BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= psy12393
         (155 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|3K6S|A Chain A, Structure Of Integrin Alphaxbeta2 Ectodomain
 pdb|3K6S|C Chain C, Structure Of Integrin Alphaxbeta2 Ectodomain
 pdb|3K6S|E Chain E, Structure Of Integrin Alphaxbeta2 Ectodomain
 pdb|3K6S|G Chain G, Structure Of Integrin Alphaxbeta2 Ectodomain
 pdb|3K71|A Chain A, Structure Of Integrin Alphax Beta2 Ectodomain
 pdb|3K71|C Chain C, Structure Of Integrin Alphax Beta2 Ectodomain
 pdb|3K71|E Chain E, Structure Of Integrin Alphax Beta2 Ectodomain
 pdb|3K71|G Chain G, Structure Of Integrin Alphax Beta2 Ectodomain
 pdb|3K72|A Chain A, Structure Of Integrin Alphax Beta2
 pdb|3K72|C Chain C, Structure Of Integrin Alphax Beta2
          Length = 1095

 Score = 26.9 bits (58), Expect = 5.1,   Method: Composition-based stats.
 Identities = 17/50 (34%), Positives = 21/50 (42%)

Query: 21  SAYLCHLCFVGGHYITDCPLFNMSPFSKYRQLFLFQARPKGEGLTPYQGK 70
           S  + HL F GG  IT    F++SP +      L  A    E  TP   K
Sbjct: 843 SCRINHLIFRGGAQITFLATFDVSPKAVLGDRLLLTANVSSENNTPRTSK 892


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.324    0.140    0.479 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 5,430,321
Number of Sequences: 62578
Number of extensions: 225419
Number of successful extensions: 418
Number of sequences better than 100.0: 8
Number of HSP's better than 100.0 without gapping: 6
Number of HSP's successfully gapped in prelim test: 2
Number of HSP's that attempted gapping in prelim test: 412
Number of HSP's gapped (non-prelim): 8
length of query: 155
length of database: 14,973,337
effective HSP length: 91
effective length of query: 64
effective length of database: 9,278,739
effective search space: 593839296
effective search space used: 593839296
T: 11
A: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (22.0 bits)
S2: 47 (22.7 bits)