Diaphorina citri psyllid: psy12393

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-----
DIVDSLCDLHLEKKSFKQPPSAYLCHLCFVGGHYITDCPLFNMSPFSKYRQLFLFQARPKGEGLTPYQGKKRCFGEYKCSKCKRKWMSGNSWANMGQECIKCNINVYPHKQRPLEKPDGLDVSDQSKVHPMYLCEKCKQLGYYCRKYCTPSSVRR
cHHHHHHHHcccccccccccccccEEEcccccCEECccccccccccccHHHHHHcccccccccccccccccccccEEEccccccccccccCEcccccccccccccccCCccCCcccccccccccccccccHHHHHHHHHcccccccccccccccc
***DSLCDLHL********PSAYLCHLCFVGGHYITDCPLFNMSPFSKYRQLFLFQARPKGEGLTPYQGKKRCFGEYKCSKCKRKWMSGNSWANMGQECIKCNINVYPHKQ****************VHPMYLCEKCKQLGYYCRKYCTPS*V**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DIVDSLCDLHLEKKSFKQPPSAYLCHLCFVGGHYITDCPLFNMSPFSKYRQLFLFQARPKGEGLTPYQGKKRCFGEYKCSKCKRKWMSGNSWANMGQECIKCNINVYPHKQRPLEKPDGLDVSDQSKVHPMYLCEKCKQLGYYCRKYCTPSSVRR

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Zinc finger CCHC domain-containing protein 24 confidentB2RVL6
Zinc finger CCHC domain-containing protein 24 confidentQ8N2G6

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0014013 [BP]regulation of gliogenesisprobableGO:0030154, GO:0007275, GO:0044699, GO:0050767, GO:0048869, GO:0060284, GO:0050789, GO:0008150, GO:0065007, GO:0032502, GO:0032501, GO:0050793, GO:0009987, GO:0050794, GO:0045595, GO:0044763, GO:0051239, GO:0022008, GO:0048699, GO:0007399, GO:0044707, GO:0048856, GO:0051960, GO:2000026, GO:0048731
GO:0003676 [MF]nucleic acid bindingprobableGO:0097159, GO:0003674, GO:1901363, GO:0005488
GO:0008270 [MF]zinc ion bindingprobableGO:0043169, GO:0046914, GO:0043167, GO:0003674, GO:0005488, GO:0046872

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2YSA, chain A
Confidence level:confident
Coverage over the Query: 18-46
View the alignment between query and template
View the model in PyMOL