, GO:0048741, GO:0009987, GO:0009888, GO:0048747, GO:0044767, GO:0044763, GO:0048731, GO:0044707, GO:0048856, GO:0060537, GO:0060538, GO:0008150, GO:0042692
GO:0086052 [BP]membrane repolarization involved in regulation of SA node cell action potentialprobableGO:0042391, GO:0035637, GO:0050801, GO:0042592, GO:0086013, GO:0032501, GO:0023052, GO:0001508, GO:0051179, GO:0086065, GO:0055082, GO:0044699, GO:0086001, GO:0044057, GO:0086009, GO:0086070, GO:0065007, GO:0006810, GO:0065008, GO:0019725, GO:0009987, GO:0061337, GO:0006811, GO:0008016, GO:0006873, GO:0034220, GO:0086019, GO:0086018, GO:0044763, GO:0051239, GO:0007267, GO:0007154, GO:0086011, GO:0051234, GO:0055085, GO:0086015, GO:0044700, GO:0044707, GO:0086036, GO:0044765, GO:0048878, GO:0050789, GO:0008150
GO:0007520 [BP]myoblast fusionprobableGO:0030154, GO:0061061, GO:0014706, GO:0000768, GO:0006949, GO:0009653, GO:0007275, GO:0044699, GO:0007517, GO:0051146, GO:0007519, GO:0048513, GO:0048869, GO:0035914, GO:0048646, GO:0032502, GO:0032501, GO:0014902, GO:0009987, GO:0009888, GO:0044767, GO:0044763, GO:0048731, GO:0044707, GO:0048856, GO:0060537, GO:0060538, GO:0008150, GO:0042692
GO:0030506 [MF]ankyrin bindingprobableGO:0003674, GO:0005488, GO:0005515, GO:0008092
GO:0043025 [CC]neuronal cell bodyprobableGO:0005575, GO:0097458, GO:0044297, GO:0005623, GO:0044464
GO:0051393 [MF]alpha-actinin bindingprobableGO:0042805, GO:0003674, GO:0005488, GO:0005515, GO:0008092
GO:2000021 [BP]regulation of ion homeostasisprobableGO:0008150, GO:0065007, GO:0050789, GO:0032844
GO:0007411 [BP]axon guidanceprobableGO:0032502, GO:0044707, GO:0030030, GO:0030154, GO:0048468, GO:0031175, GO:0009653, GO:0007275, GO:0044699, GO:0000904, GO:0000902, GO:0042330, GO:0048869, GO:0016043, GO:0032989, GO:0071840, GO:0048666, GO:0048667, GO:0032501, GO:0006935, GO:0030182, GO:0009987, GO:0044767, GO:0008150, GO:0007409, GO:0048731, GO:0042221, GO:0022008, GO:0048858, GO:0040011, GO:0048699, GO:0032990, GO:0009605, GO:0050896, GO:0048856, GO:0007399, GO:0048812, GO:0044763
GO:0009925 [CC]basal plasma membraneprobableGO:0016020, GO:0044464, GO:0045178, GO:0005623, GO:0016323, GO:0005575, GO:0071944, GO:0005886, GO:0044425, GO:0044459
GO:0014069 [CC]postsynaptic densityprobableGO:0030425, GO:0043229, GO:0043228, GO:0044430, GO:0044327, GO:0043226, GO:0005856, GO:0044446, GO:0044309, GO:0097458, GO:0044456, GO:0043005, GO:0042995, GO:0043197, GO:0043232, GO:0044463, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424, GO:0044422, GO:0045202
GO:0051928 [BP]positive regulation of calcium ion transportprobableGO:0010959, GO:0051050, GO:0051049, GO:0051924, GO:0043270, GO:0065007, GO:0048518, GO:0008150, GO:0032879, GO:0050789, GO:0043269
GO:0007605 [BP]sensory perception of soundprobableGO:0032501, GO:0044707, GO:0050954, GO:0007600, GO:0008150, GO:0050877, GO:0044699, GO:0003008
GO:0070509 [BP]calcium ion importprobableGO:0009987, GO:0070838, GO:0006812, GO:0006811, GO:0006810, GO:0070588, GO:0006816, GO:0051179, GO:0008150, GO:0034220, GO:0044765, GO:0030001, GO:0072511, GO:0051234, GO:0044763, GO:0055085, GO:0044699
GO:0002074 [BP]extraocular skeletal muscle developmentprobableGO:0032502, GO:0007517, GO:0032501, GO:0044707, GO:0007423, GO:0048856, GO:0007519, GO:0009888, GO:0044767, GO:0061061, GO:0014706, GO:0048513, GO:0001654, GO:0008150, GO:0060537, GO:0060538, GO:0048731, GO:0043010, GO:0007275, GO:0044699
GO:0030018 [CC]Z discprobableGO:0005737, GO:0005575, GO:0043229, GO:0043232, GO:0044464, GO:0031674, GO:0005623, GO:0005622, GO:0030016, GO:0030017, GO:0044444, GO:0043228, GO:0043292, GO:0044424, GO:0043226, GO:0044422, GO:0044449
GO:0005634 [CC]nucleusprobableGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0032590 [CC]dendrite membraneprobableGO:0016020, GO:0031256, GO:0044463, GO:0031253, GO:0031252, GO:0005623, GO:0044464, GO:0005575, GO:0097458, GO:0032589, GO:0071944, GO:0043005, GO:0005886, GO:0044425, GO:0042995, GO:0044459
GO:0043501 [BP]skeletal muscle adaptationprobableGO:0014888, GO:0044707, GO:0003012, GO:0032501, GO:0008150, GO:0043500, GO:0044699, GO:0003008
GO:0007029 [BP]endoplasmic reticulum organizationprobableGO:0006996, GO:0009987, GO:0016043, GO:0044763, GO:0044699, GO:0008150, GO:0071840
GO:0034765 [BP]regulation of ion transmembrane transportprobableGO:0051049, GO:0050794, GO:0065007, GO:0034762, GO:0008150, GO:0032879, GO:0050789, GO:0043269
GO:0019722 [BP]calcium-mediated signalingprobableGO:0044700, GO:0051716, GO:0008150, GO:0050896, GO:0009987, GO:0050794, GO:0023052, GO:0065007, GO:0044763, GO:0007165, GO:0019932, GO:0007154, GO:0035556, GO:0050789, GO:0044699
GO:0030165 [MF]PDZ domain bindingprobableGO:0003674, GO:0019904, GO:0005515, GO:0005488
GO:0007204 [BP]elevation of cytosolic calcium ion concentrationprobableGO:0019725, GO:0072507, GO:0072503, GO:0051480, GO:0006874, GO:0050801, GO:0009987, GO:0006873, GO:0048878, GO:0042592, GO:0006875, GO:0065007, GO:0044763, GO:0055074, GO:0030003, GO:0055065, GO:0055080, GO:0008150, GO:0055082, GO:0065008, GO:0044699
GO:0006941 [BP]striated muscle contractionprobableGO:0032501, GO:0006936, GO:0044707, GO:0003012, GO:0008150, GO:0044699, GO:0003008

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

No confident structure templates for the query are predicted