Diaphorina citri psyllid: psy12362


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90--
MRIATGASMVRSFIAPPFLHSLYWPSPRAGFTAQGREAVESFLNHCVRPFAGLIQMCGHNRARQRDRLSHLLEEFAALQDEKSKIRAGNSEI
ccccccccHHHHHcccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccc
*******SMVRSFIAPPFLHSLYWPSPRAGFTAQGREAVESFLNHCVRPFAGLIQMCGHNRARQRDRLSHLLEEFAALQDEKSKIRAG****
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MRIATGASMVRSFIAPPFLHSLYWPSPRAGFTAQGREAVESFLNHCVRPFAGLIQMCGHNxxxxxxxxxxxxxxxxxxxxxKSKIRAGNSEI

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
N-alpha-acetyltransferase 35, NatC auxiliary subunit Component of the N-terminal acetyltransferase C (NatC) complex which may catalyze acetylation of N-terminal methionine residues (By similarity). Regulates proliferation of smooth muscle cells.confidentQ5RBT3
N-alpha-acetyltransferase 35, NatC auxiliary subunit Component of NAA50-NAA35 complex, which probably displays alpha (N-terminal) acetyltransferase activity. Regulates proliferation of smooth muscle cells.confidentQ6PHQ8
N-alpha-acetyltransferase 35, NatC auxiliary subunit Regulates proliferation of smooth muscle cells (By similarity). Component of the N-terminal acetyltransferase C (NatC) complex which may catalyze acetylation of N-terminal methionine residues.confidentQ5VZE5

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005886 [CC]plasma membraneprobableGO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623
GO:0005737 [CC]cytoplasmprobableGO:0044424, GO:0005575, GO:0044464, GO:0005623, GO:0005622
GO:0005730 [CC]nucleolusprobableGO:0005575, GO:0043232, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

No confident structure templates for the query are predicted