BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= psy12338
(106 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|3KE7|A Chain A, Crystal Structure Of Putative Ketosteroid Isomerase
(Yp_001303366.1) From Parabacteroides Distasonis Atcc
8503 At 1.45 A Resolution
pdb|3KE7|B Chain B, Crystal Structure Of Putative Ketosteroid Isomerase
(Yp_001303366.1) From Parabacteroides Distasonis Atcc
8503 At 1.45 A Resolution
Length = 134
Score = 26.6 bits (57), Expect = 3.6, Method: Compositional matrix adjust.
Identities = 10/38 (26%), Positives = 18/38 (47%)
Query: 15 MQPHWNGMEPHWNGTEPHRNGTKPHWNGMQPHWNGMEP 52
+ + + WN TE +R W +Q HW+ ++P
Sbjct: 95 LDSYLSDKVIKWNCTEVYRRNPDNQWKIIQTHWSYVKP 132
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.316 0.138 0.586
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 4,739,077
Number of Sequences: 62578
Number of extensions: 224361
Number of successful extensions: 417
Number of sequences better than 100.0: 7
Number of HSP's better than 100.0 without gapping: 5
Number of HSP's successfully gapped in prelim test: 2
Number of HSP's that attempted gapping in prelim test: 321
Number of HSP's gapped (non-prelim): 65
length of query: 106
length of database: 14,973,337
effective HSP length: 71
effective length of query: 35
effective length of database: 10,530,299
effective search space: 368560465
effective search space used: 368560465
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 45 (21.9 bits)