BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= psy12308
         (251 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|3J21|O Chain O, Promiscuous Behavior Of Proteins In Archaeal Ribosomes
           Revealed By Cryo-em: Implications For Evolution Of
           Eukaryotic Ribosomes (50s Ribosomal Proteins)
          Length = 203

 Score = 28.9 bits (63), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 11/29 (37%), Positives = 16/29 (55%)

Query: 160 SINHHYKKTVVYDPAKSETFKALQEEELV 188
           S+NHH  + +VYDP    T  +    EL+
Sbjct: 40  SLNHHIAQIIVYDPKGDRTLVSAHTRELI 68


>pdb|1K04|A Chain A, Crystal Structure Of The Focal Adhesion Targeting Domain
           Of Focal Adhesion Kinase
 pdb|1K05|A Chain A, Crystal Structure Of The Focal Adhesion Targeting Domain
           Of Focal Adhesion Kinase
 pdb|1K05|B Chain B, Crystal Structure Of The Focal Adhesion Targeting Domain
           Of Focal Adhesion Kinase
 pdb|1K05|C Chain C, Crystal Structure Of The Focal Adhesion Targeting Domain
           Of Focal Adhesion Kinase
 pdb|3B71|A Chain A, Cd4 Endocytosis Motif Bound To The Focal Adhesion
           Targeting (Fat) Domain Of The Focal Adhesion Kinase
 pdb|3B71|B Chain B, Cd4 Endocytosis Motif Bound To The Focal Adhesion
           Targeting (Fat) Domain Of The Focal Adhesion Kinase
 pdb|3B71|C Chain C, Cd4 Endocytosis Motif Bound To The Focal Adhesion
           Targeting (Fat) Domain Of The Focal Adhesion Kinase
          Length = 162

 Score = 27.7 bits (60), Expect = 6.6,   Method: Compositional matrix adjust.
 Identities = 10/35 (28%), Positives = 20/35 (57%)

Query: 205 APPKTYTKGASPQPHPTSPHPNANFGMTTEEIHQS 239
           +P  +Y +G   QP   SP P AN   + ++++++
Sbjct: 3   SPADSYNEGVKLQPQEISPPPTANLDRSNDKVYEN 37


>pdb|1OW6|A Chain A, Paxillin Ld4 Motif Bound To The Focal Adhesion Targeting
           (Fat) Domain Of The Focal Adhesion Kinase
 pdb|1OW6|B Chain B, Paxillin Ld4 Motif Bound To The Focal Adhesion Targeting
           (Fat) Domain Of The Focal Adhesion Kinase
 pdb|1OW6|C Chain C, Paxillin Ld4 Motif Bound To The Focal Adhesion Targeting
           (Fat) Domain Of The Focal Adhesion Kinase
 pdb|1OW7|A Chain A, Paxillin Ld4 Motif Bound To The Focal Adhesion Targeting
           (Fat) Domain Of The Focal Adhesion Kinase
 pdb|1OW7|B Chain B, Paxillin Ld4 Motif Bound To The Focal Adhesion Targeting
           (Fat) Domain Of The Focal Adhesion Kinase
 pdb|1OW7|C Chain C, Paxillin Ld4 Motif Bound To The Focal Adhesion Targeting
           (Fat) Domain Of The Focal Adhesion Kinase
 pdb|1OW8|A Chain A, Paxillin Ld2 Motif Bound To The Focal Adhesion Targeting
           (Fat) Domain Of The Focal Adhesion Kinase
 pdb|1OW8|B Chain B, Paxillin Ld2 Motif Bound To The Focal Adhesion Targeting
           (Fat) Domain Of The Focal Adhesion Kinase
 pdb|1OW8|C Chain C, Paxillin Ld2 Motif Bound To The Focal Adhesion Targeting
           (Fat) Domain Of The Focal Adhesion Kinase
          Length = 161

 Score = 27.7 bits (60), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 10/35 (28%), Positives = 20/35 (57%)

Query: 205 APPKTYTKGASPQPHPTSPHPNANFGMTTEEIHQS 239
           +P  +Y +G   QP   SP P AN   + ++++++
Sbjct: 2   SPADSYNEGVKLQPQEISPPPTANLDRSNDKVYEN 36


>pdb|3S9O|A Chain A, The Focal Adhesion Targeting (Fat) Domain Of The Focal
           Adhesion Kinase Showing N-Terminal Interactions In Cis
 pdb|3S9O|B Chain B, The Focal Adhesion Targeting (Fat) Domain Of The Focal
           Adhesion Kinase Showing N-Terminal Interactions In Cis
 pdb|3S9O|C Chain C, The Focal Adhesion Targeting (Fat) Domain Of The Focal
           Adhesion Kinase Showing N-Terminal Interactions In Cis
          Length = 164

 Score = 27.3 bits (59), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 10/35 (28%), Positives = 20/35 (57%)

Query: 205 APPKTYTKGASPQPHPTSPHPNANFGMTTEEIHQS 239
           +P  +Y +G   QP   SP P AN   + ++++++
Sbjct: 5   SPADSYNEGVKLQPQEISPPPTANLDRSNDKVYEN 39


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.314    0.131    0.399 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 8,406,234
Number of Sequences: 62578
Number of extensions: 352887
Number of successful extensions: 485
Number of sequences better than 100.0: 8
Number of HSP's better than 100.0 without gapping: 4
Number of HSP's successfully gapped in prelim test: 4
Number of HSP's that attempted gapping in prelim test: 481
Number of HSP's gapped (non-prelim): 8
length of query: 251
length of database: 14,973,337
effective HSP length: 96
effective length of query: 155
effective length of database: 8,965,849
effective search space: 1389706595
effective search space used: 1389706595
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 50 (23.9 bits)