Query         psy12371
Match_columns 72
No_of_seqs    119 out of 1090
Neff          9.2 
Searched_HMMs 46136
Date          Fri Aug 16 17:27:01 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy12371.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/12371hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF00431 CUB:  CUB domain CUB d  99.6   4E-15 8.7E-20   79.7   6.6   51   14-69      1-51  (110)
  2 cd00041 CUB CUB domain; extrac  99.5 3.8E-14 8.3E-19   76.1   6.6   51   14-68      1-51  (113)
  3 smart00042 CUB Domain first fo  99.5 2.5E-13 5.3E-18   72.1   5.9   42   28-69      1-42  (102)
  4 KOG4292|consensus               98.8   2E-08 4.4E-13   65.5   5.7   55   10-69    288-342 (454)
  5 KOG4586|consensus               98.3   3E-06 6.5E-11   47.6   5.2   46   24-69     46-92  (156)
  6 KOG4292|consensus               97.7 4.9E-05 1.1E-09   50.1   3.3   51   13-67    168-218 (454)
  7 PF02408 CUB_2:  CUB-like domai  95.5   0.037   8E-07   30.4   4.1   27   37-63     36-62  (120)
  8 PF01186 Lysyl_oxidase:  Lysyl   70.1     4.9 0.00011   24.5   2.2   39   31-69    135-177 (205)
  9 KOG2689|consensus               50.4      37  0.0008   21.8   3.7   33   31-63    195-229 (290)
 10 smart00166 UBX Domain present   40.0      51  0.0011   16.4   3.5   21   43-63      3-23  (80)
 11 PF02843 GARS_C:  Phosphoribosy  37.3      27 0.00059   18.3   1.5   15   29-43      6-20  (93)
 12 PF05428 CRF-BP:  Corticotropin  36.9   1E+02  0.0022   20.1   4.2   28   40-67     76-103 (311)
 13 PF06473 FGF-BP1:  FGF binding   32.4      64  0.0014   20.0   2.7   29   27-62     43-72  (231)
 14 PF02083 Urotensin_II:  Urotens  26.8      22 0.00049   11.7   0.1    7   42-48      3-9   (12)
 15 PF05015 Plasmid_killer:  Plasm  25.8   1E+02  0.0022   16.0   2.5   23   41-63     59-81  (93)
 16 TIGR00008 infA translation ini  24.0      71  0.0015   16.0   1.6   24   48-71     42-65  (68)
 17 cd01770 p47_UBX p47-like ubiqu  23.6 1.2E+02  0.0025   15.4   3.3   19   44-62      4-22  (79)
 18 PF15243 ANAPC15:  Anaphase-pro  22.9      64  0.0014   17.2   1.4   17   32-48      2-18  (92)
 19 PF14400 Transglut_i_TM:  Inact  22.8 1.1E+02  0.0023   18.1   2.4   30   27-56     51-83  (165)
 20 cd01773 Faf1_like1_UBX Faf1 ik  22.7 1.3E+02  0.0028   15.6   3.5   21   42-62      3-23  (82)
 21 cd01767 UBX UBX (ubiquitin reg  22.6 1.1E+02  0.0025   14.9   3.1   19   44-62      2-20  (77)
 22 PRK12442 translation initiatio  22.0      91   0.002   16.5   1.8   25   46-70     42-66  (87)
 23 PF13473 Cupredoxin_1:  Cupredo  21.3      52  0.0011   17.2   0.9   17   48-64     36-52  (104)
 24 COG0361 InfA Translation initi  20.8 1.3E+02  0.0028   15.4   2.2   24   48-71     44-67  (75)
 25 cd01772 SAKS1_UBX SAKS1-like U  20.4 1.4E+02  0.0029   15.0   3.2   19   44-62      4-22  (79)

No 1  
>PF00431 CUB:  CUB domain CUB domain entry Spermadhesins family entry Link to schematic domain picture by Peer Bork. ;  InterPro: IPR000859 The CUB domain (for complement C1r/C1s, Uegf, Bmp1) is a structural motif of approximately 110 residues found almost exclusively in extracellular and plasma membrane-associated proteins, many of which are developmentally regulated [, ]. These proteins are involved in a diverse range of functions, including complement activation, developmental patterning, tissue repair, axon guidance and angiogenesis, cell signalling, fertilisation, haemostasis, inflammation, neurotransmission, receptor-mediated endocytosis, and tumour suppression [, ]. Many CUB-containing proteins are peptidases belonging to MEROPS peptidase families M12A (astacin) and S1A (chymotrypsin). Proteins containing a CUB domain include:  Mammalian complement subcomponents C1s/C1r, which form the calcium-dependent complex C1, the first component of the classical pathway of the complement system.  Cricetidae sp. (Hamster) serine protease Casp, which degrades type I and IV collagen and fibronectin in the presence of calcium. Mammalian complement-activating component of Ra-reactive factor (RARF), a protease that cleaves the C4 component of complement. Vertebrate enteropeptidase (3.4.21.9 from EC), a type II membrane protein of the intestinal brush border, which activates trypsinogen. Vertebrate bone morphogenic protein 1 (BMP-1), a protein which induces cartilage and bone formation and expresses metalloendopeptidase activity. Sea urchin blastula proteins BP10 and SpAN.  Caenorhabditis elegans hypothetical proteins F42A10.8 and R151.5. Neuropilin (A5 antigen), a calcium-independent cell adhesion molecule that functions during the formation of certain neuronal circuits. Fibropellins I and III from Strongylocentrotus purpuratus (Purple sea urchin). Mammalian hyaluronate-binding protein TSG-6 (or PS4), a serum and growth factor induced protein. Mammalian spermadhesins.  Xenopus laevis embryonic protein UVS.2, which is expressed during dorsoanterior development.  Several of the above proteins consist of a catalytic domain together with several CUB domains interspersed by calcium-binding EGF domains. Some CUB domains appear to be involved in oligomerisation and/or recognition of substrates and binding partners. For example, in the complement proteases, the CUB domains mediate dimerisation and binding to collagen-like regions of target proteins (e.g. C1q for C1r/C1s). The structure of CUB domains consists of a beta-sandwich with a jelly-roll fold. Almost all CUB domains contain four conserved cysteines that probably form two disulphide bridges (C1-C2, C3-C4). The CUB1 domains of C1s and Map19 have calcium-binding sites [].; PDB: 1SFP_A 3KQ4_B 2WNO_A 2QQK_A 2QQL_A 2QQO_B 2QQM_A 3POJ_A 3POB_A 3POG_B ....
Probab=99.61  E-value=4e-15  Score=79.69  Aligned_cols=51  Identities=39%  Similarity=0.756  Sum_probs=44.4

Q ss_pred             CCcEEeccccCCCcEEEeCCCCCCCCCCCCceEEEEEcCCCCeEEEEEeEEEeecC
Q psy12371         14 CDYQFVSTNHTRPQGRFFSPRYPSNYPADIKCAYTFRARAQERIRVVLEDFKLEKG   69 (72)
Q Consensus        14 C~~~~~~~~~~~~~g~i~SP~~p~~y~~~~~C~w~i~~~~~~~i~L~f~~f~le~~   69 (72)
                      |++.+     ....|.|.||+||..|+.+..|.|.|.++++.+|.|.|..|+|+..
T Consensus         1 Cg~~~-----~~~~g~i~Sp~yp~~y~~~~~C~w~i~~~~~~~I~l~f~~~~~~~~   51 (110)
T PF00431_consen    1 CGGRL-----TNNSGIISSPNYPSNYPSNSDCTWTITAPPGHRIRLTFLSFDLESS   51 (110)
T ss_dssp             SEEEE-----CSSEEEEESTTTTS-SSSSEEEEEEEE-STTEEEEEEEEEEEB--T
T ss_pred             CcCEE-----ECCeEEEECCCCCCCCCCCCcEeEEEEecccceeeeccccccceee
Confidence            78886     6899999999999999999999999999999999999999999854


No 2  
>cd00041 CUB CUB domain; extracellular domain; present in proteins mostly known to be involved in development; not found in prokaryotes, plants and yeast.
Probab=99.54  E-value=3.8e-14  Score=76.08  Aligned_cols=51  Identities=39%  Similarity=0.813  Sum_probs=45.8

Q ss_pred             CCcEEeccccCCCcEEEeCCCCCCCCCCCCceEEEEEcCCCCeEEEEEeEEEeec
Q psy12371         14 CDYQFVSTNHTRPQGRFFSPRYPSNYPADIKCAYTFRARAQERIRVVLEDFKLEK   68 (72)
Q Consensus        14 C~~~~~~~~~~~~~g~i~SP~~p~~y~~~~~C~w~i~~~~~~~i~L~f~~f~le~   68 (72)
                      |++.+.    ....|.|.||+||..|+++..|.|.|+++++.+|.|.|..|+|+.
T Consensus         1 C~~~~~----~~~~g~i~Sp~~p~~~~~~~~C~w~i~~~~g~~i~l~f~~~~l~~   51 (113)
T cd00041           1 CGGTLT----ASTSGTISSPNYPNNYPNNLNCVWTIEAPPGYRIRLTFEDFDLES   51 (113)
T ss_pred             CCCEEc----cCCCeEEECCCCCCCCCCCCcEEEEEEcCCCCEEEEEEeCccccc
Confidence            778874    224999999999999999999999999999999999999999973


No 3  
>smart00042 CUB Domain first found in C1r, C1s, uEGF, and bone morphogenetic protein. This domain is found mostly among developmentally-regulated proteins. Spermadhesins contain only this domain.
Probab=99.46  E-value=2.5e-13  Score=72.15  Aligned_cols=42  Identities=40%  Similarity=0.841  Sum_probs=39.5

Q ss_pred             EEEeCCCCCCCCCCCCceEEEEEcCCCCeEEEEEeEEEeecC
Q psy12371         28 GRFFSPRYPSNYPADIKCAYTFRARAQERIRVVLEDFKLEKG   69 (72)
Q Consensus        28 g~i~SP~~p~~y~~~~~C~w~i~~~~~~~i~L~f~~f~le~~   69 (72)
                      |.|.||+||..||++..|.|.|+++++.+|.|.|..|+|+..
T Consensus         1 G~i~Sp~yP~~y~~~~~C~w~i~~~~g~~i~l~f~~~~l~~~   42 (102)
T smart00042        1 GTITSPNYPQSYPNNLDCVWTIRAPPGYRIELQFTDFDLESS   42 (102)
T ss_pred             CEEeCCCCCcCCCCCCcEEEEEECCCCeEEEEEEEEEeccCC
Confidence            679999999999999999999999999999999999999853


No 4  
>KOG4292|consensus
Probab=98.78  E-value=2e-08  Score=65.52  Aligned_cols=55  Identities=24%  Similarity=0.596  Sum_probs=48.8

Q ss_pred             CCCCCCcEEeccccCCCcEEEeCCCCCCCCCCCCceEEEEEcCCCCeEEEEEeEEEeecC
Q psy12371         10 SGTTCDYQFVSTNHTRPQGRFFSPRYPSNYPADIKCAYTFRARAQERIRVVLEDFKLEKG   69 (72)
Q Consensus        10 ~~~~C~~~~~~~~~~~~~g~i~SP~~p~~y~~~~~C~w~i~~~~~~~i~L~f~~f~le~~   69 (72)
                      ..+.|+.+++     ...|.+.||+||..|+++..|+|++.++.++.|.+.|+.+-++.+
T Consensus       288 ~~~~C~~~~~-----~~~G~~~Sp~yp~~y~~~l~Ct~~l~~~~g~~l~v~fh~~~~~~s  342 (454)
T KOG4292|consen  288 QISDCNRTYH-----GKFGNLTSPGYPQNYPNNLDCTTHLTVPGGHTLVVFFHEFSIENS  342 (454)
T ss_pred             ccccccccee-----cceeEEcCCCCcccCCCCCcceEEEEcCCCCEEEEEeecccchhh
Confidence            3588998884     589999999999999999999999999999999999888877654


No 5  
>KOG4586|consensus
Probab=98.28  E-value=3e-06  Score=47.62  Aligned_cols=46  Identities=26%  Similarity=0.621  Sum_probs=41.0

Q ss_pred             CCCcEEEeCCCCCCCCCCCCceEEEEEcCCCCeEEEEEeE-EEeecC
Q psy12371         24 TRPQGRFFSPRYPSNYPADIKCAYTFRARAQERIRVVLED-FKLEKG   69 (72)
Q Consensus        24 ~~~~g~i~SP~~p~~y~~~~~C~w~i~~~~~~~i~L~f~~-f~le~~   69 (72)
                      .+..+.++||+||..||++.+|...|.+...+-|.+.|.. |.||++
T Consensus        46 ~~n~~Iftspn~ps~ypp~r~cv~vi~~~p~~~ve~~Fde~y~IEps   92 (156)
T KOG4586|consen   46 LQNFNIFTSPNFPSRYPPNRDCVRVIHSRPQHDVEVKFDEVYHIEPS   92 (156)
T ss_pred             ecccceEecCCccccCCCCcceEEeEecccccceEEeeeeeEEeccc
Confidence            4667899999999999999999999999999889999986 778754


No 6  
>KOG4292|consensus
Probab=97.67  E-value=4.9e-05  Score=50.10  Aligned_cols=51  Identities=24%  Similarity=0.441  Sum_probs=44.0

Q ss_pred             CCCcEEeccccCCCcEEEeCCCCCCCCCCCCceEEEEEcCCCCeEEEEEeEEEee
Q psy12371         13 TCDYQFVSTNHTRPQGRFFSPRYPSNYPADIKCAYTFRARAQERIRVVLEDFKLE   67 (72)
Q Consensus        13 ~C~~~~~~~~~~~~~g~i~SP~~p~~y~~~~~C~w~i~~~~~~~i~L~f~~f~le   67 (72)
                      .|..++.    ++..|.+.+|+||..|..+.-|.|.+.+++++++.|++..+++.
T Consensus       168 ~~~~t~~----~q~sg~~~~~~~p~~~v~s~~c~Wli~t~p~q~l~irv~~~~~~  218 (454)
T KOG4292|consen  168 TYNITFT----TQNSGSIPSPNDPDTYVASSICNWLIDTPPGQRLYIRVVHLHLA  218 (454)
T ss_pred             ccceeec----CcccccccCCCCcccccccchhhhhhhcCCCcceeEEEEeccCC
Confidence            4555663    56679999999999999999999999999999999999988664


No 7  
>PF02408 CUB_2:  CUB-like domain;  InterPro: IPR003366 This domain is found in a family of hypothetical Caenorhabditis elegans proteins. The aligned region has no known function nor do any of the proteins which possess it. However, this domain is related to the CUB domain (IPR000859 from INTERPRO). The aligned region is approximately 130 amino acids long and contains two conserved cysteine residues.
Probab=95.54  E-value=0.037  Score=30.44  Aligned_cols=27  Identities=22%  Similarity=0.496  Sum_probs=22.8

Q ss_pred             CCCCCCCceEEEEEcCCCCeEEEEEeE
Q psy12371         37 SNYPADIKCAYTFRARAQERIRVVLED   63 (72)
Q Consensus        37 ~~y~~~~~C~w~i~~~~~~~i~L~f~~   63 (72)
                      ..+|.+..|.|.|.+|.|.-++|.+..
T Consensus        36 ~~~p~n~~C~y~i~iP~G~~a~v~~~~   62 (120)
T PF02408_consen   36 PQFPANQNCTYQINIPKGYYAKVTLSA   62 (120)
T ss_pred             cccCCCCceEEEEEcCCceEEEEEEEE
Confidence            357889999999999999988887743


No 8  
>PF01186 Lysyl_oxidase:  Lysyl oxidase ;  InterPro: IPR001695 Lysyl oxidase (1.4.3.13 from EC) (LOX) [] is an extracellular copper-dependent enzyme that catalyses the oxidative deamination of peptidyl lysine residues in precursors of various collagens and elastins, yielding alpha-aminoadipic-delta-semialdehyde. The deaminated lysines are then able to form semialdehyde cross-links, resulting in the formation of insoluble collagen and elastin fibres in the extracellular matrix []. The active site of LOX resides towards the C terminus: this region also binds a single copper atom in an octahedral coordination complex involving at least 3 His residues []. Four histidine residues are clustered in a central region of the enzyme. This region is thought to be involved in cooper-binding and is called the 'copper-talon' [].; GO: 0005507 copper ion binding, 0016641 oxidoreductase activity, acting on the CH-NH2 group of donors, oxygen as acceptor, 0055114 oxidation-reduction process
Probab=70.07  E-value=4.9  Score=24.50  Aligned_cols=39  Identities=18%  Similarity=0.461  Sum_probs=27.2

Q ss_pred             eCCCCCCCCCCCCceEEE-E-EcCCC-CeEEEEEeE-EEeecC
Q psy12371         31 FSPRYPSNYPADIKCAYT-F-RARAQ-ERIRVVLED-FKLEKG   69 (72)
Q Consensus        31 ~SP~~p~~y~~~~~C~w~-i-~~~~~-~~i~L~f~~-f~le~~   69 (72)
                      .||++-..|.....|.|. | .+++| +.+++..+. +.|.+.
T Consensus       135 IS~Gc~DtY~~~idcQWiDITdvp~G~Y~l~V~vNP~~~v~Es  177 (205)
T PF01186_consen  135 ISPGCGDTYRHDIDCQWIDITDVPPGTYILQVTVNPEYRVAES  177 (205)
T ss_pred             ccCCccccccCCCCccceeecCCCCccEEEEEecCCccccccc
Confidence            689999999999999996 2 34554 556666553 444433


No 9  
>KOG2689|consensus
Probab=50.36  E-value=37  Score=21.84  Aligned_cols=33  Identities=21%  Similarity=0.359  Sum_probs=23.8

Q ss_pred             eCCCCCCCCCC--CCceEEEEEcCCCCeEEEEEeE
Q psy12371         31 FSPRYPSNYPA--DIKCAYTFRARAQERIRVVLED   63 (72)
Q Consensus        31 ~SP~~p~~y~~--~~~C~w~i~~~~~~~i~L~f~~   63 (72)
                      .+|.-+..-|+  ...|.-.|+.++|+.+..+|..
T Consensus       195 ~s~s~~~~spp~~ys~crlQiRl~DG~Tl~~tF~a  229 (290)
T KOG2689|consen  195 PSPSAPSQSPPTDYSQCRLQIRLPDGQTLTQTFNA  229 (290)
T ss_pred             CCCCccccCCCCcccceEEEEEcCCCCeeeeecCc
Confidence            34444433344  5789999999999999988853


No 10 
>smart00166 UBX Domain present in ubiquitin-regulatory proteins. Present in FAF1 and Shp1p.
Probab=40.02  E-value=51  Score=16.43  Aligned_cols=21  Identities=14%  Similarity=0.234  Sum_probs=17.3

Q ss_pred             CceEEEEEcCCCCeEEEEEeE
Q psy12371         43 IKCAYTFRARAQERIRVVLED   63 (72)
Q Consensus        43 ~~C~w~i~~~~~~~i~L~f~~   63 (72)
                      ..|.-.|+.|+|.++...|..
T Consensus         3 ~~~~I~iRlPdG~ri~~~F~~   23 (80)
T smart00166        3 DQCRLQIRLPDGSRLVRRFPS   23 (80)
T ss_pred             CeEEEEEEcCCCCEEEEEeCC
Confidence            468889999999999887753


No 11 
>PF02843 GARS_C:  Phosphoribosylglycinamide synthetase, C domain;  InterPro: IPR020560 Phosphoribosylglycinamide synthetase (6.3.4.13 from EC) (GARS) (phosphoribosylamine glycine ligase) [] catalyses the second step in the de novo biosynthesis of purine. The reaction catalysed by phosphoribosylglycinamide synthetase is the ATP-dependent addition of 5-phosphoribosylamine to glycine to form 5'phosphoribosylglycinamide:  ATP + 5-phosphoribosylamine + glycine = ADP + Pi + 5'-phosphoribosylglycinamide  In bacteria, GARS is a monofunctional enzyme (encoded by the purD gene). In yeast, GARS is part of a bifunctional enzyme (encoded by the ADE5/7 gene) in conjunction with phosphoribosylformylglycinamidine cyclo-ligase (AIRS) (IPR000728 from INTERPRO). In higher eukaryotes, GARS is part of a trifunctional enzyme in conjunction with AIRS (IPR000728 from INTERPRO) and with phosphoribosylglycinamide formyltransferase (GART) (), forming GARS-AIRS-GART. This entry represents the C-domain, which is related to the C-terminal domain of biotin carboxylase/carbamoyl phosphate synthetase (IPR005480 from INTERPRO).; GO: 0004637 phosphoribosylamine-glycine ligase activity, 0009113 purine base biosynthetic process; PDB: 2YW2_B 2YYA_A 3MJF_A 2IP4_A 3LP8_A 1VKZ_A 2YS6_A 2YRX_A 2YRW_A 2YS7_A ....
Probab=37.31  E-value=27  Score=18.27  Aligned_cols=15  Identities=27%  Similarity=0.512  Sum_probs=9.5

Q ss_pred             EEeCCCCCCCCCCCC
Q psy12371         29 RFFSPRYPSNYPADI   43 (72)
Q Consensus        29 ~i~SP~~p~~y~~~~   43 (72)
                      .+.|++||..|..+.
T Consensus         6 v~as~GYP~~~~~g~   20 (93)
T PF02843_consen    6 VLASKGYPGSYEKGF   20 (93)
T ss_dssp             EEEETTTTSS--SS-
T ss_pred             EEeCCCcCCCCCCCC
Confidence            577899998886543


No 12 
>PF05428 CRF-BP:  Corticotropin-releasing factor binding protein (CRF-BP);  InterPro: IPR008435 This family consists of several eukaryotic corticotropin-releasing factor binding proteins (CRF-BP or CRH-BP). Corticotropin-releasing hormone (CRH) plays multiple roles in vertebrate species. In mammals, it is the major hypothalamic releasing factor for pituitary adrenocorticotropin secretion, and is a neurotransmitter or neuromodulator at other sites in the central nervous system. In non-mammalian vertebrates, CRH not only acts as a neurotransmitter and hypophysiotropin, it also acts as a potent thyrotropin-releasing factor, allowing CRH to regulate both the adrenal and thyroid axes, especially in development. CRH-BP is thought to play an inhibitory role in which it binds CRH and other CRH-like ligands and prevents the activation of CRH receptors. There is however evidence that CRH-BP may also exhibit diverse extra and intracellular roles in a cell specific fashion and at specific times in development [].
Probab=36.93  E-value=1e+02  Score=20.13  Aligned_cols=28  Identities=21%  Similarity=0.453  Sum_probs=24.1

Q ss_pred             CCCCceEEEEEcCCCCeEEEEEeEEEee
Q psy12371         40 PADIKCAYTFRARAQERIRVVLEDFKLE   67 (72)
Q Consensus        40 ~~~~~C~w~i~~~~~~~i~L~f~~f~le   67 (72)
                      .+...|.-.+-+.+...|.+.|..+++.
T Consensus        76 ~pq~~Ca~y~iaePd~~IeI~~~~vdid  103 (311)
T PF05428_consen   76 RPQLVCAAYFIAEPDELIEIEFDHVDID  103 (311)
T ss_pred             CCCceeEEEEEeCCCeEEEEEEEEeecc
Confidence            4577899888888899999999999885


No 13 
>PF06473 FGF-BP1:  FGF binding protein 1 (FGF-BP1);  InterPro: IPR010510 This family consists of several mammalian FGF binding protein 1. Fibroblast growth factors (FGFs) play important roles during foetal and embryonic development []. Fibroblast growth factor-binding protein (FGF-BP) 1 is a secreted protein that can bind fibroblast growth factors (FGFs) 1 and 2 [].
Probab=32.39  E-value=64  Score=20.03  Aligned_cols=29  Identities=17%  Similarity=0.442  Sum_probs=17.7

Q ss_pred             cEEEeCCCCCCCCCCCCceEEEE-EcCCCCeEEEEEe
Q psy12371         27 QGRFFSPRYPSNYPADIKCAYTF-RARAQERIRVVLE   62 (72)
Q Consensus        27 ~g~i~SP~~p~~y~~~~~C~w~i-~~~~~~~i~L~f~   62 (72)
                      +|.|.++       ....|.|.+ ...++..++|...
T Consensus        43 ~GkF~Tk-------~~~~Ctw~v~~~~~~~~L~V~C~   72 (231)
T PF06473_consen   43 SGKFVTK-------DQHACTWQVTTGEDGVELRVECK   72 (231)
T ss_pred             cceeecC-------CCCceEEEeccCCCceEEEEEEc
Confidence            4666665       456899999 4444444555443


No 14 
>PF02083 Urotensin_II:  Urotensin II;  InterPro: IPR001483 Urotensin II, a small peptide that contains a disulphide bridge, was originally isolated from the caudal portion of the spinal cord of teleost and elasmobranch fish []. The peptide has also been found in the brain of frogs []. Urotensin II seems to be involved in smooth muscle stimulation.; GO: 0005179 hormone activity, 0005576 extracellular region
Probab=26.82  E-value=22  Score=11.72  Aligned_cols=7  Identities=14%  Similarity=0.634  Sum_probs=4.5

Q ss_pred             CCceEEE
Q psy12371         42 DIKCAYT   48 (72)
Q Consensus        42 ~~~C~w~   48 (72)
                      ..+|.|.
T Consensus         3 ~~~CFWK    9 (12)
T PF02083_consen    3 KSECFWK    9 (12)
T ss_pred             ccchhhh
Confidence            4567775


No 15 
>PF05015 Plasmid_killer:  Plasmid maintenance system killer protein;  InterPro: IPR007711 Several plasmids with proteic killer gene systems have been reported. All of them encode a stable toxin and an unstable antidote. Upon loss of the plasmid, the less stable inhibitor is inactivated more rapidly than the toxin, allowing the toxin to be activated. The activation of those systems result in cell filamentation and cessation of viable cell production. It has been verified that both the stable killer and the unstable inhibitor of the systems are short polypeptides. This family corresponds to the toxin.
Probab=25.81  E-value=1e+02  Score=16.00  Aligned_cols=23  Identities=26%  Similarity=0.364  Sum_probs=17.8

Q ss_pred             CCCceEEEEEcCCCCeEEEEEeE
Q psy12371         41 ADIKCAYTFRARAQERIRVVLED   63 (72)
Q Consensus        41 ~~~~C~w~i~~~~~~~i~L~f~~   63 (72)
                      .+..=.|.|.+..+.+|.+.|.+
T Consensus        59 G~~~g~~Si~i~~~~RliF~~~~   81 (93)
T PF05015_consen   59 GDRKGQWSIRINGNWRLIFRFED   81 (93)
T ss_pred             CCCCCcEEEEeCCCEEEEEEEeC
Confidence            34556899999999988877764


No 16 
>TIGR00008 infA translation initiation factor IF-1. This family consists of translation initiation factor IF-1 as found in bacteria and chloroplasts. This protein, about 70 residues in length, consists largely of an S1 RNA binding domain (pfam00575).
Probab=24.00  E-value=71  Score=16.00  Aligned_cols=24  Identities=21%  Similarity=0.527  Sum_probs=17.4

Q ss_pred             EEEcCCCCeEEEEEeEEEeecCCC
Q psy12371         48 TFRARAQERIRVVLEDFKLEKGDV   71 (72)
Q Consensus        48 ~i~~~~~~~i~L~f~~f~le~~~~   71 (72)
                      .|....|-++.+.+..|+++..+|
T Consensus        42 rI~I~~GD~V~Ve~spyd~tkgrI   65 (68)
T TIGR00008        42 YIRILPGDKVKVELSPYDLTRGRI   65 (68)
T ss_pred             cEEECCCCEEEEEECcccCCcEeE
Confidence            456677788888888888765543


No 17 
>cd01770 p47_UBX p47-like ubiquitin domain. p47_UBX  p47 is an adaptor molecule of the cytosolic AAA ATPase p97. The principal role of the p97-p47 complex is to regulate membrane fusion events. Mono-ubiquitin recognition by p47 is crucial for p97-p47-mediated Golgi membrane fusion events.  p47 has carboxy-terminal SEP and UBX domains.  The UBX domain has a beta-grasp fold similar to that of ubiquitin however, UBX lacks the c-terminal double glycine motif and is thus unlikely to be conjugated to other proteins.
Probab=23.62  E-value=1.2e+02  Score=15.36  Aligned_cols=19  Identities=11%  Similarity=0.160  Sum_probs=16.0

Q ss_pred             ceEEEEEcCCCCeEEEEEe
Q psy12371         44 KCAYTFRARAQERIRVVLE   62 (72)
Q Consensus        44 ~C~w~i~~~~~~~i~L~f~   62 (72)
                      .|.-.|+.++|.++..+|.
T Consensus         4 ~t~iqiRlpdG~r~~~rF~   22 (79)
T cd01770           4 TTSIQIRLADGKRLVQKFN   22 (79)
T ss_pred             eeEEEEECCCCCEEEEEeC
Confidence            5777899999999988775


No 18 
>PF15243 ANAPC15:  Anaphase-promoting complex subunit 15
Probab=22.85  E-value=64  Score=17.19  Aligned_cols=17  Identities=24%  Similarity=0.440  Sum_probs=13.2

Q ss_pred             CCCCCCCCCCCCceEEE
Q psy12371         32 SPRYPSNYPADIKCAYT   48 (72)
Q Consensus        32 SP~~p~~y~~~~~C~w~   48 (72)
                      ||-||..+|.-..-.|.
T Consensus         2 st~FPsl~Prv~~~lwf   18 (92)
T PF15243_consen    2 STQFPSLFPRVTDPLWF   18 (92)
T ss_pred             CCcCCCcCCCCCCcccc
Confidence            57788888887777774


No 19 
>PF14400 Transglut_i_TM:  Inactive transglutaminase fused to 7 transmembrane helices
Probab=22.77  E-value=1.1e+02  Score=18.11  Aligned_cols=30  Identities=17%  Similarity=0.359  Sum_probs=22.9

Q ss_pred             cEEEeCCCCCCCC---CCCCceEEEEEcCCCCe
Q psy12371         27 QGRFFSPRYPSNY---PADIKCAYTFRARAQER   56 (72)
Q Consensus        27 ~g~i~SP~~p~~y---~~~~~C~w~i~~~~~~~   56 (72)
                      ...+.||+|...+   ..+....|.++...|..
T Consensus        51 ~E~~~SpGYGls~~~~~~~RrA~WS~R~A~G~Q   83 (165)
T PF14400_consen   51 DENFASPGYGLSIVDDDGNRRAEWSIRRASGPQ   83 (165)
T ss_pred             ccccccCCCCeEEEecCCCcEEEEecccCCCce
Confidence            4467899998655   45778999999988864


No 20 
>cd01773 Faf1_like1_UBX Faf1 ike-1 UBX domain. Faf1_like1 is a protein of unknown function with a domain architecture that includes the UAS (ubiquitin-associated) and UBX (ubiquitin-like) domains.  This protein is related to other UBA/UBX-containing proteins like Faf1, p47, and SAKS1 and may serve as an adaptor molecule that shuttles proteins to the proteasome for degradation.  The UBX domain has a beta-grasp fold similar to that of ubiquitin however, UBX lacks the c-terminal double glycine motif and is thus unlikely to be conjugated to other proteins.
Probab=22.70  E-value=1.3e+02  Score=15.58  Aligned_cols=21  Identities=19%  Similarity=0.219  Sum_probs=17.1

Q ss_pred             CCceEEEEEcCCCCeEEEEEe
Q psy12371         42 DIKCAYTFRARAQERIRVVLE   62 (72)
Q Consensus        42 ~~~C~w~i~~~~~~~i~L~f~   62 (72)
                      ...|.-.|+.|.|.++.-+|.
T Consensus         3 ~~~t~i~vRlP~G~r~~rrF~   23 (82)
T cd01773           3 GPKARLMLRYPDGKREQIALP   23 (82)
T ss_pred             CCeeEEEEECCCCCEEEEEeC
Confidence            446788899999999988775


No 21 
>cd01767 UBX UBX (ubiquitin regulatory X) domain. The UBX (ubiquitin regulatory X) domain has a beta-grasp fold that is structurally quite similar to ubiquitin although UBX lacks the c-terminal double glycine motif and is thus unlikely to be conjugated to other proteins. Most UBX-containing proteins including p47, FAF1, and SAKS1 (Y33K) also contain a UBA (ubiquitin-associated) domain and are thought to serve as adaptor molecules that shuttle proteins to the proteasome for degradation.
Probab=22.59  E-value=1.1e+02  Score=14.95  Aligned_cols=19  Identities=11%  Similarity=0.165  Sum_probs=15.1

Q ss_pred             ceEEEEEcCCCCeEEEEEe
Q psy12371         44 KCAYTFRARAQERIRVVLE   62 (72)
Q Consensus        44 ~C~w~i~~~~~~~i~L~f~   62 (72)
                      .|.-.|+.|+|.++.-.|.
T Consensus         2 ~t~i~iRlpdG~~~~~~F~   20 (77)
T cd01767           2 TTKIQIRLPDGKRLEQRFN   20 (77)
T ss_pred             cEEEEEEcCCCCEEEEEeC
Confidence            4677788899998887775


No 22 
>PRK12442 translation initiation factor IF-1; Reviewed
Probab=22.04  E-value=91  Score=16.48  Aligned_cols=25  Identities=28%  Similarity=0.454  Sum_probs=18.2

Q ss_pred             EEEEEcCCCCeEEEEEeEEEeecCC
Q psy12371         46 AYTFRARAQERIRVVLEDFKLEKGD   70 (72)
Q Consensus        46 ~w~i~~~~~~~i~L~f~~f~le~~~   70 (72)
                      .-.|..-.|-+|.+.+..||++..+
T Consensus        42 ~~rIrIl~GD~V~VE~spYDltkGR   66 (87)
T PRK12442         42 KHRIRILAGDRVTLELSPYDLTKGR   66 (87)
T ss_pred             eeeEEecCCCEEEEEECcccCCcee
Confidence            3357777788888888888876544


No 23 
>PF13473 Cupredoxin_1:  Cupredoxin-like domain; PDB: 1IBZ_D 1IC0_E 1IBY_D.
Probab=21.31  E-value=52  Score=17.17  Aligned_cols=17  Identities=12%  Similarity=0.276  Sum_probs=11.8

Q ss_pred             EEEcCCCCeEEEEEeEE
Q psy12371         48 TFRARAQERIRVVLEDF   64 (72)
Q Consensus        48 ~i~~~~~~~i~L~f~~f   64 (72)
                      .|.++.|..+.|.|.+-
T Consensus        36 ~i~v~~G~~v~l~~~N~   52 (104)
T PF13473_consen   36 TITVKAGQPVTLTFTNN   52 (104)
T ss_dssp             EEEEETTCEEEEEEEE-
T ss_pred             EEEEcCCCeEEEEEEEC
Confidence            47777788777777654


No 24 
>COG0361 InfA Translation initiation factor 1 (IF-1) [Translation, ribosomal structure and biogenesis]
Probab=20.79  E-value=1.3e+02  Score=15.43  Aligned_cols=24  Identities=25%  Similarity=0.425  Sum_probs=17.7

Q ss_pred             EEEcCCCCeEEEEEeEEEeecCCC
Q psy12371         48 TFRARAQERIRVVLEDFKLEKGDV   71 (72)
Q Consensus        48 ~i~~~~~~~i~L~f~~f~le~~~~   71 (72)
                      .|...+|-.|.+...+|++...+|
T Consensus        44 ~i~I~~GD~V~Ve~~~~d~~kg~I   67 (75)
T COG0361          44 RIRILPGDVVLVELSPYDLTKGRI   67 (75)
T ss_pred             eEEeCCCCEEEEEecccccccccE
Confidence            455677888888888888776553


No 25 
>cd01772 SAKS1_UBX SAKS1-like UBX domain. SAKS1 (SAPK-substrate-1), also known as Y33K, is a widely expressed protein containing N-terminal UBA (ubiquitin-associated) and C-terminal UBX (ubiqiutin-like) domains that was identified as a substrate of stress-activated protein kinases (SAPKs). SAKS1 is related evolutionarily to two other UBA/UBX-containing proteins, p47 and Faf1.  The UBA and UBX domains of SAKS1 bind ubiquitin tetramers and valosin-containing protein (VCP), respectively suggesting a role for SAKS1 as an adaptor that directs VCP to polyubiquitinated proteins facilitating its destruction by the proteasome.  The UBX domain has a beta-grasp fold similar to that of ubiquitin however, UBX lacks the c-terminal double glycine motif and is thus unlikely to be conjugated to other proteins.
Probab=20.44  E-value=1.4e+02  Score=14.97  Aligned_cols=19  Identities=5%  Similarity=0.130  Sum_probs=15.6

Q ss_pred             ceEEEEEcCCCCeEEEEEe
Q psy12371         44 KCAYTFRARAQERIRVVLE   62 (72)
Q Consensus        44 ~C~w~i~~~~~~~i~L~f~   62 (72)
                      .|.-.|+.|+|.++.-.|.
T Consensus         4 ~~~i~iRlp~G~~~~~~F~   22 (79)
T cd01772           4 ETRIQIRLLDGTTLKQTFK   22 (79)
T ss_pred             EEEEEEECCCCCEEEEEeC
Confidence            4777889999999888775


Done!