Query         psy12393
Match_columns 155
No_of_seqs    63 out of 65
Neff          3.4 
Searched_HMMs 46136
Date          Fri Aug 16 18:00:08 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy12393.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/12393hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF13695 zf-3CxxC:  Zinc-bindin  99.6 1.2E-15 2.5E-20  111.6   4.4   68   72-139     1-97  (98)
  2 PF13696 zf-CCHC_2:  Zinc knuck  99.5 8.2E-15 1.8E-19   90.7   2.4   26   15-40      1-26  (32)
  3 COG5222 Uncharacterized conser  98.5 5.7E-08 1.2E-12   86.6   2.2   40   13-52    167-206 (427)
  4 PF00098 zf-CCHC:  Zinc knuckle  96.5   0.001 2.2E-08   36.1   0.9   16   24-39      2-17  (18)
  5 KOG0314|consensus               96.1  0.0027 5.9E-08   58.5   1.5   34   18-51    154-187 (448)
  6 PF13917 zf-CCHC_3:  Zinc knuck  95.7  0.0058 1.3E-07   39.8   1.4   32   22-62      4-35  (42)
  7 PF15135 UPF0515:  Uncharacteri  95.3  0.0092   2E-07   52.1   1.7   40   73-115   152-193 (278)
  8 smart00343 ZnF_C2HC zinc finge  85.8    0.35 7.6E-06   27.3   0.7   17   24-40      1-17  (26)
  9 smart00834 CxxC_CXXC_SSSS Puta  83.2       1 2.3E-05   27.1   2.0   30   76-105     5-35  (41)
 10 COG5082 AIR1 Arginine methyltr  75.4     1.2 2.6E-05   37.3   0.7   22   18-39     56-77  (190)
 11 TIGR02605 CxxC_CxxC_SSSS putat  72.2     3.6 7.8E-05   26.2   2.2   29   76-104     5-34  (52)
 12 KOG4400|consensus               69.6     3.6 7.7E-05   34.3   2.2   21   21-41     91-111 (261)
 13 smart00659 RPOLCX RNA polymera  68.6     4.9 0.00011   26.0   2.3   33   76-112     2-34  (44)
 14 KOG0314|consensus               63.9     4.5 9.7E-05   37.8   1.9   35   17-51    128-162 (448)
 15 PF09723 Zn-ribbon_8:  Zinc rib  63.0     6.8 0.00015   24.7   2.1   29   76-104     5-34  (42)
 16 PTZ00368 universal minicircle   57.4     4.7  0.0001   30.7   0.7   19   22-40    103-121 (148)
 17 PF05741 zf-nanos:  Nanos RNA b  56.8     4.3 9.4E-05   27.9   0.4   20   22-41     33-55  (55)
 18 PTZ00368 universal minicircle   50.8     7.4 0.00016   29.6   0.9   18   24-41      2-19  (148)
 19 PF11682 DUF3279:  Protein of u  48.0      23 0.00051   27.9   3.3   78   13-110    19-124 (128)
 20 PF14392 zf-CCHC_4:  Zinc knuck  47.0     7.6 0.00017   25.0   0.4   17   23-39     32-48  (49)
 21 PF13894 zf-C2H2_4:  C2H2-type   46.7     4.7  0.0001   20.7  -0.6   17   77-93      1-17  (24)
 22 PF12171 zf-C2H2_jaz:  Zinc-fin  46.4     4.3 9.4E-05   22.8  -0.8   18   77-94      2-19  (27)
 23 PRK00398 rpoP DNA-directed RNA  46.1      13 0.00028   23.4   1.3   30   76-107     3-32  (46)
 24 COG5082 AIR1 Arginine methyltr  45.3     9.3  0.0002   32.1   0.7   17   23-39     98-115 (190)
 25 PF01096 TFIIS_C:  Transcriptio  43.2      11 0.00025   23.4   0.7   13   75-87     27-39  (39)
 26 smart00451 ZnF_U1 U1-like zinc  41.6     7.1 0.00015   22.5  -0.4   20   75-94      2-21  (35)
 27 PF00220 Hormone_4:  Neurohypop  37.9      13 0.00029   17.5   0.3    7   34-40      2-8   (9)
 28 PF00096 zf-C2H2:  Zinc finger,  37.6       7 0.00015   20.7  -0.8   16   77-92      1-16  (23)
 29 TIGR00100 hypA hydrogenase nic  37.5      22 0.00047   26.8   1.6   49   50-105    43-95  (115)
 30 PF13240 zinc_ribbon_2:  zinc-r  37.1      19 0.00041   20.4   0.9   22   79-106     2-23  (23)
 31 TIGR00373 conserved hypothetic  36.8      13 0.00028   29.4   0.3   34   76-110   109-142 (158)
 32 smart00440 ZnF_C2C2 C2C2 Zinc   35.6      21 0.00045   22.4   1.0   24   55-87     16-39  (40)
 33 PF12874 zf-met:  Zinc-finger o  34.8     8.3 0.00018   20.8  -0.8   17   77-93      1-17  (25)
 34 PRK06266 transcription initiat  34.4      16 0.00036   29.5   0.5   34   76-110   117-150 (178)
 35 PRK00481 NAD-dependent deacety  33.3      26 0.00056   28.9   1.5   39   73-111   119-157 (242)
 36 PF13717 zinc_ribbon_4:  zinc-r  33.2      24 0.00052   21.7   1.0   12   76-87     25-36  (36)
 37 PRK00736 hypothetical protein;  33.0      30 0.00066   24.0   1.6   22    2-23     45-68  (68)
 38 PF13912 zf-C2H2_6:  C2H2-type   32.2     9.8 0.00021   20.9  -0.8   17   77-93      2-18  (27)
 39 PRK12496 hypothetical protein;  31.7      34 0.00073   27.3   1.9   27   76-106   127-153 (164)
 40 PF11827 DUF3347:  Protein of u  29.9      37 0.00081   27.2   1.9   30   32-70    133-164 (174)
 41 PRK00564 hypA hydrogenase nick  29.8      38 0.00081   25.6   1.8   31   72-105    67-97  (117)
 42 PRK12380 hydrogenase nickel in  29.6      31 0.00068   25.9   1.3   49   50-105    43-95  (113)
 43 PF13719 zinc_ribbon_5:  zinc-r  29.1      31 0.00067   21.2   1.0   13   75-87     24-36  (37)
 44 COG3791 Uncharacterized conser  28.6      19 0.00042   27.5   0.0   14   97-110    70-83  (133)
 45 COG1594 RPB9 DNA-directed RNA   28.6      29 0.00062   26.3   1.0   27   53-88     86-112 (113)
 46 KOG4400|consensus               27.8      41 0.00088   28.0   1.8   18   23-40    144-161 (261)
 47 PF14311 DUF4379:  Domain of un  26.3      38 0.00082   22.0   1.1   27   76-102    28-55  (55)
 48 PF14787 zf-CCHC_5:  GAG-polypr  26.1      29 0.00062   22.3   0.5   18   23-40      3-20  (36)
 49 TIGR02098 MJ0042_CXXC MJ0042 f  26.1      38 0.00081   20.2   1.0   13   75-87     24-36  (38)
 50 cd02336 ZZ_RSC8 Zinc finger, Z  25.0      21 0.00046   23.3  -0.3   16   21-36     22-37  (45)
 51 PF09538 FYDLN_acid:  Protein o  24.0      38 0.00083   25.7   0.9   23   95-117     8-30  (108)
 52 COG4332 Uncharacterized protei  24.0      51  0.0011   28.1   1.7   52   13-87      8-60  (203)
 53 PF04828 GFA:  Glutathione-depe  23.3      30 0.00065   23.0   0.2   13   97-109    49-61  (92)
 54 PRK00295 hypothetical protein;  23.1      53  0.0012   22.8   1.4   22    2-23     45-68  (68)
 55 PHA00732 hypothetical protein   22.6      22 0.00049   25.4  -0.5   31   77-107     2-38  (79)
 56 KOG4602|consensus               22.5      42 0.00092   30.1   1.0   22   22-43    268-292 (318)
 57 smart00531 TFIIE Transcription  22.2      32 0.00068   26.6   0.2   35   76-110    99-137 (147)
 58 PF06836 DUF1240:  Protein of u  21.3      61  0.0013   24.3   1.5   27   72-100    69-95  (95)
 59 PF01155 HypA:  Hydrogenase exp  20.1      41 0.00088   25.1   0.4   49   50-105    43-95  (113)
 60 smart00291 ZnF_ZZ Zinc-binding  20.1 1.2E+02  0.0025   19.0   2.5   34   96-141     4-37  (44)

No 1  
>PF13695 zf-3CxxC:  Zinc-binding domain
Probab=99.58  E-value=1.2e-15  Score=111.60  Aligned_cols=68  Identities=37%  Similarity=0.719  Sum_probs=55.0

Q ss_pred             cceeeeecccCcCccccceEEec-------------ccccccccCccccceeeec---cc-------------CCCCCCC
Q psy12393         72 RCFGEYKCSKCKRKWMSGNSWAN-------------MGQECIKCNINVYPHKQRP---LE-------------KPDGLDV  122 (155)
Q Consensus        72 R~fG~F~Ck~C~~~WsSaNsWan-------------~gQ~C~kC~~~vyPyrq~~---l~-------------~~~k~~~  122 (155)
                      +.||.|+|+.|++.|+|++||.+             .+|.|++|+...+|+..++   ++             .+.....
T Consensus         1 ~~~grF~C~~C~~~W~S~~v~i~f~~~~~g~v~~rv~~Q~C~~C~~~~~P~~~e~~~lv~ri~~~~y~~~~~~~~~~~~~   80 (98)
T PF13695_consen    1 NAFGRFQCSKCSRGWTSAKVWILFHMYRGGQVNMRVFGQRCKKCNPLERPYFSEEQNLVERIRYRCYGWAGIQVEEPRIS   80 (98)
T ss_pred             CcEEEEECCCCCCCCccCEEEEEEEEcCCCeEEEEEECCCCCCCCCCCCccCcccccHHHHHHHHHhcccCCccCcCccc
Confidence            47999999999999999999999             7999999999999999543   21             1111223


Q ss_pred             CCCCCCChhhhhHHHhh
Q psy12393        123 SDQSKVHPMYLCEKCKQ  139 (155)
Q Consensus       123 ~d~krPHpQ~LCgkCK~  139 (155)
                      .+..+||.++|||.|++
T Consensus        81 ~~~~~pH~~~lCE~C~~   97 (98)
T PF13695_consen   81 GKSTGPHESELCEACKQ   97 (98)
T ss_pred             CCCCCCCChhhChhhcC
Confidence            34479999999999986


No 2  
>PF13696 zf-CCHC_2:  Zinc knuckle
Probab=99.50  E-value=8.2e-15  Score=90.75  Aligned_cols=26  Identities=50%  Similarity=1.150  Sum_probs=24.8

Q ss_pred             cCCCCCCceeeeeccCCCcccccCCC
Q psy12393         15 SFKQPPSAYLCHLCFVGGHYITDCPL   40 (155)
Q Consensus        15 ~~~~pp~~y~ch~c~~~ghyi~dcp~   40 (155)
                      |+++||++|+||+|+++||||+|||+
T Consensus         1 ~~k~pP~~Y~C~~C~~~GH~i~dCP~   26 (32)
T PF13696_consen    1 PRKKPPPGYVCHRCGQKGHWIQDCPT   26 (32)
T ss_pred             CCCCCCCCCEeecCCCCCccHhHCCC
Confidence            57899999999999999999999997


No 3  
>COG5222 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only]
Probab=98.48  E-value=5.7e-08  Score=86.57  Aligned_cols=40  Identities=35%  Similarity=0.672  Sum_probs=36.2

Q ss_pred             cccCCCCCCceeeeeccCCCcccccCCCCCCCchhhHhhh
Q psy12393         13 KKSFKQPPSAYLCHLCFVGGHYITDCPLFNMSPFSKYRQL   52 (155)
Q Consensus        13 ~~~~~~pp~~y~ch~c~~~ghyi~dcp~~~~~~~~~~r~~   52 (155)
                      .+.-++|||+|+|-+|+++||||+.||||.++-||-+|-+
T Consensus       167 q~~~kppPpgY~CyRCGqkgHwIqnCpTN~DpnfdgkRir  206 (427)
T COG5222         167 QKHNKPPPPGYVCYRCGQKGHWIQNCPTNQDPNFDGKRIR  206 (427)
T ss_pred             ccCCCCCCCceeEEecCCCCchhhcCCCCCCCCccceeee
Confidence            4567899999999999999999999999999999988743


No 4  
>PF00098 zf-CCHC:  Zinc knuckle;  InterPro: IPR001878 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents the CysCysHisCys (CCHC) type zinc finger domains, and have the sequence:  C-X2-C-X4-H-X4-C  where X can be any amino acid, and number indicates the number of residues. These 18 residues CCHC zinc finger domains are mainly found in the nucleocapsid protein of retroviruses. It is required for viral genome packaging and for early infection process [, , ]. It is also found in eukaryotic proteins involved in RNA binding or single-stranded DNA binding []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003676 nucleic acid binding, 0008270 zinc ion binding; PDB: 2L44_A 1A1T_A 1WWG_A 1U6P_A 1WWD_A 1WWE_A 1A6B_B 1F6U_A 1MFS_A 1NCP_C ....
Probab=96.52  E-value=0.001  Score=36.11  Aligned_cols=16  Identities=44%  Similarity=0.912  Sum_probs=15.2

Q ss_pred             eeeeccCCCcccccCC
Q psy12393         24 LCHLCFVGGHYITDCP   39 (155)
Q Consensus        24 ~ch~c~~~ghyi~dcp   39 (155)
                      .|..|.+.||+..|||
T Consensus         2 ~C~~C~~~GH~~~~Cp   17 (18)
T PF00098_consen    2 KCFNCGEPGHIARDCP   17 (18)
T ss_dssp             BCTTTSCSSSCGCTSS
T ss_pred             cCcCCCCcCcccccCc
Confidence            5899999999999999


No 5  
>KOG0314|consensus
Probab=96.06  E-value=0.0027  Score=58.47  Aligned_cols=34  Identities=29%  Similarity=0.545  Sum_probs=30.1

Q ss_pred             CCCCceeeeeccCCCcccccCCCCCCCchhhHhh
Q psy12393         18 QPPSAYLCHLCFVGGHYITDCPLFNMSPFSKYRQ   51 (155)
Q Consensus        18 ~pp~~y~ch~c~~~ghyi~dcp~~~~~~~~~~r~   51 (155)
                      .|||.|.|-+|-++||+|+-|||+....++..+-
T Consensus       154 ~Pppsy~c~rc~~~g~wikacptv~~~~~~~~~~  187 (448)
T KOG0314|consen  154 SPPPSYKCVKCPTPGPWIKACPTVSGSYSLPSGT  187 (448)
T ss_pred             CCCCCcceecCCCCCccceeccccCCcccccCCc
Confidence            4999999999999999999999988888865553


No 6  
>PF13917 zf-CCHC_3:  Zinc knuckle
Probab=95.68  E-value=0.0058  Score=39.83  Aligned_cols=32  Identities=28%  Similarity=0.611  Sum_probs=26.0

Q ss_pred             ceeeeeccCCCcccccCCCCCCCchhhHhhhhhhhcCCCCC
Q psy12393         22 AYLCHLCFVGGHYITDCPLFNMSPFSKYRQLFLFQARPKGE   62 (155)
Q Consensus        22 ~y~ch~c~~~ghyi~dcp~~~~~~~~~~r~~~~~~~rp~~~   62 (155)
                      .-+|..|++.||+..+||..+.-+|         .+||.+.
T Consensus         4 ~~~CqkC~~~GH~tyeC~~~~~r~y---------~~RpSrt   35 (42)
T PF13917_consen    4 RVRCQKCGQKGHWTYECPNKNERKY---------TSRPSRT   35 (42)
T ss_pred             CCcCcccCCCCcchhhCCCCCCccc---------ccCCCHH
Confidence            4579999999999999997556666         7787654


No 7  
>PF15135 UPF0515:  Uncharacterised protein UPF0515
Probab=95.26  E-value=0.0092  Score=52.14  Aligned_cols=40  Identities=30%  Similarity=0.764  Sum_probs=34.0

Q ss_pred             ceeeeecccCcCccccceEEecc--cccccccCccccceeeeccc
Q psy12393         73 CFGEYKCSKCKRKWMSGNSWANM--GQECIKCNINVYPHKQRPLE  115 (155)
Q Consensus        73 ~fG~F~Ck~C~~~WsSaNsWan~--gQ~C~kC~~~vyPyrq~~l~  115 (155)
                      -+|+|+|.+|++.|.   .|+-+  .+-|..|+..|||+++.|-.
T Consensus       152 G~aef~C~~C~h~F~---G~~qm~v~sPCy~C~~~v~P~~IlPPr  193 (278)
T PF15135_consen  152 GIAEFHCPKCRHNFR---GFAQMGVPSPCYGCGNPVYPSRILPPR  193 (278)
T ss_pred             ceeeeecccccccch---hhhhcCCCCCccCCCCccCcccccCCC
Confidence            467999999999998   45555  58999999999999998743


No 8  
>smart00343 ZnF_C2HC zinc finger.
Probab=85.76  E-value=0.35  Score=27.34  Aligned_cols=17  Identities=41%  Similarity=0.796  Sum_probs=15.1

Q ss_pred             eeeeccCCCcccccCCC
Q psy12393         24 LCHLCFVGGHYITDCPL   40 (155)
Q Consensus        24 ~ch~c~~~ghyi~dcp~   40 (155)
                      .|-.|.+.||+..+||.
T Consensus         1 ~C~~CG~~GH~~~~C~~   17 (26)
T smart00343        1 KCYNCGKEGHIARDCPK   17 (26)
T ss_pred             CCccCCCCCcchhhCCc
Confidence            47889999999999993


No 9  
>smart00834 CxxC_CXXC_SSSS Putative regulatory protein. CxxC_CXXC_SSSS represents a region of about 41 amino acids found in a number of small proteins in a wide range of bacteria. The region usually begins with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One protein in this entry has been noted as a putative regulatory protein, designated FmdB. Most proteins in this entry have a C-terminal region containing highly degenerate sequence.
Probab=83.23  E-value=1  Score=27.06  Aligned_cols=30  Identities=20%  Similarity=0.540  Sum_probs=22.3

Q ss_pred             eeecccCcCccccceEEe-cccccccccCcc
Q psy12393         76 EYKCSKCKRKWMSGNSWA-NMGQECIKCNIN  105 (155)
Q Consensus        76 ~F~Ck~C~~~WsSaNsWa-n~gQ~C~kC~~~  105 (155)
                      +|+|..|+..|+-.-+.. ...-.|-.|+..
T Consensus         5 ~y~C~~Cg~~fe~~~~~~~~~~~~CP~Cg~~   35 (41)
T smart00834        5 EYRCEDCGHTFEVLQKISDDPLATCPECGGD   35 (41)
T ss_pred             EEEcCCCCCEEEEEEecCCCCCCCCCCCCCc
Confidence            589999999998544443 445679999873


No 10 
>COG5082 AIR1 Arginine methyltransferase-interacting protein, contains RING Zn-finger [Posttranslational modification, protein turnover, chaperones / Intracellular trafficking and secretion]
Probab=75.42  E-value=1.2  Score=37.32  Aligned_cols=22  Identities=32%  Similarity=0.647  Sum_probs=18.4

Q ss_pred             CCCCceeeeeccCCCcccccCC
Q psy12393         18 QPPSAYLCHLCFVGGHYITDCP   39 (155)
Q Consensus        18 ~pp~~y~ch~c~~~ghyi~dcp   39 (155)
                      ..=.+=.|+.|.+.||.+.|||
T Consensus        56 ~~~~~~~C~nCg~~GH~~~DCP   77 (190)
T COG5082          56 IREENPVCFNCGQNGHLRRDCP   77 (190)
T ss_pred             ccccccccchhcccCcccccCC
Confidence            3344557999999999999999


No 11 
>TIGR02605 CxxC_CxxC_SSSS putative regulatory protein, FmdB family. This model represents a region of about 50 amino acids found in a number of small proteins in a wide range of bacteria. The region begins usually with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One member of this family is has been noted as a putative regulatory protein, designated FmdB (PubMed:8841393). Most members of this family have a C-terminal region containing highly degenerate sequence, such as SSTSESTKSSGSSGSSGSSESKASGSTEKSTSSTTAAAAV in Mycobacterium tuberculosis and VAVGGSAPAPSPAPRAGGGGGGCCGGGCCG in Streptomyces avermitilis. These low complexity regions, which are not included in the model, resemble low-complexity C-terminal regions of some heterocycle-containing bacteriocin precursors.
Probab=72.23  E-value=3.6  Score=26.20  Aligned_cols=29  Identities=21%  Similarity=0.576  Sum_probs=19.1

Q ss_pred             eeecccCcCccccceEEe-cccccccccCc
Q psy12393         76 EYKCSKCKRKWMSGNSWA-NMGQECIKCNI  104 (155)
Q Consensus        76 ~F~Ck~C~~~WsSaNsWa-n~gQ~C~kC~~  104 (155)
                      +|+|.+|+.+++.-.+.. ...-.|-.|+.
T Consensus         5 ey~C~~Cg~~fe~~~~~~~~~~~~CP~Cg~   34 (52)
T TIGR02605         5 EYRCTACGHRFEVLQKMSDDPLATCPECGG   34 (52)
T ss_pred             EEEeCCCCCEeEEEEecCCCCCCCCCCCCC
Confidence            689999999776221111 12347999996


No 12 
>KOG4400|consensus
Probab=69.64  E-value=3.6  Score=34.28  Aligned_cols=21  Identities=43%  Similarity=0.703  Sum_probs=17.2

Q ss_pred             CceeeeeccCCCcccccCCCC
Q psy12393         21 SAYLCHLCFVGGHYITDCPLF   41 (155)
Q Consensus        21 ~~y~ch~c~~~ghyi~dcp~~   41 (155)
                      ..=.|-.|.+.||++.|||.-
T Consensus        91 ~~~~c~~C~~~gH~~~~c~~~  111 (261)
T KOG4400|consen   91 IAAACFNCGEGGHIERDCPEA  111 (261)
T ss_pred             cchhhhhCCCCccchhhCCcc
Confidence            455788899999999999953


No 13 
>smart00659 RPOLCX RNA polymerase subunit CX. present in RNA polymerase I, II and III
Probab=68.59  E-value=4.9  Score=26.03  Aligned_cols=33  Identities=24%  Similarity=0.511  Sum_probs=26.6

Q ss_pred             eeecccCcCccccceEEecccccccccCccccceeee
Q psy12393         76 EYKCSKCKRKWMSGNSWANMGQECIKCNINVYPHKQR  112 (155)
Q Consensus        76 ~F~Ck~C~~~WsSaNsWan~gQ~C~kC~~~vyPyrq~  112 (155)
                      .|.|..|+.+++..   ....-.|..|+..|. |+.+
T Consensus         2 ~Y~C~~Cg~~~~~~---~~~~irC~~CG~rIl-yK~R   34 (44)
T smart00659        2 IYICGECGRENEIK---SKDVVRCRECGYRIL-YKKR   34 (44)
T ss_pred             EEECCCCCCEeecC---CCCceECCCCCceEE-EEeC
Confidence            58999999999865   467899999998776 5554


No 14 
>KOG0314|consensus
Probab=63.90  E-value=4.5  Score=37.79  Aligned_cols=35  Identities=34%  Similarity=0.718  Sum_probs=31.5

Q ss_pred             CCCCCceeeeeccCCCcccccCCCCCCCchhhHhh
Q psy12393         17 KQPPSAYLCHLCFVGGHYITDCPLFNMSPFSKYRQ   51 (155)
Q Consensus        17 ~~pp~~y~ch~c~~~ghyi~dcp~~~~~~~~~~r~   51 (155)
                      .++++.|.||+|-.+||.|+-|.++-.+|++..+-
T Consensus       128 ~t~~~~~~~~~~~~~~~~iq~~~~~g~Pppsy~c~  162 (448)
T KOG0314|consen  128 QTPPPGYVCHRCNSPGHFIQHCSTNGSPPPSYKCV  162 (448)
T ss_pred             CCCcccceeeecccCccccccccccCCCCCCccee
Confidence            38999999999999999999999999999877653


No 15 
>PF09723 Zn-ribbon_8:  Zinc ribbon domain;  InterPro: IPR013429  This entry represents a region of about 41 amino acids found in a number of small proteins in a wide range of bacteria. The region usually begins with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One protein in this entry has been noted as a putative regulatory protein, designated FmdB []. Most proteins in this entry have a C-terminal region containing highly degenerate sequence.
Probab=63.03  E-value=6.8  Score=24.67  Aligned_cols=29  Identities=24%  Similarity=0.614  Sum_probs=20.6

Q ss_pred             eeecccCcCccccceEEe-cccccccccCc
Q psy12393         76 EYKCSKCKRKWMSGNSWA-NMGQECIKCNI  104 (155)
Q Consensus        76 ~F~Ck~C~~~WsSaNsWa-n~gQ~C~kC~~  104 (155)
                      +|+|.+|+..++---+-+ .....|-.|+.
T Consensus         5 ey~C~~Cg~~fe~~~~~~~~~~~~CP~Cg~   34 (42)
T PF09723_consen    5 EYRCEECGHEFEVLQSISEDDPVPCPECGS   34 (42)
T ss_pred             EEEeCCCCCEEEEEEEcCCCCCCcCCCCCC
Confidence            699999998776332222 24678999986


No 16 
>PTZ00368 universal minicircle sequence binding protein (UMSBP); Provisional
Probab=57.43  E-value=4.7  Score=30.73  Aligned_cols=19  Identities=37%  Similarity=0.625  Sum_probs=16.6

Q ss_pred             ceeeeeccCCCcccccCCC
Q psy12393         22 AYLCHLCFVGGHYITDCPL   40 (155)
Q Consensus        22 ~y~ch~c~~~ghyi~dcp~   40 (155)
                      .-.|.+|.+.|||-.|||.
T Consensus       103 ~~~C~~Cg~~gH~~~~C~~  121 (148)
T PTZ00368        103 RRACYNCGGEGHISRDCPN  121 (148)
T ss_pred             chhhcccCcCCcchhcCCC
Confidence            3479999999999999994


No 17 
>PF05741 zf-nanos:  Nanos RNA binding domain;  InterPro: IPR024161 Nanos is a highly conserved RNA-binding protein in higher eukaryotes and functions as a key regulatory protein in translational control using a 3' untranslated region during the development and maintenance of germ cells. Nanos comprises a non-conserved amino-terminus and highly conserved carboxy- terminal regions. The C-terminal region has two conserved Cys-Cys-His-Cys (CCHC)-type zinc-finger motifs that are indispensable for nanos function [, , ]. The structure of the nanos-type zinc finger is composed of two independent zinc-finger (ZF) lobes, the N-terminal ZF1 and the C-terminal ZF2, which are connected by a linker helix []. These lobes create a large cleft. Zinc ions in ZF1 and ZF2 are bound to the CCHC motif by tetrahedral coordination.; PDB: 3ALR_B.
Probab=56.82  E-value=4.3  Score=27.86  Aligned_cols=20  Identities=40%  Similarity=0.889  Sum_probs=8.7

Q ss_pred             ceeeeeccCCC---cccccCCCC
Q psy12393         22 AYLCHLCFVGG---HYITDCPLF   41 (155)
Q Consensus        22 ~y~ch~c~~~g---hyi~dcp~~   41 (155)
                      .|.|.+|+..|   |-|+-||++
T Consensus        33 ~y~Cp~CgAtGd~AHT~~yCP~k   55 (55)
T PF05741_consen   33 KYVCPICGATGDNAHTIKYCPKK   55 (55)
T ss_dssp             G---TTT---GGG---GGG-TT-
T ss_pred             cCcCCCCcCcCccccccccCcCC
Confidence            69999999965   799999963


No 18 
>PTZ00368 universal minicircle sequence binding protein (UMSBP); Provisional
Probab=50.84  E-value=7.4  Score=29.63  Aligned_cols=18  Identities=33%  Similarity=0.621  Sum_probs=15.8

Q ss_pred             eeeeccCCCcccccCCCC
Q psy12393         24 LCHLCFVGGHYITDCPLF   41 (155)
Q Consensus        24 ~ch~c~~~ghyi~dcp~~   41 (155)
                      +|..|.+.||+-.|||+.
T Consensus         2 ~C~~C~~~GH~~~~c~~~   19 (148)
T PTZ00368          2 VCYRCGGVGHQSRECPNS   19 (148)
T ss_pred             cCCCCCCCCcCcccCcCC
Confidence            689999999999999963


No 19 
>PF11682 DUF3279:  Protein of unknown function (DUF3279);  InterPro: IPR021696  This family of proteins with unknown function appears to be restricted to Enterobacteriaceae. 
Probab=48.04  E-value=23  Score=27.92  Aligned_cols=78  Identities=21%  Similarity=0.497  Sum_probs=50.3

Q ss_pred             cccCCCCCCceeeeeccCCC----------------------cccccCCCCCCCchhhHh------hhhhhhcCCCCCCC
Q psy12393         13 KKSFKQPPSAYLCHLCFVGG----------------------HYITDCPLFNMSPFSKYR------QLFLFQARPKGEGL   64 (155)
Q Consensus        13 ~~~~~~pp~~y~ch~c~~~g----------------------hyi~dcp~~~~~~~~~~r------~~~~~~~rp~~~~~   64 (155)
                      +..+..|=-.|-||.|.-+=                      |-...||  .-+|-+|.+      ++++-.+.|..   
T Consensus        19 ~~a~~~~~~~~tC~~Cg~~L~lh~~~~~~~pWFEH~~~~~~~~~l~~C~--yl~pe~k~~~ri~~L~~~i~~~~pv~---   93 (128)
T PF11682_consen   19 RTAASAPYDHWTCHSCGCPLILHPGTDTEPPWFEHDQHSLAENGLMQCP--YLDPEEKERRRIKRLRRMIADLDPVP---   93 (128)
T ss_pred             hhhhhCCCCeEEEecCCceEEEecCCcCCCCccccCccccChhhcccCc--eECcccchHHHHHHHHHhccccCCCC---
Confidence            33445566789999996442                      3345577  455555555      33444444332   


Q ss_pred             CCCCCcccceeeeecccCcCccccceEEecccccccccCcccccee
Q psy12393         65 TPYQGKKRCFGEYKCSKCKRKWMSGNSWANMGQECIKCNINVYPHK  110 (155)
Q Consensus        65 TPyQg~kR~fG~F~Ck~C~~~WsSaNsWan~gQ~C~kC~~~vyPyr  110 (155)
                              .--..+|-.|++.|..-       ..|.+|++.||.--
T Consensus        94 --------~~~~W~Cv~C~~~Y~Ge-------K~C~~C~tGiYS~e  124 (128)
T PF11682_consen   94 --------RKTDWHCVMCGNHYHGE-------KYCPKCGTGIYSIE  124 (128)
T ss_pred             --------cCceEEEecCCCccCcC-------EecCCCCCccccee
Confidence                    22468999999999842       68999999998643


No 20 
>PF14392 zf-CCHC_4:  Zinc knuckle
Probab=46.97  E-value=7.6  Score=25.01  Aligned_cols=17  Identities=35%  Similarity=0.751  Sum_probs=15.7

Q ss_pred             eeeeeccCCCcccccCC
Q psy12393         23 YLCHLCFVGGHYITDCP   39 (155)
Q Consensus        23 y~ch~c~~~ghyi~dcp   39 (155)
                      ..|-.|..-||-..+||
T Consensus        32 ~~C~~C~~~gH~~~~C~   48 (49)
T PF14392_consen   32 RFCFHCGRIGHSDKECP   48 (49)
T ss_pred             hhhcCCCCcCcCHhHcC
Confidence            35999999999999998


No 21 
>PF13894 zf-C2H2_4:  C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A ....
Probab=46.72  E-value=4.7  Score=20.69  Aligned_cols=17  Identities=18%  Similarity=0.636  Sum_probs=11.3

Q ss_pred             eecccCcCccccceEEe
Q psy12393         77 YKCSKCKRKWMSGNSWA   93 (155)
Q Consensus        77 F~Ck~C~~~WsSaNsWa   93 (155)
                      |.|..|+....+..+|.
T Consensus         1 ~~C~~C~~~~~~~~~l~   17 (24)
T PF13894_consen    1 FQCPICGKSFRSKSELR   17 (24)
T ss_dssp             EE-SSTS-EESSHHHHH
T ss_pred             CCCcCCCCcCCcHHHHH
Confidence            78999998888766543


No 22 
>PF12171 zf-C2H2_jaz:  Zinc-finger double-stranded RNA-binding;  InterPro: IPR022755  This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length. The mammalian members of this group occur multiple times along the protein, joined by flexible linkers, and are referred to as JAZ - dsRNA-binding ZF protein - zinc-fingers. The JAZ proteins are expressed in all tissues tested and localise in the nucleus, particularly the nucleolus []. JAZ preferentially binds to double-stranded (ds) RNA or RNA/DNA hybrids rather than DNA. In addition to binding double-stranded RNA, these zinc-fingers are required for nucleolar localisation.   This entry represents the multiple-adjacent-C2H2 zinc finger, JAZ. ; PDB: 4DGW_A 1ZR9_A.
Probab=46.44  E-value=4.3  Score=22.82  Aligned_cols=18  Identities=22%  Similarity=0.637  Sum_probs=16.1

Q ss_pred             eecccCcCccccceEEec
Q psy12393         77 YKCSKCKRKWMSGNSWAN   94 (155)
Q Consensus        77 F~Ck~C~~~WsSaNsWan   94 (155)
                      |.|..|++...+.++|..
T Consensus         2 ~~C~~C~k~f~~~~~~~~   19 (27)
T PF12171_consen    2 FYCDACDKYFSSENQLKQ   19 (27)
T ss_dssp             CBBTTTTBBBSSHHHHHC
T ss_pred             CCcccCCCCcCCHHHHHH
Confidence            789999999999998865


No 23 
>PRK00398 rpoP DNA-directed RNA polymerase subunit P; Provisional
Probab=46.12  E-value=13  Score=23.44  Aligned_cols=30  Identities=30%  Similarity=0.726  Sum_probs=21.9

Q ss_pred             eeecccCcCccccceEEecccccccccCcccc
Q psy12393         76 EYKCSKCKRKWMSGNSWANMGQECIKCNINVY  107 (155)
Q Consensus        76 ~F~Ck~C~~~WsSaNsWan~gQ~C~kC~~~vy  107 (155)
                      +|+|+.|+..-+....  .+...|..|+..+.
T Consensus         3 ~y~C~~CG~~~~~~~~--~~~~~Cp~CG~~~~   32 (46)
T PRK00398          3 EYKCARCGREVELDEY--GTGVRCPYCGYRIL   32 (46)
T ss_pred             EEECCCCCCEEEECCC--CCceECCCCCCeEE
Confidence            6899999998764322  12789999997665


No 24 
>COG5082 AIR1 Arginine methyltransferase-interacting protein, contains RING Zn-finger [Posttranslational modification, protein turnover, chaperones / Intracellular trafficking and secretion]
Probab=45.32  E-value=9.3  Score=32.09  Aligned_cols=17  Identities=41%  Similarity=0.780  Sum_probs=15.9

Q ss_pred             eeeeeccCCCcccccC-C
Q psy12393         23 YLCHLCFVGGHYITDC-P   39 (155)
Q Consensus        23 y~ch~c~~~ghyi~dc-p   39 (155)
                      -+|-+|++.|||-.|| |
T Consensus        98 ~~C~~Cg~~GH~~~dC~P  115 (190)
T COG5082          98 KKCYNCGETGHLSRDCNP  115 (190)
T ss_pred             cccccccccCccccccCc
Confidence            6899999999999999 5


No 25 
>PF01096 TFIIS_C:  Transcription factor S-II (TFIIS);  InterPro: IPR001222 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents a zinc finger motif found in transcription factor IIs (TFIIS). In eukaryotes the initiation of transcription of protein encoding genes by polymerase II (Pol II) is modulated by general and specific transcription factors. The general transcription factors operate through common promoters elements (such as the TATA box). At least eight different proteins associate to form the general transcription factors: TFIIA, -IIB, -IID, -IIE, -IIF, -IIG, -IIH and -IIS []. During mRNA elongation, Pol II can encounter DNA sequences that cause reverse movement of the enzyme. Such backtracking involves extrusion of the RNA 3'-end into the pore, and can lead to transcriptional arrest. Escape from arrest requires cleavage of the extruded RNA with the help of TFIIS, which induces mRNA cleavage by enhancing the intrinsic nuclease activity of RNA polymerase (Pol) II, past template-encoded pause sites []. TFIIS extends from the polymerase surface via a pore to the internal active site. Two essential and invariant acidic residues in a TFIIS loop complement the Pol II active site and could position a metal ion and a water molecule for hydrolytic RNA cleavage. TFIIS also induces extensive structural changes in Pol II that would realign nucleic acids in the active centre.  TFIIS is a protein of about 300 amino acids. It contains three regions: a variable N-terminal domain not required for TFIIS activity; a conserved central domain required for Pol II binding; and a conserved C-terminal C4-type zinc finger essential for RNA cleavage. The zinc finger folds in a conformation termed a zinc ribbon [] characterised by a three-stranded antiparallel beta-sheet and two beta-hairpins. A backbone model for Pol II-TFIIS complex was obtained from X-ray analysis. It shows that a beta hairpin protrudes from the zinc finger and complements the pol II active site [].  Some viral proteins also contain the TFIIS zinc ribbon C-terminal domain. The Vaccinia virus protein, unlike its eukaryotic homologue, is an integral RNA polymerase subunit rather than a readily separable transcription factor []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003676 nucleic acid binding, 0008270 zinc ion binding, 0006351 transcription, DNA-dependent; PDB: 3M4O_I 3S14_I 2E2J_I 4A3J_I 3HOZ_I 1TWA_I 3S1Q_I 3S1N_I 1TWG_I 3I4M_I ....
Probab=43.22  E-value=11  Score=23.42  Aligned_cols=13  Identities=31%  Similarity=0.933  Sum_probs=10.9

Q ss_pred             eeeecccCcCccc
Q psy12393         75 GEYKCSKCKRKWM   87 (155)
Q Consensus        75 G~F~Ck~C~~~Ws   87 (155)
                      -.|.|.+|+.+|.
T Consensus        27 ~fy~C~~C~~~wr   39 (39)
T PF01096_consen   27 LFYVCCNCGHRWR   39 (39)
T ss_dssp             EEEEESSSTEEEE
T ss_pred             EEEEeCCCCCeeC
Confidence            4689999999994


No 26 
>smart00451 ZnF_U1 U1-like zinc finger. Family of C2H2-type zinc fingers, present in matrin, U1 small nuclear ribonucleoprotein C and other RNA-binding proteins.
Probab=41.55  E-value=7.1  Score=22.47  Aligned_cols=20  Identities=20%  Similarity=0.466  Sum_probs=15.9

Q ss_pred             eeeecccCcCccccceEEec
Q psy12393         75 GEYKCSKCKRKWMSGNSWAN   94 (155)
Q Consensus        75 G~F~Ck~C~~~WsSaNsWan   94 (155)
                      |.|.|..|+....|..+|..
T Consensus         2 ~~~~C~~C~~~~~~~~~~~~   21 (35)
T smart00451        2 GGFYCKLCNVTFTDEISVEA   21 (35)
T ss_pred             cCeEccccCCccCCHHHHHH
Confidence            56889999998887777743


No 27 
>PF00220 Hormone_4:  Neurohypophysial hormones, N-terminal Domain;  InterPro: IPR022423 Oxytocin (or ocytocin) and vasopressin [] are small (nine amino acid residues), structurally and functionally related neurohypophysial peptide hormones. Oxytocin causes contraction of the smooth muscle of the uterus and of the mammary gland while vasopressin has a direct antidiuretic action on the kidney and also causes vasoconstriction of the peripheral vessels. Like the majority of active peptides, both hormones are synthesized as larger protein precursors that are enzymatically converted to their mature forms. Peptides belonging to this family are also found in birds, fish, reptiles and amphibians (mesotocin, isotocin, valitocin, glumitocin, aspargtocin, vasotocin, seritocin, asvatocin, phasvatocin), in worms (annetocin), octopi (cephalotocin), locust (locupressin or neuropeptide F1/F2) and in molluscs (conopressins G and S) [].  The pattern developed to detect this category of peptides spans their entire sequence and includes four invariant amino acid residues.  .; GO: 0005185 neurohypophyseal hormone activity, 0005576 extracellular region
Probab=37.93  E-value=13  Score=17.46  Aligned_cols=7  Identities=57%  Similarity=1.697  Sum_probs=5.9

Q ss_pred             ccccCCC
Q psy12393         34 YITDCPL   40 (155)
Q Consensus        34 yi~dcp~   40 (155)
                      ||..||.
T Consensus         2 ~i~nCP~    8 (9)
T PF00220_consen    2 YIRNCPI    8 (9)
T ss_pred             ccccCCC
Confidence            7999994


No 28 
>PF00096 zf-C2H2:  Zinc finger, C2H2 type;  InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger: #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C], where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter []. This entry represents the classical C2H2 zinc finger domain.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0005622 intracellular; PDB: 2D9H_A 2EPC_A 1SP1_A 1VA3_A 2WBT_B 2ELR_A 2YTP_A 2YTT_A 1VA1_A 2ELO_A ....
Probab=37.59  E-value=7  Score=20.67  Aligned_cols=16  Identities=31%  Similarity=0.800  Sum_probs=11.8

Q ss_pred             eecccCcCccccceEE
Q psy12393         77 YKCSKCKRKWMSGNSW   92 (155)
Q Consensus        77 F~Ck~C~~~WsSaNsW   92 (155)
                      |.|+.|++...+...+
T Consensus         1 y~C~~C~~~f~~~~~l   16 (23)
T PF00096_consen    1 YKCPICGKSFSSKSNL   16 (23)
T ss_dssp             EEETTTTEEESSHHHH
T ss_pred             CCCCCCCCccCCHHHH
Confidence            7899999888765443


No 29 
>TIGR00100 hypA hydrogenase nickel insertion protein HypA. In Hpylori, hypA mutant abolished hydrogenase activity and decrease in urease activity. Nickel supplementation in media restored urease activity and partial hydrogenase activity. HypA probably involved in inserting Ni in enzymes.
Probab=37.49  E-value=22  Score=26.76  Aligned_cols=49  Identities=22%  Similarity=0.274  Sum_probs=31.7

Q ss_pred             hhhhhhhcCCCCCCCCCCCCcc----cceeeeecccCcCccccceEEecccccccccCcc
Q psy12393         50 RQLFLFQARPKGEGLTPYQGKK----RCFGEYKCSKCKRKWMSGNSWANMGQECIKCNIN  105 (155)
Q Consensus        50 r~~~~~~~rp~~~~~TPyQg~k----R~fG~F~Ck~C~~~WsSaNsWan~gQ~C~kC~~~  105 (155)
                      -++|.|-+-   .--|+..|-+    ..-+.++|+.|+..|.....    .-.|-+|+..
T Consensus        43 ~L~faf~~~---~~~t~~ega~L~I~~~p~~~~C~~Cg~~~~~~~~----~~~CP~Cgs~   95 (115)
T TIGR00100        43 QLQFAFEVV---REGTVAEGAKLNIEDEPVECECEDCSEEVSPEID----LYRCPKCHGI   95 (115)
T ss_pred             HHHHHHHHH---hCCCccCCCEEEEEeeCcEEEcccCCCEEecCCc----CccCcCCcCC
Confidence            455666552   1136665532    45688999999998887532    3459999954


No 30 
>PF13240 zinc_ribbon_2:  zinc-ribbon domain
Probab=37.07  E-value=19  Score=20.38  Aligned_cols=22  Identities=18%  Similarity=0.593  Sum_probs=14.0

Q ss_pred             cccCcCccccceEEecccccccccCccc
Q psy12393         79 CSKCKRKWMSGNSWANMGQECIKCNINV  106 (155)
Q Consensus        79 Ck~C~~~WsSaNsWan~gQ~C~kC~~~v  106 (155)
                      |+.|+++=.      ...++|..|+..+
T Consensus         2 Cp~CG~~~~------~~~~fC~~CG~~l   23 (23)
T PF13240_consen    2 CPNCGAEIE------DDAKFCPNCGTPL   23 (23)
T ss_pred             CcccCCCCC------CcCcchhhhCCcC
Confidence            666765543      4467788887653


No 31 
>TIGR00373 conserved hypothetical protein TIGR00373. This family of proteins is, so far, restricted to archaeal genomes. The family appears to be distantly related to the N-terminal region of the eukaryotic transcription initiation factor IIE alpha chain.
Probab=36.80  E-value=13  Score=29.41  Aligned_cols=34  Identities=9%  Similarity=0.256  Sum_probs=27.3

Q ss_pred             eeecccCcCccccceEEecccccccccCcccccee
Q psy12393         76 EYKCSKCKRKWMSGNSWANMGQECIKCNINVYPHK  110 (155)
Q Consensus        76 ~F~Ck~C~~~WsSaNsWan~gQ~C~kC~~~vyPyr  110 (155)
                      +|.|+.|+.+|+.--|-. .+=.|..|+.....+-
T Consensus       109 ~Y~Cp~c~~r~tf~eA~~-~~F~Cp~Cg~~L~~~d  142 (158)
T TIGR00373       109 FFICPNMCVRFTFNEAME-LNFTCPRCGAMLDYLD  142 (158)
T ss_pred             eEECCCCCcEeeHHHHHH-cCCcCCCCCCEeeecc
Confidence            589999999999877765 4788999998865543


No 32 
>smart00440 ZnF_C2C2 C2C2 Zinc finger. Nucleic-acid-binding motif in transcriptional elongation factor TFIIS and RNA polymerases.
Probab=35.61  E-value=21  Score=22.41  Aligned_cols=24  Identities=38%  Similarity=0.836  Sum_probs=17.4

Q ss_pred             hhcCCCCCCCCCCCCcccceeeeecccCcCccc
Q psy12393         55 FQARPKGEGLTPYQGKKRCFGEYKCSKCKRKWM   87 (155)
Q Consensus        55 ~~~rp~~~~~TPyQg~kR~fG~F~Ck~C~~~Ws   87 (155)
                      ++.|..-|+.|-         .|.|.+|+.+|.
T Consensus        16 ~Q~RsaDE~mT~---------fy~C~~C~~~w~   39 (40)
T smart00440       16 LQTRSADEPMTV---------FYVCTKCGHRWR   39 (40)
T ss_pred             EcccCCCCCCeE---------EEEeCCCCCEeC
Confidence            455666665554         578999999996


No 33 
>PF12874 zf-met:  Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A.
Probab=34.85  E-value=8.3  Score=20.79  Aligned_cols=17  Identities=29%  Similarity=0.712  Sum_probs=13.3

Q ss_pred             eecccCcCccccceEEe
Q psy12393         77 YKCSKCKRKWMSGNSWA   93 (155)
Q Consensus        77 F~Ck~C~~~WsSaNsWa   93 (155)
                      |.|..|+....|.+++.
T Consensus         1 ~~C~~C~~~f~s~~~~~   17 (25)
T PF12874_consen    1 FYCDICNKSFSSENSLR   17 (25)
T ss_dssp             EEETTTTEEESSHHHHH
T ss_pred             CCCCCCCCCcCCHHHHH
Confidence            78999998888776654


No 34 
>PRK06266 transcription initiation factor E subunit alpha; Validated
Probab=34.40  E-value=16  Score=29.50  Aligned_cols=34  Identities=15%  Similarity=0.421  Sum_probs=27.8

Q ss_pred             eeecccCcCccccceEEecccccccccCcccccee
Q psy12393         76 EYKCSKCKRKWMSGNSWANMGQECIKCNINVYPHK  110 (155)
Q Consensus        76 ~F~Ck~C~~~WsSaNsWan~gQ~C~kC~~~vyPyr  110 (155)
                      +|.|+.|+.+|+.--|-. .+-.|..|+.....+-
T Consensus       117 ~Y~Cp~C~~rytf~eA~~-~~F~Cp~Cg~~L~~~d  150 (178)
T PRK06266        117 FFFCPNCHIRFTFDEAME-YGFRCPQCGEMLEEYD  150 (178)
T ss_pred             EEECCCCCcEEeHHHHhh-cCCcCCCCCCCCeecc
Confidence            689999999999877653 4678999998877664


No 35 
>PRK00481 NAD-dependent deacetylase; Provisional
Probab=33.30  E-value=26  Score=28.86  Aligned_cols=39  Identities=18%  Similarity=0.352  Sum_probs=29.2

Q ss_pred             ceeeeecccCcCccccceEEecccccccccCccccceee
Q psy12393         73 CFGEYKCSKCKRKWMSGNSWANMGQECIKCNINVYPHKQ  111 (155)
Q Consensus        73 ~fG~F~Ck~C~~~WsSaNsWan~gQ~C~kC~~~vyPyrq  111 (155)
                      .+...+|.+|+..|..........-.|..|+..+.|.-+
T Consensus       119 ~~~~~~C~~C~~~~~~~~~~~~~~p~C~~Cgg~lrP~Vv  157 (242)
T PRK00481        119 SLLRARCTKCGQTYDLDEYLKPEPPRCPKCGGILRPDVV  157 (242)
T ss_pred             CcCceeeCCCCCCcChhhhccCCCCCCCCCCCccCCCeE
Confidence            567789999999887666654444459999888877766


No 36 
>PF13717 zinc_ribbon_4:  zinc-ribbon domain
Probab=33.24  E-value=24  Score=21.68  Aligned_cols=12  Identities=33%  Similarity=0.949  Sum_probs=10.7

Q ss_pred             eeecccCcCccc
Q psy12393         76 EYKCSKCKRKWM   87 (155)
Q Consensus        76 ~F~Ck~C~~~Ws   87 (155)
                      ..+|+.|+..|.
T Consensus        25 ~v~C~~C~~~f~   36 (36)
T PF13717_consen   25 KVRCSKCGHVFF   36 (36)
T ss_pred             EEECCCCCCEeC
Confidence            689999999994


No 37 
>PRK00736 hypothetical protein; Provisional
Probab=33.05  E-value=30  Score=24.02  Aligned_cols=22  Identities=9%  Similarity=0.208  Sum_probs=12.4

Q ss_pred             hhhhhhhcc--cccccCCCCCCce
Q psy12393          2 IVDSLCDLH--LEKKSFKQPPSAY   23 (155)
Q Consensus         2 ~~~~~~~~~--~~~~~~~~pp~~y   23 (155)
                      |++.+.++.  ....+.-.|||+|
T Consensus        45 L~~rl~~~~~~~~~~~~~~~PPHY   68 (68)
T PRK00736         45 LTERFLSLEEQAAPDVPVTKPPHW   68 (68)
T ss_pred             HHHHHHHhccccCCCCCCCCcCCC
Confidence            344555443  2334456789988


No 38 
>PF13912 zf-C2H2_6:  C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B.
Probab=32.23  E-value=9.8  Score=20.87  Aligned_cols=17  Identities=18%  Similarity=0.655  Sum_probs=13.3

Q ss_pred             eecccCcCccccceEEe
Q psy12393         77 YKCSKCKRKWMSGNSWA   93 (155)
Q Consensus        77 F~Ck~C~~~WsSaNsWa   93 (155)
                      |.|..|++.+.+..+|.
T Consensus         2 ~~C~~C~~~F~~~~~l~   18 (27)
T PF13912_consen    2 FECDECGKTFSSLSALR   18 (27)
T ss_dssp             EEETTTTEEESSHHHHH
T ss_pred             CCCCccCCccCChhHHH
Confidence            78999999888766553


No 39 
>PRK12496 hypothetical protein; Provisional
Probab=31.72  E-value=34  Score=27.30  Aligned_cols=27  Identities=26%  Similarity=0.548  Sum_probs=21.2

Q ss_pred             eeecccCcCccccceEEecccccccccCccc
Q psy12393         76 EYKCSKCKRKWMSGNSWANMGQECIKCNINV  106 (155)
Q Consensus        76 ~F~Ck~C~~~WsSaNsWan~gQ~C~kC~~~v  106 (155)
                      .|+|+-|++.+.+..    ..++|..|+..+
T Consensus       127 ~~~C~gC~~~~~~~~----~~~~C~~CG~~~  153 (164)
T PRK12496        127 RKVCKGCKKKYPEDY----PDDVCEICGSPV  153 (164)
T ss_pred             eEECCCCCccccCCC----CCCcCCCCCChh
Confidence            478999999987432    357999999776


No 40 
>PF11827 DUF3347:  Protein of unknown function (DUF3347);  InterPro: IPR021782  This family of proteins are functionally uncharacterised. This protein is found in bacteria. Proteins in this family are typically between 169 to 570 amino acids in length. 
Probab=29.89  E-value=37  Score=27.19  Aligned_cols=30  Identities=23%  Similarity=0.416  Sum_probs=25.9

Q ss_pred             CcccccCCCCCCC--chhhHhhhhhhhcCCCCCCCCCCCCc
Q psy12393         32 GHYITDCPLFNMS--PFSKYRQLFLFQARPKGEGLTPYQGK   70 (155)
Q Consensus        32 ghyi~dcp~~~~~--~~~~~r~~~~~~~rp~~~~~TPyQg~   70 (155)
                      .=|+.-|||-||.  .|         |+....+-.-||-|.
T Consensus       133 ~ly~~~CPMa~~~kGa~---------WLs~~~~I~NPYfG~  164 (174)
T PF11827_consen  133 TLYVQYCPMAFNNKGAY---------WLSDSKEIKNPYFGD  164 (174)
T ss_pred             cEEEEECCCccCCCCCe---------eCCCCCcCcCCCCch
Confidence            4599999998877  78         999999999999885


No 41 
>PRK00564 hypA hydrogenase nickel incorporation protein; Provisional
Probab=29.82  E-value=38  Score=25.60  Aligned_cols=31  Identities=19%  Similarity=0.344  Sum_probs=22.1

Q ss_pred             cceeeeecccCcCccccceEEecccccccccCcc
Q psy12393         72 RCFGEYKCSKCKRKWMSGNSWANMGQECIKCNIN  105 (155)
Q Consensus        72 R~fG~F~Ck~C~~~WsSaNsWan~gQ~C~kC~~~  105 (155)
                      ..-+.++|..|++.|+....   ....|-+|+..
T Consensus        67 ~vp~~~~C~~Cg~~~~~~~~---~~~~CP~Cgs~   97 (117)
T PRK00564         67 DEKVELECKDCSHVFKPNAL---DYGVCEKCHSK   97 (117)
T ss_pred             ecCCEEEhhhCCCccccCCc---cCCcCcCCCCC
Confidence            45688999999998886421   12349999964


No 42 
>PRK12380 hydrogenase nickel incorporation protein HybF; Provisional
Probab=29.57  E-value=31  Score=25.88  Aligned_cols=49  Identities=18%  Similarity=0.152  Sum_probs=31.7

Q ss_pred             hhhhhhhcCCCCCCCCCCCCc----ccceeeeecccCcCccccceEEecccccccccCcc
Q psy12393         50 RQLFLFQARPKGEGLTPYQGK----KRCFGEYKCSKCKRKWMSGNSWANMGQECIKCNIN  105 (155)
Q Consensus        50 r~~~~~~~rp~~~~~TPyQg~----kR~fG~F~Ck~C~~~WsSaNsWan~gQ~C~kC~~~  105 (155)
                      -++|.|-+=   ..-|+.+|-    +..-+.++|..|+..|.....    .-.|-+|+..
T Consensus        43 ~L~f~f~~~---~~~T~~egA~L~I~~vp~~~~C~~Cg~~~~~~~~----~~~CP~Cgs~   95 (113)
T PRK12380         43 AVRFSFEIV---CHGTVAQGCDLHIVYKPAQAWCWDCSQVVEIHQH----DAQCPHCHGE   95 (113)
T ss_pred             HHHHHHHHH---hCCCccCCCEEEEEeeCcEEEcccCCCEEecCCc----CccCcCCCCC
Confidence            456666542   123677664    346789999999988886531    1239999953


No 43 
>PF13719 zinc_ribbon_5:  zinc-ribbon domain
Probab=29.13  E-value=31  Score=21.18  Aligned_cols=13  Identities=23%  Similarity=0.721  Sum_probs=11.3

Q ss_pred             eeeecccCcCccc
Q psy12393         75 GEYKCSKCKRKWM   87 (155)
Q Consensus        75 G~F~Ck~C~~~Ws   87 (155)
                      +..+|+.|+..|.
T Consensus        24 ~~vrC~~C~~~f~   36 (37)
T PF13719_consen   24 RKVRCPKCGHVFR   36 (37)
T ss_pred             cEEECCCCCcEee
Confidence            5789999999985


No 44 
>COG3791 Uncharacterized conserved protein [Function unknown]
Probab=28.62  E-value=19  Score=27.46  Aligned_cols=14  Identities=14%  Similarity=0.351  Sum_probs=10.8

Q ss_pred             ccccccCcccccee
Q psy12393         97 QECIKCNINVYPHK  110 (155)
Q Consensus        97 Q~C~kC~~~vyPyr  110 (155)
                      .+|..|++.++=..
T Consensus        70 ~FC~~CGs~l~~~~   83 (133)
T COG3791          70 GFCPTCGSPLFWRG   83 (133)
T ss_pred             eecccCCCceEEec
Confidence            79999997776443


No 45 
>COG1594 RPB9 DNA-directed RNA polymerase, subunit M/Transcription elongation factor TFIIS [Transcription]
Probab=28.57  E-value=29  Score=26.35  Aligned_cols=27  Identities=33%  Similarity=0.737  Sum_probs=21.3

Q ss_pred             hhhhcCCCCCCCCCCCCcccceeeeecccCcCcccc
Q psy12393         53 FLFQARPKGEGLTPYQGKKRCFGEYKCSKCKRKWMS   88 (155)
Q Consensus        53 ~~~~~rp~~~~~TPyQg~kR~fG~F~Ck~C~~~WsS   88 (155)
                      |+++.|---|+.|-         .|.|..|+++|..
T Consensus        86 ~~~QtRsaDEp~T~---------Fy~C~~Cg~~wre  112 (113)
T COG1594          86 WQLQTRSADEPETR---------FYKCTRCGYRWRE  112 (113)
T ss_pred             EeeehhccCCCceE---------EEEecccCCEeec
Confidence            66777877777776         3789999999963


No 46 
>KOG4400|consensus
Probab=27.85  E-value=41  Score=28.02  Aligned_cols=18  Identities=39%  Similarity=0.693  Sum_probs=15.9

Q ss_pred             eeeeeccCCCcccccCCC
Q psy12393         23 YLCHLCFVGGHYITDCPL   40 (155)
Q Consensus        23 y~ch~c~~~ghyi~dcp~   40 (155)
                      =.|=.|++.||+..|||.
T Consensus       144 ~~Cy~Cg~~GH~s~~C~~  161 (261)
T KOG4400|consen  144 AKCYSCGEQGHISDDCPE  161 (261)
T ss_pred             CccCCCCcCCcchhhCCC
Confidence            449999999999999995


No 47 
>PF14311 DUF4379:  Domain of unknown function (DUF4379)
Probab=26.35  E-value=38  Score=21.95  Aligned_cols=27  Identities=30%  Similarity=0.762  Sum_probs=17.6

Q ss_pred             eeecccCcCccccceEEe-ccccccccc
Q psy12393         76 EYKCSKCKRKWMSGNSWA-NMGQECIKC  102 (155)
Q Consensus        76 ~F~Ck~C~~~WsSaNsWa-n~gQ~C~kC  102 (155)
                      .++|+.|+.+|.+.=+-- ..+..|-.|
T Consensus        28 ~W~C~~Cgh~w~~~v~~R~~~~~~CP~C   55 (55)
T PF14311_consen   28 WWKCPKCGHEWKASVNDRTRRGKGCPYC   55 (55)
T ss_pred             EEECCCCCCeeEccHhhhccCCCCCCCC
Confidence            589999999998643222 345556544


No 48 
>PF14787 zf-CCHC_5:  GAG-polyprotein viral zinc-finger; PDB: 1CL4_A 1DSV_A.
Probab=26.13  E-value=29  Score=22.28  Aligned_cols=18  Identities=33%  Similarity=0.670  Sum_probs=11.6

Q ss_pred             eeeeeccCCCcccccCCC
Q psy12393         23 YLCHLCFVGGHYITDCPL   40 (155)
Q Consensus        23 y~ch~c~~~ghyi~dcp~   40 (155)
                      =+|.+|.+..|.-+||=.
T Consensus         3 ~~CprC~kg~Hwa~~C~s   20 (36)
T PF14787_consen    3 GLCPRCGKGFHWASECRS   20 (36)
T ss_dssp             -C-TTTSSSCS-TTT---
T ss_pred             ccCcccCCCcchhhhhhh
Confidence            379999999999999974


No 49 
>TIGR02098 MJ0042_CXXC MJ0042 family finger-like domain. This domain contains a CXXCX(19)CXXC motif suggestive of both zinc fingers and thioredoxin, usually found at the N-terminus of prokaryotic proteins. One partially characterized gene, agmX, is among a large set in Myxococcus whose interruption affects adventurous gliding motility.
Probab=26.07  E-value=38  Score=20.21  Aligned_cols=13  Identities=38%  Similarity=1.224  Sum_probs=11.0

Q ss_pred             eeeecccCcCccc
Q psy12393         75 GEYKCSKCKRKWM   87 (155)
Q Consensus        75 G~F~Ck~C~~~Ws   87 (155)
                      +.++|+.|+..|.
T Consensus        24 ~~v~C~~C~~~~~   36 (38)
T TIGR02098        24 GKVRCGKCGHVWY   36 (38)
T ss_pred             CEEECCCCCCEEE
Confidence            3789999999885


No 50 
>cd02336 ZZ_RSC8 Zinc finger, ZZ type. Zinc finger present in RSC8 and related proteins. RSC8 is a component of the RSC complex, which is closely related to the SWI/SNF complex and is involved in remodeling chromatin structure. The ZZ motif coordinates a zinc ion and most likely participates in ligand binding or molecular scaffolding.
Probab=25.00  E-value=21  Score=23.27  Aligned_cols=16  Identities=25%  Similarity=0.686  Sum_probs=13.2

Q ss_pred             CceeeeeccCCCcccc
Q psy12393         21 SAYLCHLCFVGGHYIT   36 (155)
Q Consensus        21 ~~y~ch~c~~~ghyi~   36 (155)
                      -.=+|..||..|++..
T Consensus        22 ~~dLC~~CF~~G~f~~   37 (45)
T cd02336          22 KYDLCPSCYQEGRFPS   37 (45)
T ss_pred             ccccChHHHhCcCCCC
Confidence            4568999999999854


No 51 
>PF09538 FYDLN_acid:  Protein of unknown function (FYDLN_acid);  InterPro: IPR012644 Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues. The function of members of this family is unknown.
Probab=24.05  E-value=38  Score=25.71  Aligned_cols=23  Identities=22%  Similarity=0.598  Sum_probs=11.5

Q ss_pred             ccccccccCccccceeeecccCC
Q psy12393         95 MGQECIKCNINVYPHKQRPLEKP  117 (155)
Q Consensus        95 ~gQ~C~kC~~~vyPyrq~~l~~~  117 (155)
                      +++.|.+|++.+|=-...||.||
T Consensus         8 tKR~Cp~CG~kFYDLnk~PivCP   30 (108)
T PF09538_consen    8 TKRTCPSCGAKFYDLNKDPIVCP   30 (108)
T ss_pred             CcccCCCCcchhccCCCCCccCC
Confidence            34555555555555544554443


No 52 
>COG4332 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=23.98  E-value=51  Score=28.12  Aligned_cols=52  Identities=29%  Similarity=0.565  Sum_probs=37.2

Q ss_pred             cccCCCCCCceeeeeccCCCcccccCCCCCCCchhhHhhhhhhhcCCCCCCCCCCCCcc-cceeeeecccCcCccc
Q psy12393         13 KKSFKQPPSAYLCHLCFVGGHYITDCPLFNMSPFSKYRQLFLFQARPKGEGLTPYQGKK-RCFGEYKCSKCKRKWM   87 (155)
Q Consensus        13 ~~~~~~pp~~y~ch~c~~~ghyi~dcp~~~~~~~~~~r~~~~~~~rp~~~~~TPyQg~k-R~fG~F~Ck~C~~~Ws   87 (155)
                      -.|-..|||.-.|..|+.+--|+  |-                     +.-...=||+. -.+--|+|..|+++|.
T Consensus         8 Itp~~~pq~~k~C~~Cg~kr~f~--cS---------------------g~fRvNAq~K~LDvWlIYkC~~Cd~tWN   60 (203)
T COG4332           8 ITPVGAPQPAKRCNSCGVKRAFT--CS---------------------GKFRVNAQGKVLDVWLIYKCTHCDYTWN   60 (203)
T ss_pred             eccccCChhhhhCcccCCcceee--ec---------------------CcEEEcCCCcEEEEEEEEEeeccCCccc
Confidence            35778899999999999887765  22                     12123345433 2788999999999995


No 53 
>PF04828 GFA:  Glutathione-dependent formaldehyde-activating enzyme;  InterPro: IPR006913 The GFA family consists mainly of glutathione-dependent formaldehyde-activating enzymes, but also includes centromere protein V and a fission yeast protein described as uncharacterised lyase. Glutathione-dependent formaldehyde-activating enzyme catalyse the condensation of formaldehyde and glutathione to S-hydroxymethylglutathione.  All known members of this family contain 5 strongly conserved cysteine residues.; GO: 0016846 carbon-sulfur lyase activity, 0008152 metabolic process; PDB: 3FAC_B 1XA8_A 1X6M_B.
Probab=23.31  E-value=30  Score=23.01  Aligned_cols=13  Identities=15%  Similarity=0.521  Sum_probs=9.3

Q ss_pred             ccccccCccccce
Q psy12393         97 QECIKCNINVYPH  109 (155)
Q Consensus        97 Q~C~kC~~~vyPy  109 (155)
                      .+|.+|++.++=.
T Consensus        49 ~FC~~CGs~l~~~   61 (92)
T PF04828_consen   49 YFCPTCGSPLFSE   61 (92)
T ss_dssp             EEETTT--EEEEE
T ss_pred             cccCCCCCeeecc
Confidence            7999999999855


No 54 
>PRK00295 hypothetical protein; Provisional
Probab=23.10  E-value=53  Score=22.79  Aligned_cols=22  Identities=14%  Similarity=0.350  Sum_probs=12.2

Q ss_pred             hhhhhhhcc--cccccCCCCCCce
Q psy12393          2 IVDSLCDLH--LEKKSFKQPPSAY   23 (155)
Q Consensus         2 ~~~~~~~~~--~~~~~~~~pp~~y   23 (155)
                      |++++.++.  +.....-.|||+|
T Consensus        45 L~~rl~~~~~~~~~~~~e~~PPHY   68 (68)
T PRK00295         45 LIKRQEEMVGQFGSFEEEAPPPHY   68 (68)
T ss_pred             HHHHHHHhhccCCCCCCCCCcCCC
Confidence            344555543  1233445799988


No 55 
>PHA00732 hypothetical protein
Probab=22.62  E-value=22  Score=25.37  Aligned_cols=31  Identities=19%  Similarity=0.354  Sum_probs=21.4

Q ss_pred             eecccCcCccccceEEec------ccccccccCcccc
Q psy12393         77 YKCSKCKRKWMSGNSWAN------MGQECIKCNINVY  107 (155)
Q Consensus        77 F~Ck~C~~~WsSaNsWan------~gQ~C~kC~~~vy  107 (155)
                      |.|..|++.+.+..+...      .+..|..|++...
T Consensus         2 y~C~~Cgk~F~s~s~Lk~H~r~~H~~~~C~~CgKsF~   38 (79)
T PHA00732          2 FKCPICGFTTVTLFALKQHARRNHTLTKCPVCNKSYR   38 (79)
T ss_pred             ccCCCCCCccCCHHHHHHHhhcccCCCccCCCCCEeC
Confidence            679999999887554433      1357888887654


No 56 
>KOG4602|consensus
Probab=22.50  E-value=42  Score=30.14  Aligned_cols=22  Identities=41%  Similarity=0.839  Sum_probs=18.7

Q ss_pred             ceeeeeccCCC---cccccCCCCCC
Q psy12393         22 AYLCHLCFVGG---HYITDCPLFNM   43 (155)
Q Consensus        22 ~y~ch~c~~~g---hyi~dcp~~~~   43 (155)
                      .|.|.+|+..|   |-|+-||.-+.
T Consensus       268 ~YVCPiCGATgDnAHTiKyCPl~~~  292 (318)
T KOG4602|consen  268 SYVCPICGATGDNAHTIKYCPLAFG  292 (318)
T ss_pred             hhcCccccccCCcccceecccccCC
Confidence            59999999988   89999996443


No 57 
>smart00531 TFIIE Transcription initiation factor IIE.
Probab=22.16  E-value=32  Score=26.59  Aligned_cols=35  Identities=23%  Similarity=0.483  Sum_probs=25.0

Q ss_pred             eeecccCcCccccceEEec---cc-ccccccCcccccee
Q psy12393         76 EYKCSKCKRKWMSGNSWAN---MG-QECIKCNINVYPHK  110 (155)
Q Consensus        76 ~F~Ck~C~~~WsSaNsWan---~g-Q~C~kC~~~vyPyr  110 (155)
                      .|.|+.|+.+|+..-+=..   .+ -.|..|+..+..+-
T Consensus        99 ~Y~Cp~C~~~y~~~ea~~~~d~~~~f~Cp~Cg~~l~~~d  137 (147)
T smart00531       99 YYKCPNCQSKYTFLEANQLLDMDGTFTCPRCGEELEEDD  137 (147)
T ss_pred             EEECcCCCCEeeHHHHHHhcCCCCcEECCCCCCEEEEcC
Confidence            6999999999996432211   12 67999998887654


No 58 
>PF06836 DUF1240:  Protein of unknown function (DUF1240);  InterPro: IPR010665 This family consists of a number of hypothetical putative membrane proteins which seem to be specific to Yersinia pestis. The function of this family is unknown.
Probab=21.31  E-value=61  Score=24.26  Aligned_cols=27  Identities=30%  Similarity=0.543  Sum_probs=21.5

Q ss_pred             cceeeeecccCcCccccceEEeccccccc
Q psy12393         72 RCFGEYKCSKCKRKWMSGNSWANMGQECI  100 (155)
Q Consensus        72 R~fG~F~Ck~C~~~WsSaNsWan~gQ~C~  100 (155)
                      +..|+..|.+=  .|+|.|.|+-..-.|+
T Consensus        69 ~~~gY~~C~k~--Swmspn~YVKdi~LCk   95 (95)
T PF06836_consen   69 KSEGYLVCPKI--SWMSPNTYVKDISLCK   95 (95)
T ss_pred             ccCCcEECCcc--cccCCceEECchhhcC
Confidence            46899999764  7999999988766663


No 59 
>PF01155 HypA:  Hydrogenase expression/synthesis hypA family;  InterPro: IPR000688 Bacterial membrane-bound nickel-dependent hydrogenases requires a number of accessory proteins which are involved in their maturation. The exact role of these proteins is not yet clear, but some seem to be required for the incorporation of the nickel ions []. One of these proteins is generally known as hypA. It is a protein of about 12 to 14 kDa that contains, in its C-terminal region, four conserved cysteines that form a zinc-finger like motif. Escherichia coli has two proteins that belong to this family, hypA and hybF. A homologue, MJ0214, has also been found in a number of archaeal species, including the genome of Methanocaldococcus jannaschii (Methanococcus jannaschii).; GO: 0016151 nickel ion binding, 0006464 protein modification process; PDB: 2KDX_A 3A44_D 3A43_B.
Probab=20.11  E-value=41  Score=25.08  Aligned_cols=49  Identities=16%  Similarity=0.338  Sum_probs=27.0

Q ss_pred             hhhhhhhcCCCCCCCCCCCCc----ccceeeeecccCcCccccceEEecccccccccCcc
Q psy12393         50 RQLFLFQARPKGEGLTPYQGK----KRCFGEYKCSKCKRKWMSGNSWANMGQECIKCNIN  105 (155)
Q Consensus        50 r~~~~~~~rp~~~~~TPyQg~----kR~fG~F~Ck~C~~~WsSaNsWan~gQ~C~kC~~~  105 (155)
                      .++|.|.+--+   -|+..|-    ...-+.++|..|+..|.....-    -.|-.|+..
T Consensus        43 ~L~f~f~~~~~---~T~~e~a~L~Ie~~p~~~~C~~Cg~~~~~~~~~----~~CP~Cgs~   95 (113)
T PF01155_consen   43 ALRFAFEVLAE---GTILEGAELEIEEVPARARCRDCGHEFEPDEFD----FSCPRCGSP   95 (113)
T ss_dssp             HHHHHHHHHHC---CSTTTT-EEEEEEE--EEEETTTS-EEECHHCC----HH-SSSSSS
T ss_pred             HHHHHHHHHhC---CCCccCCEEEEEecCCcEECCCCCCEEecCCCC----CCCcCCcCC
Confidence            34455543322   2566553    2456789999999999754332    449999865


No 60 
>smart00291 ZnF_ZZ Zinc-binding domain, present in Dystrophin, CREB-binding protein. Putative zinc-binding domain present in dystrophin-like proteins,  and CREB-binding protein/p300 homologues. The ZZ in dystrophin appears to bind calmodulin. A missense mutation of one of the conserved cysteines in dystrophin results in a patient with Duchenne muscular dystrophy [3].
Probab=20.06  E-value=1.2e+02  Score=18.98  Aligned_cols=34  Identities=26%  Similarity=0.500  Sum_probs=22.1

Q ss_pred             cccccccCccccceeeecccCCCCCCCCCCCCCChhhhhHHHhhcc
Q psy12393         96 GQECIKCNINVYPHKQRPLEKPDGLDVSDQSKVHPMYLCEKCKQLG  141 (155)
Q Consensus        96 gQ~C~kC~~~vyPyrq~~l~~~~k~~~~d~krPHpQ~LCgkCK~lg  141 (155)
                      +..|..|+..|.-.+.+-+.+++            -+||..|-..|
T Consensus         4 ~~~C~~C~~~i~g~ry~C~~C~d------------~dlC~~Cf~~~   37 (44)
T smart00291        4 SYSCDTCGKPIVGVRYHCLVCPD------------YDLCQSCFAKG   37 (44)
T ss_pred             CcCCCCCCCCCcCCEEECCCCCC------------ccchHHHHhCc
Confidence            34577777777666666444443            47888887755


Done!